Timeless circadian clock

Overview
NameTimeless circadian clock
Smed IDSMED30017903
Length (bp)4060
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Timeless circadian clock (SMED30017903) t-SNE clustered cells

Violin plots show distribution of expression levels for Timeless circadian clock (SMED30017903) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Timeless circadian clock (SMED30017903) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Timeless circadian clock (SMED30017903) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017903

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017903SMESG000030310.1 SMESG000030309.1 SMESG000030307.1 SmedASXL_013832SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30017903SMESG000030310.1 SMESG000030309.1 SMESG000030307.1 SmedASXL_013832SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30017903SMESG000030309.1 dd_Smed_v4_16022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017903SMESG000030309.1 Contig46866uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017903SMESG000030309.1 Contig46866newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30017903SMESG000030309.1 dd_Smed_v4_16022_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30017903SMESG000030310.1 SMESG000030307.1 dd_Smed_v4_19257_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30017903SMESG000030307.1 dd_Smed_v4_29222_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017903SMESG000030310.1 SMESG000030309.1 SMESG000030307.1 SMED30017903smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30017903SMESG000030310.1 SMESG000030307.1 SMED_34337_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30017903SMESG000030310.1 SMESG000030307.1 SMED_34337_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Timeless circadian clock vs. Ensembl Human
Match: TIMELESS (timeless circadian regulator [Source:HGNC Symbol;Acc:HGNC:11813])

HSP 1 Score: 325.479 bits (833), Expect = 8.170e-92
Identity = 306/996 (30.72%), Postives = 501/996 (50.30%), Query Frame = 1
Query:   88 DLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESAS----DQQLRRQRELELMAKSA--ENPRVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLM-SAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKE----WTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNPWTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKN---SKLIPN 3018
            +L A  + LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  ++ D  LFD VIRL++NLTQP+ +CF   LPK+      F++V   LQ  K  F       VLS  + ++    WE+R E+++LL+ERIL+L+RNILH+  +       +   S HD L+  +  SG  DLL++L+++  EE+++ H LEI+SLMFR+Q+ E +  +      +  S    + ++ RQRE+      A     R  RFGG++ +Q +K+   R  I+H   H++     DL +  K  +  K +   +E +   +S   V   L++FC  FL+  YN LM +    L R++ Q  DETYY+WAL FFM   R     P  VSET+++  FH++ Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F    Q R+FLR L+E + L +K+L+    F         + K++K  K K    +Q I +  +PS  ++    +  +W  + E L   A N E+ +        D ++P      +  SE PV+ Q   A+  +Q  L    + +A+ +    +++WPE D  +    D   EEEI++LK I+ A         +   +   E G   E+E E E ++E++  VQV E  F+F  +++ F    VV  + +L      N   TN+ +++++H +A   K   +L+QL +F  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY + DD +       W+ E E  L  L+    ++D+  G D    I +  +   +TR+QI++ LV +GL  S K+ + K      WT D++  L  L EE RD    +  IM  + A        RSR  ++ K+L LGLV  + +L  + +    S ++PN
Sbjct:    9 ELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGN-LPKEPSFRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKIDDDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLMFRDQNPEQLAGVGQGRLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKGLHNLRNYSSDLGKQPK--KVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGSVKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRELFLALFRKFDERCQPRSFLRDLVETTHLFLKMLE---RFCRSRGNLVVQNKQKKRRKKKKKVLDQAIVSGNVPSSPEE----VEAVWPALAEQLQCCAQNSELSM--------DSVVP-----FDAASEVPVEEQRAEAMVRIQDCLLAGQAPQALTLLRSAREVWPEGD--VFGSQDISPEEEIQLLKQILSAP--------LPRQQGPEERGAE-EEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSAHTNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFAKYILGKFFALAAVNQ--KAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLA--NKDV-EGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRLFEEFRDSDDVLGHIMKNITAK-------RSRARIVDKLLALGLVAERRELYKKRQKKLASSILPN 958          
BLAST of Timeless circadian clock vs. Ensembl Human
Match: TIMELESS (timeless circadian regulator [Source:HGNC Symbol;Acc:HGNC:11813])

HSP 1 Score: 324.709 bits (831), Expect = 1.146e-91
Identity = 307/996 (30.82%), Postives = 502/996 (50.40%), Query Frame = 1
Query:   88 DLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESAS----DQQLRRQRELELMAKSA--ENPRVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLM-SAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKE----WTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNPWTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKN---SKLIPN 3018
            +L A  + LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  ++ D  LFD VIRL++NLTQP+ +CF   LPK+      F++V   LQ  K  F       VLS  + ++    WE+R E+++LL+ERIL+L+RNILH+  +     I +   S HD L+  +  SG  DLL++L+++  EE+++ H LEI+SLMFR+Q+ E +  +      +  S    + ++ RQRE+      A     R  RFGG++ +Q +K+   R  I+H   H++     DL +  K  +  K +   +E +   +S   V   L++FC  FL+  YN LM +    L R++ Q  DETYY+WAL FFM   R     P  VSET+++  FH++ Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F    Q R+FLR L+E + L +K+L+    F         + K++K  K K    +Q I +  +PS  ++    +  +W  + E L   A N E+ +        D ++P      +  SE PV+ Q   A+  +Q  L    + +A+ +    +++WPE D  +    D   EEEI++LK I+ A         +   +   E G   E+E E E ++E++  VQV E  F+F  +++ F    VV  + +L      N   TN+ +++++H +A   K   +L+QL +F  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY + DD +       W+ E E  L  L+    ++D+  G D    I +  +   +TR+QI++ LV +GL  S K+ + K      WT D++  L  L EE RD    +  IM  + A        RSR  ++ K+L LGLV  + +L  + +    S ++PN
Sbjct:    9 ELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGN-LPKEPSFRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKIDDDA-SAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLMFRDQNPEQLAGVGQGRLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKGLHNLRNYSSDLGKQPK--KVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGSVKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRELFLALFRKFDERCQPRSFLRDLVETTHLFLKMLE---RFCRSRGNLVVQNKQKKRRKKKKKVLDQAIVSGNVPSSPEE----VEAVWPALAEQLQCCAQNSELSM--------DSVVP-----FDAASEVPVEEQRAEAMVRIQDCLLAGQAPQALTLLRSAREVWPEGD--VFGSQDISPEEEIQLLKQILSAP--------LPRQQGPEERGAE-EEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSAHTNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFAKYILGKFFALAAVNQ--KAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLA--NKDV-EGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRLFEEFRDSDDVLGHIMKNITAK-------RSRARIVDKLLALGLVAERRELYKKRQKKLASSILPN 957          
BLAST of Timeless circadian clock vs. Ensembl Celegans
Match: tim-1 (pep chromosome:WBcel235:III:12240403:12250164:-1 gene:WBGene00006571.1 transcript:Y75B8A.22.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tim-1)

HSP 1 Score: 174.866 bits (442), Expect = 1.054e-43
Identity = 175/685 (25.55%), Postives = 338/685 (49.34%), Query Frame = 1
Query:   91 LHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYL-KEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNST--ESASDQQLRRQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPA--IYHHDINWSKIDLTRDRKLRRKA-KNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRF---FMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKES--AVSSYRKLHLVMSAYKELLEFCLMLDNH-QEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDD-GGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE---PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTD--DDNRVEEEIKILKDIMFANKFYKEEDLIK 2091
            +   +  LG  E+ ++ ++ D   S+RD++R+LR + +    R+E G+  ++E  L+ ++K  +     FD+ IRL++NL QP+    + + P D    +++ +++E L+R K+ F D  F   +  +I + ++  E+EDR E   L+VERI++L++ +  IN + S+G      DS HD +++  +ESG    L++++N   E+ F    L+I +L+ +EQ+AE + T     ST  +  ++++ R+  E  ++ ++ +     RFGG++ ++ +K  S   +  ++    N  K +   DRK +++A +N+   + +T  H ++ +V   L++     ++  +N LMK++ + +   Q+Q   +  Y + ++F   F+ + R++ L  E +SE I +  FH    Q   Y++N+ T +   A S   K    + AY EL+     +  H +EE  R  +      +    EY E+   ++  F     S  FLR L+  +   +K+++       +FV   +  K  K +K +   +   +   ++ SE D      L  +W+E    ++  +  EV              PE R     DS+   PVD+Q K A   +Q  LR R    AV ++   + LWPE  +  +TD  D    E++++ L+ ++ A+     +DL K
Sbjct:    5 VQGAVHALGYYEDGKYSREPDCYESIRDLIRYLREDGDDHTARIECGRHNLVEQDLVPMVKCEDLTDDEFDIAIRLMVNLCQPAISTMRGKPPADRDQWKMYWELEENLRRAKTAFSDAHFFTAIKKRIDNYFIDTEYEDRDERLRLVVERIVLLIKYVFSINPDTSEGRRTRIEDSSHDRVIIAFLESGIDKTLMHIANQPREKEFHVTILDIFALILKEQTAEDLATKSEEVSTAEQKKTEEEFRKIIENHVVKETQKRKSFSRFGGSYTIKGLKGISANSSQVVFKPIQNVEKHNFLDDRKAKKRAPRNRRPFEIDTNSHFASSEVRGMLRDMVIRIIETCFNRLMKSSKTTV-FVQVQKTSQINYFFLIKFVLRFVRLSRQDHLL-ERISECIGVEAFHENNVQLTEYVENATTLKGVEAKSHGLKAQYALGAYNELVLLHRYIYEHAKEENERKFAKRALEHIVNVEEYRELPIFIIKKFSSSVLSNNFLRELVLTTHHYMKLVE-------RFVKTGALKKVTKKVKVRKATKKSKMSEEDVRSEFDGMSKKDLDRLWEESKGLVLQILKKEV--------------PEMRGMNPIDSQLDVPVDAQQKFAKLSIQRSLRSRGFPAAVGLYHASRALWPESFKRGLTDFQDSPGEEDQLQELEQLLKADMKKVAKDLKK 666          
BLAST of Timeless circadian clock vs. Ensembl Celegans
Match: tim-1 (pep chromosome:WBcel235:III:12240367:12250164:-1 gene:WBGene00006571.1 transcript:Y75B8A.22.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tim-1)

HSP 1 Score: 174.866 bits (442), Expect = 1.054e-43
Identity = 175/685 (25.55%), Postives = 338/685 (49.34%), Query Frame = 1
Query:   91 LHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYL-KEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNST--ESASDQQLRRQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPA--IYHHDINWSKIDLTRDRKLRRKA-KNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRF---FMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKES--AVSSYRKLHLVMSAYKELLEFCLMLDNH-QEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDD-GGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE---PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTD--DDNRVEEEIKILKDIMFANKFYKEEDLIK 2091
            +   +  LG  E+ ++ ++ D   S+RD++R+LR + +    R+E G+  ++E  L+ ++K  +     FD+ IRL++NL QP+    + + P D    +++ +++E L+R K+ F D  F   +  +I + ++  E+EDR E   L+VERI++L++ +  IN + S+G      DS HD +++  +ESG    L++++N   E+ F    L+I +L+ +EQ+AE + T     ST  +  ++++ R+  E  ++ ++ +     RFGG++ ++ +K  S   +  ++    N  K +   DRK +++A +N+   + +T  H ++ +V   L++     ++  +N LMK++ + +   Q+Q   +  Y + ++F   F+ + R++ L  E +SE I +  FH    Q   Y++N+ T +   A S   K    + AY EL+     +  H +EE  R  +      +    EY E+   ++  F     S  FLR L+  +   +K+++       +FV   +  K  K +K +   +   +   ++ SE D      L  +W+E    ++  +  EV              PE R     DS+   PVD+Q K A   +Q  LR R    AV ++   + LWPE  +  +TD  D    E++++ L+ ++ A+     +DL K
Sbjct:    5 VQGAVHALGYYEDGKYSREPDCYESIRDLIRYLREDGDDHTARIECGRHNLVEQDLVPMVKCEDLTDDEFDIAIRLMVNLCQPAISTMRGKPPADRDQWKMYWELEENLRRAKTAFSDAHFFTAIKKRIDNYFIDTEYEDRDERLRLVVERIVLLIKYVFSINPDTSEGRRTRIEDSSHDRVIIAFLESGIDKTLMHIANQPREKEFHVTILDIFALILKEQTAEDLATKSEEVSTAEQKKTEEEFRKIIENHVVKETQKRKSFSRFGGSYTIKGLKGISANSSQVVFKPIQNVEKHNFLDDRKAKKRAPRNRRPFEIDTNSHFASSEVRGMLRDMVIRIIETCFNRLMKSSKTTV-FVQVQKTSQINYFFLIKFVLRFVRLSRQDHLL-ERISECIGVEAFHENNVQLTEYVENATTLKGVEAKSHGLKAQYALGAYNELVLLHRYIYEHAKEENERKFAKRALEHIVNVEEYRELPIFIIKKFSSSVLSNNFLRELVLTTHHYMKLVE-------RFVKTGALKKVTKKVKVRKATKKSKMSEEDVRSEFDGMSKKDLDRLWEESKGLVLQILKKEV--------------PEMRGMNPIDSQLDVPVDAQQKFAKLSIQRSLRSRGFPAAVGLYHASRALWPESFKRGLTDFQDSPGEEDQLQELEQLLKADMKKVAKDLKK 666          
BLAST of Timeless circadian clock vs. Ensembl Fly
Match: timeout (gene:FBgn0038118 transcript:FBtr0082712)

HSP 1 Score: 237.269 bits (604), Expect = 5.302e-63
Identity = 269/983 (27.37%), Postives = 491/983 (49.95%), Query Frame = 1
Query:   70 MEKYLSDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMD--TLKSSNSTESASDQQLRRQRELELMAKSAENP--RVKRFGGTFELQDIKTESGRPAIYHHDINW-SKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQAD-DETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWV-----YQQAMIYIDNSKTKESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEK-YRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLN-LPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPK-EWTDXXXXXXXXXXXXXQHEDILPGFDKASV--IESRFSDKNKTRRQILNRLVTLGLISSA---KELKNKKRENNPWTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGL 2961
            M   L+D+ A    LG ++ +++  + D    L+ ++  LRR+ +  E R  LG+ KV++  L+ +L  Y +   L DL+IRLL+ LT P+ + +++  PKD  G ++F+++ ++LQ  K+ F        L  K+       +  RSE+++LL+ERIL+L+RN+L +  N      A+   S HD ++  + ++G  DL++++ ++ +EE+F  H LEI+ L+FREQSAE +   +L+ S S +    Q+L   R  E   + A  P  R  RFGGT+ ++++K+ S R  I H  +   S ID  R+++ ++++   +  +E     +S   V   L+E+C   L+  YN L++    +L+R    +  D++Y LWA+RFFME  R + L  + VSE++++  FHWV     +   MI  D  + +  A    ++LH+ +  ++ELL+  L L   +++   R L   + + V Y  EY E    LL ++     ++ FLR ++E + + IK+++       +F       + +K  +  + ++ Q     + P+        L   W E+   + S ++ E+E+P +  P+ +D              + +D Q +  +  +   LR     +A+A+    +++WPE +           E+E+ +L++I  +N    E +  +  K+  +    +ED++    + E+ ++  + E  F F  F R   +P +V    ++  D    P  +    + I+H IA   K   +L+Q KLF  F +     +  +   + L++  IF+++KF E    N K+  E+LF K I EA+E   GY ++ +   K  WT+E E EL  LFEE Q     P  DK  +  I     DK + RR +L +L  LGL+  A   +  K+ +   N W  +E   L  L ++ R +P  ++ ++N          + RS+  +IK++L++ L
Sbjct:    1 MSILLADIDATCAALGYSDGQKYQAEPDAAEGLKHLIWILRRDLDNHEYRRHLGRSKVLQTDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYREGAPKDNHGRKVFMELIDILQGYKAAFAKDKVWSALFEKLKQALEIAFAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADNDASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLLFREQSAESLADASLQRSLSEKQRDQQELLAARRRERARRQARPPPGRHSRFGGTYVIRNMKSVSDRDVICHQALERVSSIDFDREKQQQKRSHRHIQ-EEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRVLERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIVSDKKQARLWA----KRLHVALLTFRELLQSLLALQKLKDDNNARALFDMLLNNVCYVLEYRETVLHLLMNYNEAHSTKVFLRDVVETANVFIKMME-------RFCQDSVVVQDKKRGRGASRKKKQAATKSKPPAAPQPTEEELSSKWAELATEVCSLLSTELEMPEDEQPLPFDA----------ASEKSIDDQREDCMIRINKLLRSEKLDQAIALLRAAREVWPENEVFGAIS--AAPEDELLLLREIFMSNITTVESEDKENEKDQKQDEYEDEDDDLDNEEYEEQDN-GLTEKTFKFDDFARRLLNPKIVRACTLVLSDWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFS--VERDVHQEELRRLAIFVVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAWTEEQESELRFLFEENQRN---PETDKDVIDWILDNLVDKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQSGKNVWQPEEDDELRSLYDQHRIEPDCLERLVNEFA-------ERRSKQQIIKRMLQIHL 946          
BLAST of Timeless circadian clock vs. Ensembl Fly
Match: tim (gene:FBgn0014396 transcript:FBtr0333253)

HSP 1 Score: 56.6102 bits (135), Expect = 1.803e-7
Identity = 48/217 (22.12%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  976 RDRKLRRKAKNQVHNKEETYIHKSTDK-VLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYID----NSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLD--NHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFG 1602
            R +KL +++K+ + N +    H  TD  + N L+EF   FL  GY+ L++     L        D +++ W + +F++   + +L  E +   +T  V  ++  + +   +    N++ + S +  Y R++HLV++A +E L+     +   H  E  +     ++ ++   S+   ++ +LL  F P   S+ +L+ L+  + +++ IL    + G
Sbjct:  553 RRKKLVKRSKSSLINMKGLVQHTPTDDDISNLLKEFTVDFLLKGYSYLVEELHMQLLSNAKVPIDTSHFFWLVTYFLKFAAQLELDMEHIDTILTYDVLSYLTYEGVSLCEQLELNARQEGSDLKPYLRRMHLVVTAIREFLQAIDTYNKVTHLNEDDKAHLRQLQLQISEMSDLRCLFVLLLRRFNPSIHSKQYLQDLVVTNHILLLILDSSAKLG 769          
BLAST of Timeless circadian clock vs. Ensembl Fly
Match: tim (gene:FBgn0014396 transcript:FBtr0333259)

HSP 1 Score: 56.6102 bits (135), Expect = 1.805e-7
Identity = 48/217 (22.12%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  976 RDRKLRRKAKNQVHNKEETYIHKSTDK-VLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYID----NSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLD--NHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFG 1602
            R +KL +++K+ + N +    H  TD  + N L+EF   FL  GY+ L++     L        D +++ W + +F++   + +L  E +   +T  V  ++  + +   +    N++ + S +  Y R++HLV++A +E L+     +   H  E  +     ++ ++   S+   ++ +LL  F P   S+ +L+ L+  + +++ IL    + G
Sbjct:  521 RRKKLVKRSKSSLINMKGLVQHTPTDDDISNLLKEFTVDFLLKGYSYLVEELHMQLLSNAKVPIDTSHFFWLVTYFLKFAAQLELDMEHIDTILTYDVLSYLTYEGVSLCEQLELNARQEGSDLKPYLRRMHLVVTAIREFLQAIDTYNKVTHLNEDDKAHLRQLQLQISEMSDLRCLFVLLLRRFNPSIHSKQYLQDLVVTNHILLLILDSSAKLG 737          
BLAST of Timeless circadian clock vs. Ensembl Fly
Match: tim (gene:FBgn0014396 transcript:FBtr0333255)

HSP 1 Score: 56.6102 bits (135), Expect = 1.815e-7
Identity = 48/217 (22.12%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  976 RDRKLRRKAKNQVHNKEETYIHKSTDK-VLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYID----NSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLD--NHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFG 1602
            R +KL +++K+ + N +    H  TD  + N L+EF   FL  GY+ L++     L        D +++ W + +F++   + +L  E +   +T  V  ++  + +   +    N++ + S +  Y R++HLV++A +E L+     +   H  E  +     ++ ++   S+   ++ +LL  F P   S+ +L+ L+  + +++ IL    + G
Sbjct:  553 RRKKLVKRSKSSLINMKGLVQHTPTDDDISNLLKEFTVDFLLKGYSYLVEELHMQLLSNAKVPIDTSHFFWLVTYFLKFAAQLELDMEHIDTILTYDVLSYLTYEGVSLCEQLELNARQEGSDLKPYLRRMHLVVTAIREFLQAIDTYNKVTHLNEDDKAHLRQLQLQISEMSDLRCLFVLLLRRFNPSIHSKQYLQDLVVTNHILLLILDSSAKLG 769          
BLAST of Timeless circadian clock vs. Ensembl Fly
Match: tim (gene:FBgn0014396 transcript:FBtr0077567)

HSP 1 Score: 56.6102 bits (135), Expect = 2.055e-7
Identity = 48/217 (22.12%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  976 RDRKLRRKAKNQVHNKEETYIHKSTDK-VLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYID----NSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLD--NHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFG 1602
            R +KL +++K+ + N +    H  TD  + N L+EF   FL  GY+ L++     L        D +++ W + +F++   + +L  E +   +T  V  ++  + +   +    N++ + S +  Y R++HLV++A +E L+     +   H  E  +     ++ ++   S+   ++ +LL  F P   S+ +L+ L+  + +++ IL    + G
Sbjct:  553 RRKKLVKRSKSSLINMKGLVQHTPTDDDISNLLKEFTVDFLLKGYSYLVEELHMQLLSNAKVPIDTSHFFWLVTYFLKFAAQLELDMEHIDTILTYDVLSYLTYEGVSLCEQLELNARQEGSDLKPYLRRMHLVVTAIREFLQAIDTYNKVTHLNEDDKAHLRQLQLQISEMSDLRCLFVLLLRRFNPSIHSKQYLQDLVVTNHILLLILDSSAKLG 769          
BLAST of Timeless circadian clock vs. Ensembl Zebrafish
Match: timeless (timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE-030131-8978])

HSP 1 Score: 329.331 bits (843), Expect = 3.177e-93
Identity = 307/989 (31.04%), Postives = 506/989 (51.16%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQLRRQRELELMAK--SAE--------NPRVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFS--DKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E +  +IR +LG  ++++N L+ ++  +  D  LFD  IRL++NLTQP+ +CF + +P D      F++V   LQ  K  F D     VLS  + ++   +WE R E+++LL+ERIL+L+RN+LH+  +  +    +   S HD L+  +  SG  DLL +L+ A++E++++FH LEIISLMFR+Q+AE    L S+    SA ++Q +  +ELEL+ +  +AE          R  RF G++ ++ +K+      +YH  + N+        + +RR  K +   K+     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYY+WAL FFM   R     P+ VSETI+I  FH++ +    Y +   T +S  +S+ R++HL + AY+ELL     +D  ++E  R  S+ IKS +FY  E+ EI+  LL  +    Q R+FLR L+E + L +++L+       +F  K       +  + K  + +Q    ME  +E       L   W  + E L ++     +LP +L    +  +P    S  P    V+ Q   AL  +Q  L  R   EA+++    + +WPE D       +   EEE+++LK I+F           KL + +     VEE++ +   ++E++ SV V E  F+F  FI+ F HPN+V  + +L      N P TN+ + R++H +A   K   +LYQL +F+ FNK L DP +   +        +          N   K  +E+LF KN+    E   GY+   + + K+     EEE        +H+D   G     V+E+       ++TRR++++ LV++GL+ S K+LK +K+      WT +++  L  L E+ +D    +  I+  + A        RSR  ++ KIL +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLEGDVYHKEPDCLESVKDLIRYLRHEDDARDIRQQLGAGQILQNDLLPIITQHTQDKPLFDACIRLMVNLTQPALLCFGK-IPDDPAFRHHFLQVTSYLQAYKEAFADEKVFTVLSETLYNLLQLDWEQRDEEDNLLIERILLLVRNVLHVPADPYEEKNVDDDASVHDKLLWAIHISGLDDLLKFLACAQSEQQWSFHILEIISLMFRDQTAEL---LVSAGQMRSAQEKQ-KDMQELELLRQKETAEKRSRTLMRGTRHSRFRGSYVIEGLKSIGENDVVYHQGLHNFKSYSHDLGKAVRRVPKRKQMAKDSDSHRRSALNVRLFLREFCIDFLENCYNRLMYLVKEGLIRERAQQHDETYYMWALTFFMAFNRLQNFKPDVVSETISIRTFHFIEKNITNYYEMMLTDKSDATSWSRRMHLALKAYQELLLTVNEMDRSKDENIRHSSSVIKSNIFYLMEFREIFLTLLRKYDERLQPRSFLRDLVESAHLFLRMLE-------RFC-KGRNNLVVQKKRVKRKKRSQKKPEMETSAED------LEQSWQIVSEELRAS---GFQLPESLT---EGAVPFDAASDTP----VNEQRTEALVRIQDCLMSRAGPEALSLLRAARAVWPEGD--TFGSVEVEPEEELELLKQILFT----------KLPRTVPLDSAVEEEDGDELVEEEELESVAVSETEFNFLDFIKRFAHPNIVRPYVILLRSYSQNSPHTNHCVTRMLHRLAVDLKMEALLYQLSVFSLFNKILGDPAAAAYQELVKFAKYVLNRFFVFAATNN--KAFVELLFWKNVGAVREMTEGYTKDGEGSKKKSKWTPEEEAELQRLYEEHKD--SGV--PDVVETLLPLLSSSRTRREVVSHLVSMGLVDSVKDLKKEKKGTRIVLWTEEQEQELQGLFEDFQDSDDVLGNILKRITAK-------RSRARIVDKILSMGLVSDRKEL 935          
BLAST of Timeless circadian clock vs. Ensembl Zebrafish
Match: timeless (timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE-030131-8978])

HSP 1 Score: 329.331 bits (843), Expect = 3.212e-93
Identity = 307/989 (31.04%), Postives = 506/989 (51.16%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQLRRQRELELMAK--SAE--------NPRVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFS--DKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E +  +IR +LG  ++++N L+ ++  +  D  LFD  IRL++NLTQP+ +CF + +P D      F++V   LQ  K  F D     VLS  + ++   +WE R E+++LL+ERIL+L+RN+LH+  +  +    +   S HD L+  +  SG  DLL +L+ A++E++++FH LEIISLMFR+Q+AE    L S+    SA ++Q +  +ELEL+ +  +AE          R  RF G++ ++ +K+      +YH  + N+        + +RR  K +   K+     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYY+WAL FFM   R     P+ VSETI+I  FH++ +    Y +   T +S  +S+ R++HL + AY+ELL     +D  ++E  R  S+ IKS +FY  E+ EI+  LL  +    Q R+FLR L+E + L +++L+       +F  K       +  + K  + +Q    ME  +E       L   W  + E L ++     +LP +L    +  +P    S  P    V+ Q   AL  +Q  L  R   EA+++    + +WPE D       +   EEE+++LK I+F           KL + +     VEE++ +   ++E++ SV V E  F+F  FI+ F HPN+V  + +L      N P TN+ + R++H +A   K   +LYQL +F+ FNK L DP +   +        +          N   K  +E+LF KN+    E   GY+   + + K+     EEE        +H+D   G     V+E+       ++TRR++++ LV++GL+ S K+LK +K+      WT +++  L  L E+ +D    +  I+  + A        RSR  ++ KIL +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLEGDVYHKEPDCLESVKDLIRYLRHEDDARDIRQQLGAGQILQNDLLPIITQHTQDKPLFDACIRLMVNLTQPALLCFGK-IPDDPAFRHHFLQVTSYLQAYKEAFADEKVFTVLSETLYNLLQLDWEQRDEEDNLLIERILLLVRNVLHVPADPYEEKNVDDDASVHDKLLWAIHISGLDDLLKFLACAQSEQQWSFHILEIISLMFRDQTAEL---LVSAGQMRSAQEKQ-KDMQELELLRQKETAEKRSRTLMRGTRHSRFRGSYVIEGLKSIGENDVVYHQGLHNFKSYSHDLGKAVRRVPKRKQMAKDSDSHRRSALNVRLFLREFCIDFLENCYNRLMYLVKEGLIRERAQQHDETYYMWALTFFMAFNRLQNFKPDVVSETISIRTFHFIEKNITNYYEMMLTDKSDATSWSRRMHLALKAYQELLLTVNEMDRSKDENIRHSSSVIKSNIFYLMEFREIFLTLLRKYDERLQPRSFLRDLVESAHLFLRMLE-------RFC-KGRNNLVVQKKRVKRKKRSQKKPEMETSAED------LEQSWQIVSEELRAS---GFQLPESLT---EGAVPFDAASDTP----VNEQRTEALVRIQDCLMSRAGPEALSLLRAARAVWPEGD--TFGSVEVEPEEELELLKQILFT----------KLPRTVPLDSAVEEEDGDELVEEEELESVAVSETEFNFLDFIKRFAHPNIVRPYVILLRSYSQNSPHTNHCVTRMLHRLAVDLKMEALLYQLSVFSLFNKILGDPAAAAYQELVKFAKYVLNRFFVFAATNN--KAFVELLFWKNVGAVREMTEGYTKDGEGSKKKSKWTPEEEAELQRLYEEHKD--SGV--PDVVETLLPLLSSSRTRREVVSHLVSMGLVDSVKDLKKEKKGTRIVLWTEEQEQELQGLFEDFQDSDDVLGNILKRITAK-------RSRARIVDKILSMGLVSDRKEL 935          
BLAST of Timeless circadian clock vs. Ensembl Zebrafish
Match: timeless (timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE-030131-8978])

HSP 1 Score: 328.561 bits (841), Expect = 9.156e-93
Identity = 307/989 (31.04%), Postives = 506/989 (51.16%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQLRRQRELELMAK--SAE--------NPRVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFS--DKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E +  +IR +LG  ++++N L+ ++  +  D  LFD  IRL++NLTQP+ +CF + +P D      F++V   LQ  K  F D     VLS  + ++   +WE R E+++LL+ERIL+L+RN+LH+  +  +    +   S HD L+  +  SG  DLL +L+ A++E++++FH LEIISLMFR+Q+AE    L S+    SA ++Q +  +ELEL+ +  +AE          R  RF G++ ++ +K+      +YH  + N+        + +RR  K +   K+     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYY+WAL FFM   R     P+ VSETI+I  FH++ +    Y +   T +S  +S+ R++HL + AY+ELL     +D  ++E  R  S+ IKS +FY  E+ EI+  LL  +    Q R+FLR L+E + L +++L+       +F  K       +  + K  + +Q    ME  +E       L   W  + E L ++     +LP +L    +  +P    S  P    V+ Q   AL  +Q  L  R   EA+++    + +WPE D       +   EEE+++LK I+F           KL + +     VEE++ +   ++E++ SV V E  F+F  FI+ F HPN+V  + +L      N P TN+ + R++H +A   K   +LYQL +F+ FNK L DP +   +        +          N   K  +E+LF KN+    E   GY+   + + K+     EEE        +H+D   G     V+E+       ++TRR++++ LV++GL+ S K+LK +K+      WT +++  L  L E+ +D    +  I+  + A        RSR  ++ KIL +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLEGDVYHKEPDCLESVKDLIRYLRHEDDARDIRQQLGAGQILQNDLLPIITQHTQDKPLFDACIRLMVNLTQPALLCFGK-IPDDPAFRHHFLQVTSYLQAYKEAFADEKVFTVLSETLYNLLQLDWEQRDEEDNLLIERILLLVRNVLHVPADPYEEKNVDDDASVHDKLLWAIHISGLDDLLKFLACAQSEQQWSFHILEIISLMFRDQTAEL---LVSAGQMRSAQEKQ-KDMQELELLRQKETAEKRSRTLMRGTRHSRFRGSYVIEGLKSIGENDVVYHQGLHNFKSYSHDLGKAVRRVPKRKQMAKDSDSHRRSALNVRLFLREFCIDFLENCYNRLMYLVKEGLIRERAQQHDETYYMWALTFFMAFNRLQNFKPDVVSETISIRTFHFIEKNITNYYEMMLTDKSDATSWSRRMHLALKAYQELLLTVNEMDRSKDENIRHSSSVIKSNIFYLMEFREIFLTLLRKYDERLQPRSFLRDLVESAHLFLRMLE-------RFC-KGRNNLVVQKKRVKRKKRSQKKPEMETSAED------LEQSWQIVSEELRAS---GFQLPESLT---EGAVPFDAASDTP----VNEQRTEALVRIQDCLMSRAGPEALSLLRAARAVWPEGD--TFGSVEVEPEEELELLKQILFT----------KLPRTVPLDSAVEEEDGDELVEEEELESVAVSETEFNFLDFIKRFAHPNIVRPYVILLRSYSQNSPHTNHCVTRMLHRLAVDLKMEALLYQLSVFSLFNKILGDPAAAAYQELVKFAKYVLNRFFVFAATNN--KAFVELLFWKNVGAVREMTEGYTKDGEGSKKKSKWTPEEEAELQRLYEEHKD--SGV--PDVVETLLPLLSSSRTRREVVSHLVSMGLVDSVKDLKKEKKGTRIVLWTEEQEQELQGLFEDFQDSDDVLGNILKRITAK-------RSRARIVDKILSMGLVSDRKEL 935          
BLAST of Timeless circadian clock vs. Ensembl Zebrafish
Match: timeless (timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE-030131-8978])

HSP 1 Score: 328.561 bits (841), Expect = 1.057e-92
Identity = 307/989 (31.04%), Postives = 506/989 (51.16%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQLRRQRELELMAK--SAE--------NPRVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFS--DKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E +  +IR +LG  ++++N L+ ++  +  D  LFD  IRL++NLTQP+ +CF + +P D      F++V   LQ  K  F D     VLS  + ++   +WE R E+++LL+ERIL+L+RN+LH+  +  +    +   S HD L+  +  SG  DLL +L+ A++E++++FH LEIISLMFR+Q+AE    L S+    SA ++Q +  +ELEL+ +  +AE          R  RF G++ ++ +K+      +YH  + N+        + +RR  K +   K+     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYY+WAL FFM   R     P+ VSETI+I  FH++ +    Y +   T +S  +S+ R++HL + AY+ELL     +D  ++E  R  S+ IKS +FY  E+ EI+  LL  +    Q R+FLR L+E + L +++L+       +F  K       +  + K  + +Q    ME  +E       L   W  + E L ++     +LP +L    +  +P    S  P    V+ Q   AL  +Q  L  R   EA+++    + +WPE D       +   EEE+++LK I+F           KL + +     VEE++ +   ++E++ SV V E  F+F  FI+ F HPN+V  + +L      N P TN+ + R++H +A   K   +LYQL +F+ FNK L DP +   +        +          N   K  +E+LF KN+    E   GY+   + + K+     EEE        +H+D   G     V+E+       ++TRR++++ LV++GL+ S K+LK +K+      WT +++  L  L E+ +D    +  I+  + A        RSR  ++ KIL +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLEGDVYHKEPDCLESVKDLIRYLRHEDDARDIRQQLGAGQILQNDLLPIITQHTQDKPLFDACIRLMVNLTQPALLCFGK-IPDDPAFRHHFLQVTSYLQAYKEAFADEKVFTVLSETLYNLLQLDWEQRDEEDNLLIERILLLVRNVLHVPADPYEEKNVDDDASVHDKLLWAIHISGLDDLLKFLACAQSEQQWSFHILEIISLMFRDQTAEL---LVSAGQMRSAQEKQ-KDMQELELLRQKETAEKRSRTLMRGTRHSRFRGSYVIEGLKSIGENDVVYHQGLHNFKSYSHDLGKAVRRVPKRKQMAKDSDSHRRSALNVRLFLREFCIDFLENCYNRLMYLVKEGLIRERAQQHDETYYMWALTFFMAFNRLQNFKPDVVSETISIRTFHFIEKNITNYYEMMLTDKSDATSWSRRMHLALKAYQELLLTVNEMDRSKDENIRHSSSVIKSNIFYLMEFREIFLTLLRKYDERLQPRSFLRDLVESAHLFLRMLE-------RFC-KGRNNLVVQKKRVKRKKRSQKKPEMETSAED------LEQSWQIVSEELRAS---GFQLPESLT---EGAVPFDAASDTP----VNEQRTEALVRIQDCLMSRAGPEALSLLRAARAVWPEGD--TFGSVEVEPEEELELLKQILFT----------KLPRTVPLDSAVEEEDGDELVEEEELESVAVSETEFNFLDFIKRFAHPNIVRPYVILLRSYSQNSPHTNHCVTRMLHRLAVDLKMEALLYQLSVFSLFNKILGDPAAAAYQELVKFAKYVLNRFFVFAATNN--KAFVELLFWKNVGAVREMTEGYTKDGEGSKKKSKWTPEEEAELQRLYEEHKD--SGV--PDVVETLLPLLSSSRTRREVVSHLVSMGLVDSVKDLKKEKKGTRIVLWTEEQEQELQGLFEDFQDSDDVLGNILKRITAK-------RSRARIVDKILSMGLVSDRKEL 935          
BLAST of Timeless circadian clock vs. Ensembl Xenopus
Match: hsph1 (heat shock protein family H (Hsp110) member 1 [Source:Xenbase;Acc:XB-GENE-965196])

HSP 1 Score: 338.576 bits (867), Expect = 6.117e-96
Identity = 321/991 (32.39%), Postives = 516/991 (52.07%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNST-ESASD---QQLRRQRELELMAKSA--ENPRVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSA-VNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY-----SNSDDNNPK-EWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E+  + K+ D + S++D++R+LR E +  +IR +LG  ++++N LI L+  ++ND  LFD VIRL++N+TQP+ +CF + +P+D      F++V   LQ  K  F +     VLS K+ D+   EWE R E+ +LL+ERIL+L+RNILH+  +  +    +   S HD ++  +  SG  DL+ +L+++E E++++ H LE +SLMFR+Q AE +     + ST E  +D    ++ RQRE       A     R  RFGG++ +Q +K+   +  IYH  I N+        +++RR  K +   KE     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYYLW++ FFM   R  +  PE VSET++I  FH++ Q    Y +   T K+ A S  R++HL + AY+ELL     +D+ +EE  R  S  IK+ +FY  EY E++  L   F   KQ R+FL+ L+E + L +K+L+       KF   K     +K    +  +++   G  E+   Q      L  IW  + E L +  VN E     NLP   D ++P      +  SE PV+ Q   AL  +Q  L    + EA+ +    +++WPE D       +   EEE ++LK I+FA       +L + ++  +E  V+ E+E E E ++E++ SVQV E  F+F  +++ F + NVV T+ +L ++   N   TN+ + +++H IA   K   +L+QL +F  FNK L DP ++  +        I            N K  +E+LF KN +   E   GY       S+ N  + +WT E E+EL RL+ + +    +   D    I +      +TR+Q++N LV +GL  S K+ K + +      WT D++  L  L E+ +D    +  IM  + A        RS+  +I+K++ +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLESDTYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAAQILQNDLIPLVIQHHNDKQLFDAVIRLMVNVTQPALLCFGK-VPQDPTFRHHFLQVVSYLQAYKEAFANERLFGVLSEKLYDLLQMEWEQREEEHNLLIERILLLVRNILHVPPDPEEEKSVDDDASIHDRVLWAIHMSGMDDLIKFLASSETEQQWSMHVLETVSLMFRDQIAEHLAATGQARSTAERDTDIKNLEILRQRESAEKKNRALQRGTRHSRFGGSYIVQGLKSIGDKDVIYHKGIHNFKNYTHDLGKEVRRVPKRKQQAKETEARRRSALNVRLFLKEFCIDFLENCYNRLMYIVKDNLIREKAQQHDETYYLWSMAFFMGFNRLFRFQPELVSETVSIRTFHFIEQNLTNYYEMMLTDKKEATSWARRMHLALKAYQELLSTVHEMDHSKEEAVRESSKIIKNNIFYLMEYRELFLALFRKFDETKQPRSFLKDLVETTHLFLKMLE-------KFCKGKQTVVVQKRRVKRKKKKSSVSGAKEV---QPKSTEELAAIWTNVSEQLTTCIVNSE-----NLP---DSVVP-----FDAASEIPVEEQRAEALVRIQDGLFSGCAAEALVLLRSAREVWPEGDVFGAA--EIEPEEETELLKQILFA-------ELPRSTQ--AESEVLGEEEEEDEIEEEELTSVQVSEREFNFLDYMKRFANSNVVKTYVLLLKNYQQNSAHTNHCVAKMLHRIAYDLKMEALLFQLSVFCIFNKILGDPAASAYKELVAFSKYILNKFFSL--AATNNKAYVELLFWKNTNVIREMTEGYRKLGEEESEANRKRIKWTPEDEDELRRLYLQFKE---IEDADVVDNIVANLKPGTRTRKQVINHLVQMGLADSVKDFKQETKGTRIVLWTEDQELELQRLYEDFKDSDDILGNIMKNVTAK-------RSKARIIEKLISMGLVCDRKEL 944          
BLAST of Timeless circadian clock vs. Ensembl Xenopus
Match: hsph1 (heat shock protein family H (Hsp110) member 1 [Source:Xenbase;Acc:XB-GENE-965196])

HSP 1 Score: 332.798 bits (852), Expect = 7.832e-95
Identity = 311/992 (31.35%), Postives = 505/992 (50.91%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNST-ESASD---QQLRRQRELELMAKSA--ENPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKIDLTRD--RKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY-----SNSDDNNPK-EWT-DXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E+  + K+ D + S++D++R+LR E +  +IR +LG  ++++N LI L+  ++ND  LFD VIRL++N+TQP+ +CF + +P+D      F++V   LQ  K  F +     VLS K+ D+   EWE R E+ +LL+ERIL+L+RNILH+  +  +    +   S HD ++  +  SG  DL+ +L+++E E++++ H LE +SLMFR+Q AE +     + ST E  +D    ++ RQRE       A     R  RFGG++ +Q +K+   +  IYH  I+  K + T D  +++RR  K +   KE     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYYLW++ FFM   R  +  PE VSET++I  FH++ Q    Y +   T K+ A S  R++HL + AY+ELL     +D+ +EE  R  S  IK+ +FY  EY E++  L   F   KQ R+FL+ L+E + L +K+L+       KF                   + +    +++  EQ         + +  L    S  N E     NLP   D ++P      +  SE PV+ Q   AL  +Q  L    + EA+ +    +++WPE D  +    +   EEE ++LK I+FA              E+    V+ E+E E E ++E++ SVQV E  F+F  +++ F + NVV T+ +L ++   N   TN+ + +++H IA   K   +L+QL +F  FNK L DP ++  +        I          N   K  +E+LF KN +   E   GY       S+ N  + +WT ++ +E      +  + ED++        I +      +TR+Q++N LV +GL  S K+ K + +      WT D++  L  L E+ +D    +  IM  + A        RS+  +I+K++ +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLESDTYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAAQILQNDLIPLVIQHHNDKQLFDAVIRLMVNVTQPALLCFGK-VPQDPTFRHHFLQVVSYLQAYKEAFANERLFGVLSEKLYDLLQMEWEQREEEHNLLIERILLLVRNILHVPPDPEEEKSVDDDASIHDRVLWAIHMSGMDDLIKFLASSETEQQWSMHVLETVSLMFRDQIAEHLAATGQARSTAERDTDIKNLEILRQRESAEKKNRALQRGTRHSRFGGSYIVQGLKSIGDKDVIYHKGIHNFK-NYTHDLGKEVRRVPKRKQQAKETEARRRSALNVRLFLKEFCIDFLENCYNRLMYIVKDNLIREKAQQHDETYYLWSMAFFMGFNRLFRFQPELVSETVSIRTFHFIEQNLTNYYEMMLTDKKEATSWARRMHLALKAYQELLSTVHEMDHSKEEAVRESSKIIKNNIFYLMEYRELFLALFRKFDETKQPRSFLKDLVETTHLFLKMLE-------KFC------------------KGKQTVVVQVREEQAINLLFQISVSNHNLHLFKSTQNSE-----NLP---DSVVP-----FDAASEIPVEEQRAEALVRIQDGLFSGCAAEALVLLRSAREVWPEGD--VFGAAEIEPEEETELLKQILFA--------------ELPSKSVLGEEEEEDEIEEEELTSVQVSEREFNFLDYMKRFANSNVVKTYVLLLKNYQQNSAHTNHCVAKMLHRIAYDLKMEALLFQLSVFCIFNKILGDPAASAYKELVAFSKYILNKFFSLAATNN--KAYVELLFWKNTNVIREMTEGYRKLGEEESEANRKRIKWTPEDEDELRRLYLQFKEIEDVVDN------IVANLKPGTRTRKQVINHLVQMGLADSVKDFKQETKGTRIVLWTEDQELELQRLYEDFKDSDDILGNIMKNVTAK-------RSKARIIEKLISMGLVCDRKEL 921          
BLAST of Timeless circadian clock vs. Ensembl Xenopus
Match: hsph1 (heat shock protein family H (Hsp110) member 1 [Source:Xenbase;Acc:XB-GENE-965196])

HSP 1 Score: 320.857 bits (821), Expect = 4.719e-91
Identity = 309/983 (31.43%), Postives = 490/983 (49.85%), Query Frame = 1
Query:   88 DLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNST-ESASD---QQLRRQRELELMAKSA--ENPRVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSA-VNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY-----SNSDDNNPK-EWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            +L A  + LG  E+  + K+ D + S++D++R+LR E +  +IR +LG  ++++N LI L+  ++ND  LFD VIRL++N+TQP+ +CF + +P+D      F++V   LQ  K  F +     VLS K+ D+   EWE R E+ +LL+ERIL+L+RNILH+  +  +    +   S HD ++  +  SG  DL+ +L+++E E++++ H LE +SLMFR+Q AE +     + ST E  +D    ++ RQRE       A     R  RFGG++ +Q +K+   +  IYH  I N S       +++RR  K +   KE     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYYLW++ FFM   R  +  PE VSET++I  FH++ Q    Y +   T K+ A S  R++HL + AY+ELL     +D+ +EE  R  S  IK+ +FY  EY E++  L   F   KQ R+FL+ L+E + L +K+L+       KF   K     +K    +  +++   G  E+   Q      L  IW  + E L +  VN E     NLP   D ++P      +  SE PV+ Q   AL  +Q  L    + EA+ +    +++WPE D  +    +   EEE ++LK I+FA    K                              I++ QV             F + NVV T+ +L ++   N   TN+ + +++H IA   K   +L+QL +F  FNK L DP ++  +        I            N K  +E+LF KN +   E   GY       S+ N  + +WT E E+EL RL+ + +    +   D    I +      +TR+Q++N LV +GL  S K+ K + +      WT D++  L  L E+ +D    +  IM  + A        RS+  +I+K++ +GLV ++ +L
Sbjct:    5 ELLATCSALGYLESDTYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAAQILQNDLIPLVIQHHNDKQLFDAVIRLMVNVTQPALLCFGK-VPQDPTFRHHFLQVVSYLQAYKEAFANERLFGVLSEKLYDLLQMEWEQREEEHNLLIERILLLVRNILHVPPDPEEEKSVDDDASIHDRVLWAIHMSGMDDLIKFLASSETEQQWSMHVLETVSLMFRDQIAEHLAATGQARSTAERDTDIKNLEILRQRESAEKKNRALQRGTRHSRFGGSYIVQGLKSIGDKDVIYHKGIHNVSNYTHDLGKEVRRVPKRKQQAKETEARRRSALNVRLFLKEFCIDFLENCYNRLMYIVKDNLIREKAQQHDETYYLWSMAFFMGFNRLFRFQPELVSETVSIRTFHFIEQNLTNYYEMMLTDKKEATSWARRMHLALKAYQELLSTVHEMDHSKEEAVRESSKIIKNNIFYLMEYRELFLALFRKFDETKQPRSFLKDLVETTHLFLKMLE-------KFCKGKQTVVVQKRRVKRKKKKSSVSGAKEV---QPKSTEELAAIWTNVSEQLTTCIVNSE-----NLP---DSVVP-----FDAASEIPVEEQRAEALVRIQDGLFSGCAAEALVLLRSAREVWPEGD--VFGAAEIEPEEETELLKQILFAELPSK----------------------------SAISAYQV-------------FANSNVVKTYVLLLKNYQQNSAHTNHCVAKMLHRIAYDLKMEALLFQLSVFCIFNKILGDPAASAYKELVAFSKYILNKFFSL--AATNNKAYVELLFWKNTNVIREMTEGYRKLGEEESEANRKRIKWTPEDEDELRRLYLQFKE---IEDADVVDNIVANLKPGTRTRKQVINHLVQMGLADSVKDFKQETKGTRIVLWTEDQELELQRLYEDFKDSDDILGNIMKNVTAK-------RSKARIIEKLISMGLVCDRKEL 908          
BLAST of Timeless circadian clock vs. Ensembl Xenopus
Match: hsph1 (heat shock protein family H (Hsp110) member 1 [Source:Xenbase;Acc:XB-GENE-965196])

HSP 1 Score: 319.701 bits (818), Expect = 2.578e-90
Identity = 316/992 (31.85%), Postives = 505/992 (50.91%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNST-ESASD---QQLRRQRELELMAKSA--ENPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKIDLTRD--RKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSA-VNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY-----SNSDDNNPK-EWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E+  + K+ D + S++D++R+LR E +  +IR +LG  ++++N LI L+  ++ND  LFD VIRL++N+TQP+ +CF + +P+D      F++V   LQ  K  F +     VLS K+ D+   EWE R E+ +LL+ERIL+L+RNILH+  +  +    +   S HD ++  +  SG  DL+ +L+++E E++++ H LE +SLMFR+Q AE +     + ST E  +D    ++ RQRE       A     R  RFGG++ +Q +K+   +  IYH  I+  K + T D  +++RR  K +   KE     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYYLW++ FFM   R  +  PE VSET++I  FH++ Q    Y +   T K+ A S  R++HL + AY+ELL     +D+ +EE  R  S  IK+ +FY  EY E++  L   F   KQ R+FL+ L+E + L +K+L+       KF   K     +K    +  +++   G  E+   Q      L  IW  + E L +  VN E     NLP   D ++P      +  SE PV+ Q  RA  LV+I+    + + +V++                          I  LK+    N  Y       L    +E  V+ E+E E E ++E++ SVQV E  F+F  +++ F + NVV T+ +L ++   N   TN+ + +++H IA   K   +L+QL +F  FNK L DP ++  +        I            N K  +E+LF KN +   E   GY       S+ N  + +WT E E+EL RL+ + +    +   D    I +      +TR+Q++N LV +GL  S K+ K + +      WT D++  L  L E+ +D    +  IM  + A        RS+  +I+K++ +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLESDTYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAAQILQNDLIPLVIQHHNDKQLFDAVIRLMVNVTQPALLCFGK-VPQDPTFRHHFLQVVSYLQAYKEAFANERLFGVLSEKLYDLLQMEWEQREEEHNLLIERILLLVRNILHVPPDPEEEKSVDDDASIHDRVLWAIHMSGMDDLIKFLASSETEQQWSMHVLETVSLMFRDQIAEHLAATGQARSTAERDTDIKNLEILRQRESAEKKNRALQRGTRHSRFGGSYIVQGLKSIGDKDVIYHKGIHNFK-NYTHDLGKEVRRVPKRKQQAKETEARRRSALNVRLFLKEFCIDFLENCYNRLMYIVKDNLIREKAQQHDETYYLWSMAFFMGFNRLFRFQPELVSETVSIRTFHFIEQNLTNYYEMMLTDKKEATSWARRMHLALKAYQELLSTVHEMDHSKEEAVRESSKIIKNNIFYLMEYRELFLALFRKFDETKQPRSFLKDLVETTHLFLKMLE-------KFCKGKQTVVVQKRRVKRKKKKSSVSGAKEV---QPKSTEELAAIWTNVSEQLTTCIVNSE-----NLP---DSVVP-----FDAASEIPVEEQ--RAEALVRIQDGLFSGLLSVSL------------------------SAIFFLKNTCLPNLNYSH-----LGSTQAESEVLGEEEEEDEIEEEELTSVQVSEREFNFLDYMKRFANSNVVKTYVLLLKNYQQNSAHTNHCVAKMLHRIAYDLKMEALLFQLSVFCIFNKILGDPAASAYKELVAFSKYILNKFFSL--AATNNKAYVELLFWKNTNVIREMTEGYRKLGEEESEANRKRIKWTPEDEDELRRLYLQFKE---IEDADVVDNIVANLKPGTRTRKQVINHLVQMGLADSVKDFKQETKGTRIVLWTEDQELELQRLYEDFKDSDDILGNIMKNVTAK-------RSKARIIEKLISMGLVCDRKEL 924          
BLAST of Timeless circadian clock vs. Ensembl Xenopus
Match: hsph1 (heat shock protein family H (Hsp110) member 1 [Source:Xenbase;Acc:XB-GENE-965196])

HSP 1 Score: 304.294 bits (778), Expect = 3.149e-85
Identity = 292/913 (31.98%), Postives = 474/913 (51.92%), Query Frame = 1
Query:   88 DLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNST-ESASD---QQLRRQRELELMAKSA--ENPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKIDLTRD--RKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWT---------DXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKEL 2769
            +L A  + LG  E+  + K+ D + S++D++R+LR E +  +IR +LG  ++++N LI L+  ++ND  LFD VIRL++N+TQP+ +CF + +P+D      F++V   LQ  K  F +     VLS K+ D+   EWE R E+ +LL+ERIL+L+RNILH+  +  +    +   S HD ++  +  SG  DL+ +L+++E E++++ H LE +SLMFR+Q AE +     + ST E  +D    ++ RQRE       A     R  RFGG++ +Q +K+   +  IYH  I+  K + T D  +++RR  K +   KE     +S   V   L+EFC  FL+  YN LM      L R++ Q  DETYYLW++ FFM   R  +  PE VSET++I  FH++ Q    Y +   T K+ A S  R++HL + AY+ELL     +D+ +EE  R  S  IK+ +FY  EY E++  L   F   KQ R+FL+ L+E + L +K+L+       KF   K     +K    +  +++   G  E+   Q    N         L    S  N E     NLP   D ++P      +  SE PV+ Q   AL  +Q  L    + EA+ +    +++WPE D  +    +   EEE ++LK I+FA       +L + ++  +E  V+ E+E E E ++E++ SVQV E  F+F  +++ F + NVV T+ +L ++   N   TN+ + +++H IA   K   +L+QL +F  FNK L DP ++  +        I            N K  +E+LF KN +   E   GY    +     W          ++ +E      +  + EDIL      +++++  + ++K R  I+ +L+++GL+   KEL
Sbjct:    5 ELLATCSALGYLESDTYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAAQILQNDLIPLVIQHHNDKQLFDAVIRLMVNVTQPALLCFGK-VPQDPTFRHHFLQVVSYLQAYKEAFANERLFGVLSEKLYDLLQMEWEQREEEHNLLIERILLLVRNILHVPPDPEEEKSVDDDASIHDRVLWAIHMSGMDDLIKFLASSETEQQWSMHVLETVSLMFRDQIAEHLAATGQARSTAERDTDIKNLEILRQRESAEKKNRALQRGTRHSRFGGSYIVQGLKSIGDKDVIYHKGIHNFK-NYTHDLGKEVRRVPKRKQQAKETEARRRSALNVRLFLKEFCIDFLENCYNRLMYIVKDNLIREKAQQHDETYYLWSMAFFMGFNRLFRFQPELVSETVSIRTFHFIEQNLTNYYEMMLTDKKEATSWARRMHLALKAYQELLSTVHEMDHSKEEAVRESSKIIKNNIFYLMEYRELFLALFRKFDETKQPRSFLKDLVETTHLFLKMLE-------KFCKGKQTVVVQKRRVKRKKKKSSVSGAKEVQLFQISVSN-------HNLHLFKSTQNSE-----NLP---DSVVP-----FDAASEIPVEEQRAEALVRIQDGLFSGCAAEALVLLRSAREVWPEGD--VFGAAEIEPEEETELLKQILFA-------ELPRSTQ--AESEVLGEEEEEDEIEEEELTSVQVSEREFNFLDYMKRFANSNVVKTYVLLLKNYQQNSAHTNHCVAKMLHRIAYDLKMEALLFQLSVFCIFNKILGDPAASAYKELVAFSKYILNKFFSL--AATNNKAYVELLFWKNTNVIREMTEGYRKLGEEERAGWNLLARIKWTPEDEDELRRLYLQFKEIEDIL-----GNIMKNVTAKRSKAR--IIEKLISMGLVCDRKEL 868          
BLAST of Timeless circadian clock vs. Ensembl Mouse
Match: Timeless (timeless circadian clock 1 [Source:MGI Symbol;Acc:MGI:1321393])

HSP 1 Score: 314.309 bits (804), Expect = 2.997e-88
Identity = 310/1011 (30.66%), Postives = 504/1011 (49.85%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFM-----DTLKSSNSTESASDQQLRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNA---LQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRI---MVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY----SNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP-WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPNYDSG 3030
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  +  D  LFD VIRL++NLTQP+ +CF   +PKD      F++V   LQ  K  F       VLS  + ++    WEDR E+++LL+ERIL+L+RNILH+  N       +   S HD L+  +  SG  DLL++LS++  E++++ H LEIISLMFR+Q+ E +       L    ST+ A  + LR++   E  A++ +   R  RFGG++ +Q +K+   +  ++H   H++     DL    K  R+   +    +E  +H+ +  VLN    L++FC  FL+  YN LM      L R++ Q  DETYY+WA+ FFM   R     P  VSET++I  FH+V Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F      R+FLR L+E + L +K+L    E   +  G      +RK  K K   ++Q +   + P E       L  +W  + E L+     + EL +      DP++P      +  SE PV+ Q   A+  +Q  L    + +A+A+    +++WPE +     +++       EE+++LK I+ +    ++++  +   E  E           E ++E++  VQV E  F+F  +++ F    +V  + +L      N   TN+ + +++H +A       +L+QL LF  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY    S S  +    W+ E E +L  L+    H+D+  G D    I +      +TR+Q+++ LV +GL  S KE + +K      WT D++  L  L EE RD    + +IM  + A        RSR  V+ K+L LGLV  + QL  + +  KL P+  +G
Sbjct:    1 MDLYMMNCELLATCSALGYLEGGTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHRQDKPLFDAVIRLMVNLTQPALLCFG-SVPKDSSVRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEDRQEEDNLLIERILLLVRNILHVPANLEQEKSIDDDASIHDRLLWAIHLSGMDDLLLFLSSSSAEQQWSLHVLEIISLMFRDQTPEQLAGVGQGRLAQERSTDVAELEVLRQREMAEKRARALQRGNRHSRFGGSYIVQGLKSIGEKDVVFHKGLHNLQNYSSDLG---KQPRRVPKRRQAAQELSVHRRS--VLNVRLFLRDFCSEFLENCYNPLMGAVKDHLLRERAQQHDETYYMWAMAFFMAFNRAATFRPGLVSETLSIRTFHFVEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDMCPDEAVRESSRIIKNNIFYMMEYRELFLALFRKFDERYHPRSFLRDLVETTHLFLKML----ERFCRSRGNLMVQNKRKKRKKKKKVQDQGVAFSQSPGE-------LEAMWPALAEQLLQCAQ-DPELSV------DPVVP-----FDAASEVPVEEQRVEAMVRIQDCLTAGQAPQALALLRSAREVWPEGNAFGSPVISPG-----EEMQLLKQIL-STPLPRQQEPEEGDAEEEEE----------EEEEEELQVVQVSEKEFNFLEYLKRFASSTIVRAYVLLLRSYRQNSAHTNHCIAKMLHRLAHGLGMEALLFQLSLFCLFNRLLSDPAAAAYKELVTFAKYIIGKFFALAAVNQ--KAFVELLFWKNTAVVREMTQGYGSLDSGSSSHRAPLWSPEEEAQLQELYLA--HKDV-EGQDVVETILAHLKVVPRTRKQVIHHLVRMGLADSVKEFQKRKGTQIVLWTEDQELELQRLFEEFRDSDDVLGQIMKNITAK-------RSRARVVDKLLALGLVSERRQL-YKKRRKKLAPSCMNG 953          
BLAST of Timeless circadian clock vs. Ensembl Mouse
Match: Timeless (timeless circadian clock 1 [Source:MGI Symbol;Acc:MGI:1321393])

HSP 1 Score: 312.768 bits (800), Expect = 7.954e-88
Identity = 309/1007 (30.69%), Postives = 502/1007 (49.85%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFM-----DTLKSSNSTESASDQQLRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNA---LQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRI---MVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY----SNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP-WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPN 3018
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  +  D  LFD VIRL++NLTQP+ +CF   +PKD      F++V   LQ  K  F       VLS  + ++    WEDR E+++LL+ERIL+L+RNILH+  N       +   S HD L+  +  SG  DLL++LS++  E++++ H LEIISLMFR+Q+ E +       L    ST+ A  + LR++   E  A++ +   R  RFGG++ +Q +K+   +  ++H   H++     DL    K  R+   +    +E  +H+ +  VLN    L++FC  FL+  YN LM      L R++ Q  DETYY+WA+ FFM   R     P  VSET++I  FH+V Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F      R+FLR L+E + L +K+L    E   +  G      +RK  K K   ++Q +   + P E       L  +W  + E L+     + EL +      DP++P      +  SE PV+ Q   A+  +Q  L    + +A+A+    +++WPE +     +++       EE+++LK I+ +    ++++  +   E  E           E ++E++  VQV E  F+F  +++ F    +V  + +L      N   TN+ + +++H +A       +L+QL LF  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY    S S  +    W+ E E +L  L+    H+D+  G D    I +      +TR+Q+++ LV +GL  S KE + +K      WT D++  L  L EE RD    + +IM  + A        RSR  V+ K+L LGLV  + QL  + +  KL P+
Sbjct:    1 MDLYMMNCELLATCSALGYLEGGTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHRQDKPLFDAVIRLMVNLTQPALLCFG-SVPKDSSVRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEDRQEEDNLLIERILLLVRNILHVPANLEQEKSIDDDASIHDRLLWAIHLSGMDDLLLFLSSSSAEQQWSLHVLEIISLMFRDQTPEQLAGVGQGRLAQERSTDVAELEVLRQREMAEKRARALQRGNRHSRFGGSYIVQGLKSIGEKDVVFHKGLHNLQNYSSDLG---KQPRRVPKRRQAAQELSVHRRS--VLNVRLFLRDFCSEFLENCYNPLMGAVKDHLLRERAQQHDETYYMWAMAFFMAFNRAATFRPGLVSETLSIRTFHFVEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDMCPDEAVRESSRIIKNNIFYMMEYRELFLALFRKFDERYHPRSFLRDLVETTHLFLKML----ERFCRSRGNLMVQNKRKKRKKKKKVQDQGVAFSQSPGE-------LEAMWPALAEQLLQCAQ-DPELSV------DPVVP-----FDAASEVPVEEQRVEAMVRIQDCLTAGQAPQALALLRSAREVWPEGNAFGSPVISPG-----EEMQLLKQIL-STPLPRQQEPEEGDAEEEEE----------EEEEEELQVVQVSEKEFNFLEYLKRFASSTIVRAYVLLLRSYRQNSAHTNHCIAKMLHRLAHGLGMEALLFQLSLFCLFNRLLSDPAAAAYKELVTFAKYIIGKFFALAAVNQ--KAFVELLFWKNTAVVREMTQGYGSLDSGSSSHRAPLWSPEEEAQLQELYLA--HKDV-EGQDVVETILAHLKVVPRTRKQVIHHLVRMGLADSVKEFQKRKGTQIVLWTEDQELELQRLFEEFRDSDDVLGQIMKNITAK-------RSRARVVDKLLALGLVSERRQL-YKKRRKKLAPS 949          
BLAST of Timeless circadian clock vs. Ensembl Mouse
Match: Timeless (timeless circadian clock 1 [Source:MGI Symbol;Acc:MGI:1321393])

HSP 1 Score: 312.768 bits (800), Expect = 7.954e-88
Identity = 309/1007 (30.69%), Postives = 502/1007 (49.85%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFM-----DTLKSSNSTESASDQQLRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNA---LQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRI---MVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY----SNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP-WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPN 3018
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  +  D  LFD VIRL++NLTQP+ +CF   +PKD      F++V   LQ  K  F       VLS  + ++    WEDR E+++LL+ERIL+L+RNILH+  N       +   S HD L+  +  SG  DLL++LS++  E++++ H LEIISLMFR+Q+ E +       L    ST+ A  + LR++   E  A++ +   R  RFGG++ +Q +K+   +  ++H   H++     DL    K  R+   +    +E  +H+ +  VLN    L++FC  FL+  YN LM      L R++ Q  DETYY+WA+ FFM   R     P  VSET++I  FH+V Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F      R+FLR L+E + L +K+L    E   +  G      +RK  K K   ++Q +   + P E       L  +W  + E L+     + EL +      DP++P      +  SE PV+ Q   A+  +Q  L    + +A+A+    +++WPE +     +++       EE+++LK I+ +    ++++  +   E  E           E ++E++  VQV E  F+F  +++ F    +V  + +L      N   TN+ + +++H +A       +L+QL LF  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY    S S  +    W+ E E +L  L+    H+D+  G D    I +      +TR+Q+++ LV +GL  S KE + +K      WT D++  L  L EE RD    + +IM  + A        RSR  V+ K+L LGLV  + QL  + +  KL P+
Sbjct:    1 MDLYMMNCELLATCSALGYLEGGTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHRQDKPLFDAVIRLMVNLTQPALLCFG-SVPKDSSVRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEDRQEEDNLLIERILLLVRNILHVPANLEQEKSIDDDASIHDRLLWAIHLSGMDDLLLFLSSSSAEQQWSLHVLEIISLMFRDQTPEQLAGVGQGRLAQERSTDVAELEVLRQREMAEKRARALQRGNRHSRFGGSYIVQGLKSIGEKDVVFHKGLHNLQNYSSDLG---KQPRRVPKRRQAAQELSVHRRS--VLNVRLFLRDFCSEFLENCYNPLMGAVKDHLLRERAQQHDETYYMWAMAFFMAFNRAATFRPGLVSETLSIRTFHFVEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDMCPDEAVRESSRIIKNNIFYMMEYRELFLALFRKFDERYHPRSFLRDLVETTHLFLKML----ERFCRSRGNLMVQNKRKKRKKKKKVQDQGVAFSQSPGE-------LEAMWPALAEQLLQCAQ-DPELSV------DPVVP-----FDAASEVPVEEQRVEAMVRIQDCLTAGQAPQALALLRSAREVWPEGNAFGSPVISPG-----EEMQLLKQIL-STPLPRQQEPEEGDAEEEEE----------EEEEEELQVVQVSEKEFNFLEYLKRFASSTIVRAYVLLLRSYRQNSAHTNHCIAKMLHRLAHGLGMEALLFQLSLFCLFNRLLSDPAAAAYKELVTFAKYIIGKFFALAAVNQ--KAFVELLFWKNTAVVREMTQGYGSLDSGSSSHRAPLWSPEEEAQLQELYLA--HKDV-EGQDVVETILAHLKVVPRTRKQVIHHLVRMGLADSVKEFQKRKGTQIVLWTEDQELELQRLFEEFRDSDDVLGQIMKNITAK-------RSRARVVDKLLALGLVSERRQL-YKKRRKKLAPS 949          
BLAST of Timeless circadian clock vs. Ensembl Mouse
Match: Timeless (timeless circadian clock 1 [Source:MGI Symbol;Acc:MGI:1321393])

HSP 1 Score: 312.768 bits (800), Expect = 8.561e-88
Identity = 309/1007 (30.69%), Postives = 502/1007 (49.85%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFM-----DTLKSSNSTESASDQQLRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNA---LQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRI---MVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY----SNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP-WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPN 3018
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  +  D  LFD VIRL++NLTQP+ +CF   +PKD      F++V   LQ  K  F       VLS  + ++    WEDR E+++LL+ERIL+L+RNILH+  N       +   S HD L+  +  SG  DLL++LS++  E++++ H LEIISLMFR+Q+ E +       L    ST+ A  + LR++   E  A++ +   R  RFGG++ +Q +K+   +  ++H   H++     DL    K  R+   +    +E  +H+ +  VLN    L++FC  FL+  YN LM      L R++ Q  DETYY+WA+ FFM   R     P  VSET++I  FH+V Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F      R+FLR L+E + L +K+L    E   +  G      +RK  K K   ++Q +   + P E       L  +W  + E L+     + EL +      DP++P      +  SE PV+ Q   A+  +Q  L    + +A+A+    +++WPE +     +++       EE+++LK I+ +    ++++  +   E  E           E ++E++  VQV E  F+F  +++ F    +V  + +L      N   TN+ + +++H +A       +L+QL LF  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY    S S  +    W+ E E +L  L+    H+D+  G D    I +      +TR+Q+++ LV +GL  S KE + +K      WT D++  L  L EE RD    + +IM  + A        RSR  V+ K+L LGLV  + QL  + +  KL P+
Sbjct:    1 MDLYMMNCELLATCSALGYLEGGTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHRQDKPLFDAVIRLMVNLTQPALLCFG-SVPKDSSVRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEDRQEEDNLLIERILLLVRNILHVPANLEQEKSIDDDASIHDRLLWAIHLSGMDDLLLFLSSSSAEQQWSLHVLEIISLMFRDQTPEQLAGVGQGRLAQERSTDVAELEVLRQREMAEKRARALQRGNRHSRFGGSYIVQGLKSIGEKDVVFHKGLHNLQNYSSDLG---KQPRRVPKRRQAAQELSVHRRS--VLNVRLFLRDFCSEFLENCYNPLMGAVKDHLLRERAQQHDETYYMWAMAFFMAFNRAATFRPGLVSETLSIRTFHFVEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDMCPDEAVRESSRIIKNNIFYMMEYRELFLALFRKFDERYHPRSFLRDLVETTHLFLKML----ERFCRSRGNLMVQNKRKKRKKKKKVQDQGVAFSQSPGE-------LEAMWPALAEQLLQCAQ-DPELSV------DPVVP-----FDAASEVPVEEQRVEAMVRIQDCLTAGQAPQALALLRSAREVWPEGNAFGSPVISPG-----EEMQLLKQIL-STPLPRQQEPEEGDAEEEEE----------EEEEEELQVVQVSEKEFNFLEYLKRFASSTIVRAYVLLLRSYRQNSAHTNHCIAKMLHRLAHGLGMEALLFQLSLFCLFNRLLSDPAAAAYKELVTFAKYIIGKFFALAAVNQ--KAFVELLFWKNTAVVREMTQGYGSLDSGSSSHRAPLWSPEEEAQLQELYLA--HKDV-EGQDVVETILAHLKVVPRTRKQVIHHLVRMGLADSVKEFQKRKGTQIVLWTEDQELELQRLFEEFRDSDDVLGQIMKNITAK-------RSRARVVDKLLALGLVSERRQL-YKKRRKKLAPS 949          
BLAST of Timeless circadian clock vs. Ensembl Mouse
Match: Timeless (timeless circadian clock 1 [Source:MGI Symbol;Acc:MGI:1321393])

HSP 1 Score: 236.113 bits (601), Expect = 1.660e-66
Identity = 183/520 (35.19%), Postives = 288/520 (55.38%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFM-----DTLKSSNSTESASDQQLRRQRELELMAKSAE-NPRVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNA---LQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQ 1584
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  +  D  LFD VIRL++NLTQP+ +CF   +PKD      F++V   LQ  K  F       VLS  + ++    WEDR E+++LL+ERIL+L+RNILH+  N       +   S HD L+  +  SG  DLL++LS++  E++++ H LEIISLMFR+Q+ E +       L    ST+ A  + LR++   E  A++ +   R  RFGG++ +Q +K+   +  ++H   H++     DL    K  R+   +    +E  +H+ +  VLN    L++FC  FL+  YN LM      L R++ Q  DETYY+WA+ FFM   R     P  VSET++I  FH+V Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F      R+FLR L+E + L +K+L+
Sbjct:    1 MDLYMMNCELLATCSALGYLEGGTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHRQDKPLFDAVIRLMVNLTQPALLCFG-SVPKDSSVRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEDRQEEDNLLIERILLLVRNILHVPANLEQEKSIDDDASIHDRLLWAIHLSGMDDLLLFLSSSSAEQQWSLHVLEIISLMFRDQTPEQLAGVGQGRLAQERSTDVAELEVLRQREMAEKRARALQRGNRHSRFGGSYIVQGLKSIGEKDVVFHKGLHNLQNYSSDLG---KQPRRVPKRRQAAQELSVHRRS--VLNVRLFLRDFCSEFLENCYNPLMGAVKDHLLRERAQQHDETYYMWAMAFFMAFNRAATFRPGLVSETLSIRTFHFVEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDMCPDEAVRESSRIIKNNIFYMMEYRELFLALFRKFDERYHPRSFLRDLVETTHLFLKMLE 514          
BLAST of Timeless circadian clock vs. UniProt/SwissProt
Match: sp|Q9UNS1|TIM_HUMAN (Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS PE=1 SV=2)

HSP 1 Score: 325.479 bits (833), Expect = 3.924e-91
Identity = 306/996 (30.72%), Postives = 501/996 (50.30%), Query Frame = 1
Query:   88 DLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESAS----DQQLRRQRELELMAKSA--ENPRVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLM-SAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKE----WTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNPWTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKN---SKLIPN 3018
            +L A  + LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  ++ D  LFD VIRL++NLTQP+ +CF   LPK+      F++V   LQ  K  F       VLS  + ++    WE+R E+++LL+ERIL+L+RNILH+  +       +   S HD L+  +  SG  DLL++L+++  EE+++ H LEI+SLMFR+Q+ E +  +      +  S    + ++ RQRE+      A     R  RFGG++ +Q +K+   R  I+H   H++     DL +  K  +  K +   +E +   +S   V   L++FC  FL+  YN LM +    L R++ Q  DETYY+WAL FFM   R     P  VSET+++  FH++ Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F    Q R+FLR L+E + L +K+L+    F         + K++K  K K    +Q I +  +PS  ++    +  +W  + E L   A N E+ +        D ++P      +  SE PV+ Q   A+  +Q  L    + +A+ +    +++WPE D  +    D   EEEI++LK I+ A         +   +   E G   E+E E E ++E++  VQV E  F+F  +++ F    VV  + +L      N   TN+ +++++H +A   K   +L+QL +F  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY + DD +       W+ E E  L  L+    ++D+  G D    I +  +   +TR+QI++ LV +GL  S K+ + K      WT D++  L  L EE RD    +  IM  + A        RSR  ++ K+L LGLV  + +L  + +    S ++PN
Sbjct:    9 ELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHHQDKPLFDAVIRLMVNLTQPALLCFGN-LPKEPSFRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEERQEEDNLLIERILLLVRNILHVPADLDQEKKIDDDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLMFRDQNPEQLAGVGQGRLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKGLHNLRNYSSDLGKQPK--KVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGSVKDHLLREKAQQHDETYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDISPDEAVRESSRIIKNNIFYVMEYRELFLALFRKFDERCQPRSFLRDLVETTHLFLKMLE---RFCRSRGNLVVQNKQKKRRKKKKKVLDQAIVSGNVPSSPEE----VEAVWPALAEQLQCCAQNSELSM--------DSVVP-----FDAASEVPVEEQRAEAMVRIQDCLLAGQAPQALTLLRSAREVWPEGD--VFGSQDISPEEEIQLLKQILSAP--------LPRQQGPEERGAE-EEEEEEEEEEEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSAHTNHCIVKMLHRLAHDLKMEALLFQLSVFCLFNRLLSDPAAGAYKELVTFAKYILGKFFALAAVNQ--KAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLRELYLA--NKDV-EGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRLFEEFRDSDDVLGHIMKNITAK-------RSRARIVDKLLALGLVAERRELYKKRQKKLASSILPN 958          
BLAST of Timeless circadian clock vs. UniProt/SwissProt
Match: sp|Q9R1X4|TIM_MOUSE (Protein timeless homolog OS=Mus musculus OX=10090 GN=Timeless PE=1 SV=3)

HSP 1 Score: 312.768 bits (800), Expect = 5.564e-87
Identity = 309/1007 (30.69%), Postives = 502/1007 (49.85%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFM-----DTLKSSNSTESASDQQLRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNA---LQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRI---MVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGY----SNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP-WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPN 3018
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  +  D  LFD VIRL++NLTQP+ +CF   +PKD      F++V   LQ  K  F       VLS  + ++    WEDR E+++LL+ERIL+L+RNILH+  N       +   S HD L+  +  SG  DLL++LS++  E++++ H LEIISLMFR+Q+ E +       L    ST+ A  + LR++   E  A++ +   R  RFGG++ +Q +K+   +  ++H   H++     DL    K  R+   +    +E  +H+ +  VLN    L++FC  FL+  YN LM      L R++ Q  DETYY+WA+ FFM   R     P  VSET++I  FH+V Q    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  IK+ +FY  EY E++  L   F      R+FLR L+E + L +K+L    E   +  G      +RK  K K   ++Q +   + P E       L  +W  + E L+     + EL +      DP++P      +  SE PV+ Q   A+  +Q  L    + +A+A+    +++WPE +     +++       EE+++LK I+ +    ++++  +   E  E           E ++E++  VQV E  F+F  +++ F    +V  + +L      N   TN+ + +++H +A       +L+QL LF  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY    S S  +    W+ E E +L  L+    H+D+  G D    I +      +TR+Q+++ LV +GL  S KE + +K      WT D++  L  L EE RD    + +IM  + A        RSR  V+ K+L LGLV  + QL  + +  KL P+
Sbjct:    1 MDLYMMNCELLATCSALGYLEGGTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHRQDKPLFDAVIRLMVNLTQPALLCFG-SVPKDSSVRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEDRQEEDNLLIERILLLVRNILHVPANLEQEKSIDDDASIHDRLLWAIHLSGMDDLLLFLSSSSAEQQWSLHVLEIISLMFRDQTPEQLAGVGQGRLAQERSTDVAELEVLRQREMAEKRARALQRGNRHSRFGGSYIVQGLKSIGEKDVVFHKGLHNLQNYSSDLG---KQPRRVPKRRQAAQELSVHRRS--VLNVRLFLRDFCSEFLENCYNPLMGAVKDHLLRERAQQHDETYYMWAMAFFMAFNRAATFRPGLVSETLSIRTFHFVEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDMCPDEAVRESSRIIKNNIFYMMEYRELFLALFRKFDERYHPRSFLRDLVETTHLFLKML----ERFCRSRGNLMVQNKRKKRKKKKKVQDQGVAFSQSPGE-------LEAMWPALAEQLLQCAQ-DPELSV------DPVVP-----FDAASEVPVEEQRVEAMVRIQDCLTAGQAPQALALLRSAREVWPEGNAFGSPVISPG-----EEMQLLKQIL-STPLPRQQEPEEGDAEEEEE----------EEEEEELQVVQVSEKEFNFLEYLKRFASSTIVRAYVLLLRSYRQNSAHTNHCIAKMLHRLAHGLGMEALLFQLSLFCLFNRLLSDPAAAAYKELVTFAKYIIGKFFALAAVNQ--KAFVELLFWKNTAVVREMTQGYGSLDSGSSSHRAPLWSPEEEAQLQELYLA--HKDV-EGQDVVETILAHLKVVPRTRKQVIHHLVRMGLADSVKEFQKRKGTQIVLWTEDQELELQRLFEEFRDSDDVLGQIMKNITAK-------RSRARVVDKLLALGLVSERRQL-YKKRRKKLAPS 949          
BLAST of Timeless circadian clock vs. UniProt/SwissProt
Match: sp|Q9Z2Y1|TIM_RAT (Protein timeless homolog OS=Rattus norvegicus OX=10116 GN=Timeless PE=1 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 2.082e-86
Identity = 308/1002 (30.74%), Postives = 493/1002 (49.20%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFM-----DTLKSSNSTESASDQQLRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYH---HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNA---LQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKE----WTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNPWTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPN 3018
            M+ Y+ +     TC  LG  E   + K+ D + S++D++R+LR E E  ++R +LG  +++++ L+ +L  +  D  LFD VIRL++NLTQP+ +CF   +PKD      F++V   LQ  K  F       VLS  + ++    WEDR E+++LL+ERIL+L+RNILH+  N       +   S HD L+  +  SG  DLL++LS++  E++++ H LEIISLMFR+Q  E +       L    ST+ A  + LR++   E  A++ +   R  RFGG++ +Q +K+   R  ++H   H++     DL    K  R+   +    +E  +H+ +  VLN    L++FC  FL+  YN LM      L R++ Q  DETYY+WA+ FFM   R     P  VSET++I  FH+V Q    Y +   T ++ A S  R++HL + AY+ELL     +D   ++  R  S  IK+ +FY  EY E++  L   F      R+FL  L+E + L +K+L    E   +  G      +RK  K K   + Q +     P E       L+ +W  + E L+     E EL ++  + +D               PV+ Q   A+  +Q  L    + +A+A+    +++WPE +  +         EE+++LK I+ A         +   +E  E    EEDE E E ++E++  VQV E  F F  +++ F    +V  + +L      N   TN+ + +++H +A       +L+QL LF  FN+ L DP +   +        I         VN+  K  +E+LF KN     E   GY + D  +       W+ E E +L  L+    H+D+  G D    I +      +TR+Q+++ LV +GL  S K+ + K  +   WT D++  L  L EE +D    +  IM  + A        RSR  V+ K+L LGLV  + QL  + +  KL P+
Sbjct:    1 MDLYMMNCELLATCSALGYLEGGTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHRQDKPLFDAVIRLMVNLTQPALLCFG-SVPKDPTVRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEDRQEEDNLLIERILLLVRNILHVPANLEQEKRIDDDASIHDRLLWAIHLSGMDDLLLFLSSSSAEQQWSLHVLEIISLMFRDQKPEQLAGVGQGRLAQERSTDLAELEVLRQREVAEKRARALQRGNRHSRFGGSYVVQGLKSIGERDVVFHKGLHNLQNYSSDLG---KQPRRVPKRRQAAQELSVHRRS--VLNVRLFLRDFCSEFLENCYNPLMGAVKDHLLREKAQQHDETYYMWAMAFFMAFNRAAAFRPGFVSETLSIRTFHFVEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATVNEMDMCPDDAVRESSRIIKNNIFYMMEYRELFLALFRKFDERYHPRSFLCDLVETTHLFLKML----ERFCRSRGNLMVQNKRKKRKKKKKAQEQGVAFSRSPEE-------LQAMWSALAERLLQCAQ-EPELSVDSIIPFDA----------ASEVPVEEQRVEAMVRIQDCLVAGQAPQALALLRSAREVWPEGN--VFGSPVISPGEEMQLLKQILSAT--------LPRQQEPVEGDAEEEDEEEEEEEEEELQVVQVSEKEFKFLDYLKRFACSTIVRAYVLLLRSYRQNSAHTNHCIAKMLHRLAHDLGMEALLFQLSLFCLFNQLLSDPAAAAYKELVTFAKYILGKFFALAAVNQ--KAFVELLFWKNTSVVREMTQGYGSLDSGSCSHRAPVWSSEEEAQLQELYLA--HKDV-EGQDVVETILAHLKAVPRTRKQVIHHLVRMGLADSVKDFQRKGTQIVLWTEDQELELQRLFEEFQDSDDVLGHIMKNITAK-------RSRARVVDKLLALGLVSERRQLH-KKRRKKLAPS 951          
BLAST of Timeless circadian clock vs. UniProt/SwissProt
Match: sp|G5EDN3|TIM_CAEEL (Protein timeless homolog OS=Caenorhabditis elegans OX=6239 GN=tim-1 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.340e-42
Identity = 175/685 (25.55%), Postives = 338/685 (49.34%), Query Frame = 1
Query:   91 LHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYL-KEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNST--ESASDQQLRRQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPA--IYHHDINWSKIDLTRDRKLRRKA-KNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRF---FMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKES--AVSSYRKLHLVMSAYKELLEFCLMLDNH-QEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDD-GGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE---PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTD--DDNRVEEEIKILKDIMFANKFYKEEDLIK 2091
            +   +  LG  E+ ++ ++ D   S+RD++R+LR + +    R+E G+  ++E  L+ ++K  +     FD+ IRL++NL QP+    + + P D    +++ +++E L+R K+ F D  F   +  +I + ++  E+EDR E   L+VERI++L++ +  IN + S+G      DS HD +++  +ESG    L++++N   E+ F    L+I +L+ +EQ+AE + T     ST  +  ++++ R+  E  ++ ++ +     RFGG++ ++ +K  S   +  ++    N  K +   DRK +++A +N+   + +T  H ++ +V   L++     ++  +N LMK++ + +   Q+Q   +  Y + ++F   F+ + R++ L  E +SE I +  FH    Q   Y++N+ T +   A S   K    + AY EL+     +  H +EE  R  +      +    EY E+   ++  F     S  FLR L+  +   +K+++       +FV   +  K  K +K +   +   +   ++ SE D      L  +W+E    ++  +  EV              PE R     DS+   PVD+Q K A   +Q  LR R    AV ++   + LWPE  +  +TD  D    E++++ L+ ++ A+     +DL K
Sbjct:    5 VQGAVHALGYYEDGKYSREPDCYESIRDLIRYLREDGDDHTARIECGRHNLVEQDLVPMVKCEDLTDDEFDIAIRLMVNLCQPAISTMRGKPPADRDQWKMYWELEENLRRAKTAFSDAHFFTAIKKRIDNYFIDTEYEDRDERLRLVVERIVLLIKYVFSINPDTSEGRRTRIEDSSHDRVIIAFLESGIDKTLMHIANQPREKEFHVTILDIFALILKEQTAEDLATKSEEVSTAEQKKTEEEFRKIIENHVVKETQKRKSFSRFGGSYTIKGLKGISANSSQVVFKPIQNVEKHNFLDDRKAKKRAPRNRRPFEIDTNSHFASSEVRGMLRDMVIRIIETCFNRLMKSSKTTV-FVQVQKTSQINYFFLIKFVLRFVRLSRQDHLL-ERISECIGVEAFHENNVQLTEYVENATTLKGVEAKSHGLKAQYALGAYNELVLLHRYIYEHAKEENERKFAKRALEHIVNVEEYRELPIFIIKKFSSSVLSNNFLRELVLTTHHYMKLVE-------RFVKTGALKKVTKKVKVRKATKKSKMSEEDVRSEFDGMSKKDLDRLWEESKGLVLQILKKEV--------------PEMRGMNPIDSQLDVPVDAQQKFAKLSIQRSLRSRGFPAAVGLYHASRALWPESFKRGLTDFQDSPGEEDQLQELEQLLKADMKKVAKDLKK 666          
BLAST of Timeless circadian clock vs. UniProt/SwissProt
Match: sp|O17482|TIM_DROVI (Protein timeless OS=Drosophila virilis OX=7244 GN=tim PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 5.178e-8
Identity = 50/223 (22.42%), Postives = 111/223 (49.78%), Query Frame = 1
Query:  976 RDRKLRRKAKNQVHNKEETYIHKSTDK-VLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYID----NSKTKESAVSSY-RKLHLVMSAYKELLEFCLMLD--NHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEF-GMKFVG 1617
            R +KL +++K+ + N +   +H   D  + N L+EF   FL  GYN L++   S L        D +++ W + FF++   + +L  E +   +T  V  ++  + +   +    N++ + + +  Y R++HLV++A +E L+     +   H  E  R     ++ ++  +++   ++ +LL  F P   S+ +L+ L+  + +++ IL +  +  G + +G
Sbjct:  520 RRKKLVKRSKSSLINMKGLVLHTPNDDDISNLLKEFTVDFLLKGYNYLVEELHSQLLSNAKMPIDTSHFFWLVTFFLKFAAQLELDMEHIDTILTFDVLSFLTYEGVSLCEQLELNARQEGADLRPYLRRMHLVVTAIREFLQAIEAYNKVTHLSEDDRYRLRQLQLQISATTDLRCLFVLLLRRFNPSIHSKQYLQDLVVTNHILLLILDNAAKLEGGQTIG 742          
BLAST of Timeless circadian clock vs. TrEMBL
Match: A0A3Q0KRK0 (Timeless, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 2.312e-122
Identity = 371/1090 (34.04%), Postives = 564/1090 (51.74%), Query Frame = 1
Query:   85 SDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQLRRQRELELMAKS---------AENPRVKRFGGTFELQDIKTESGRPAIYHHDINW-------------SKIDLTRDRKL------RRKAKNQVHNKE--ETYIHK-STDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDN-------SKTKESAVSSYRKLHLVMSAYKELLEFCL--ML-------------DNHQ---EEKYRT---LSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDH-NEFGMKFVGXXXXXXXXXXXXXXANQE-------NQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVE--EEIKILKDIMFANKFYKEEDLIKLS-KEISEIGVVXXXXXXXXXXXXXINS------------VQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXD-PLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPK-EWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELK-------------NKKRENNP----WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPD-----------------------KLRSRGSVIKKILELGLVENKDQL 2982
            +D+ AC +CLG  E   +  D D   S+R +LR+LR ET +C+IR ELG+ +++ + LI LL+  + +  LF+LVIRLLMNLTQP+ +CF+QE+PKD      +++VD++L+  K  F D +   VL + +  +  + WE+RSE++ LL+ERILIL+RN+LHI  +       +   S HD ++  M  SGW +LL++L+N+++E  F FHTLEIISLM REQ+ E +    + N  E+ S+   RR+    L  +          A N R  RFGG FEL +  + S RP IYHHDI               S +D+  +  +      +RK +   H K   +  IH+ S   V   LQ FC  FL+  YN +M+   S L RQ  Q +DETY+LW +RFFM  CR  +   + +SET+++P+FHW+Y Q + Y ++         + + A+ + R+L L ++ YKE L  CL  ML             D  Q   EE+ R+   ++ SI + VFY +EY E++P LL  +  I  S+ +LR L+EGS L I +L +       K + K+ R  R K   SKA +E       NQ    + I   +    N L G    ++E L+     E E   +   + D  L    ++   +SE  D QLK A+  VQ  L   ++  A+++ +   +LWPE   + + +D++ ++      +  + +      ++  + +L  K +  +G +    +     D+  N                +EV  DFS F+  F HP VV+ + +L ED   NP S N  ++  +H +A K +     +QL+LF  F KFL D  L+ +PEFK L   + +I++KF E   +N  +L+E LF K   E++ETV GY   + N     WT E ++EL +LFE  +H+ +  G D A ++   FSD +KTRRQI+ RL+TLGLI+S K+LK             N++  NN     WT  E ARL  +VE  +     + EIMN +K   VD D                        +R+R  V  KILELGLV+N++QL
Sbjct:   10 ADIQACCSCLGFREGDTYKIDTDAEVSIRTLLRYLRNETAECDIRRELGQLRIVSSDLIPLLRCCSGNKTLFELVIRLLMNLTQPAIVCFRQEVPKDRDLYSAYLQVDDLLKSYKKDFADEELFRVLCNLVGSLLDRSWEERSEEDRLLIERILILIRNVLHIAPDVVGEQRTDEDVSVHDQILWAMHLSGWDELLLFLANSDDERMFAFHTLEIISLMLREQTPELLAC--AGNRAETKSELNKRRKLIERLKIRDDAERKNFLYACNLRQARFGGAFELVNTPSLSERPLIYHHDITHTAQMATVISKQLDSSVDVVDNVGIVELDVGKRKFRKPKHRKPLVDRSIHRRSILAVQLYLQGFCWQFLKFCYNPIMRVVQSGLTRQATQENDETYFLWTMRFFMAFCRVYRFRSDYISETLSVPIFHWIYDQVINYKEHLVTNKRGGASNQRAMQAARRLELAVACYKEFLT-CLNRMLHVTGADKTVQPGDDETQDGVEERLRSQANVAESIIANVFYVAEYQEVFPNLLRDYNEIFMSKDYLRDLVEGSHLFITLLSNKICGSNKKIIVKRRRVHRMKKRSSKAKKETRKKAILNQEPEDVRISRLKQQWSNQLEG---PLIEILLGTAYQESEQDESDDEMNDTRL---FDATTGNSE--DQQLKSAIRRVQAALFAGSAKRALSMAKRMWRLWPEVAPVSIEEDNSAIDAGRAAGLRPECLNVLGALQQIHMTELGDKRLFILGALNNSSSNSSDGDDLYNEELGISDSNDELVTTEKEVVLDFSAFMLKFVHPRVVHAYTLLLEDYDNNPESVNRAIVHTIHRLAVKERLTGCFFQLRLFRVFQKFLHDRALATSPEFKELANLIKYILRKFFEAEERNNYILIETLFFKTPKESYETVQGYGTFESNKKTIHWTSEHDKELTQLFEAYRHDPVPSGNDLADLLVKYFSDSSKTRRQIVARLITLGLITSLKQLKEITVRPPKPLSGRNRRLLNNGESSEWTEQEIARLRDIVELHKGSKNMLTEIMNEIK---VDHDLAVQRCLEQELIMDENQSGKYIPPIRARRVVAAKILELGLVDNENQL 1085          
BLAST of Timeless circadian clock vs. TrEMBL
Match: A0A0X3PCW4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR104658 PE=4 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 7.002e-117
Identity = 373/1126 (33.13%), Postives = 561/1126 (49.82%), Query Frame = 1
Query:   85 SDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENE-ERFTFHTLEIISLMFREQSAEFMDT------LKSSNSTESASDQQLR-RQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPAIYHHDI----------------------------NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYID-------NSKTKESAVSSYRKLHLVMSAYKELL---------------EFCLMLDNHQEEKYRTLSA------SIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEI--------------PSEQDDGGNVLRGIW--DEMLET------------LMSAVNGEVELPLN---LPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVT-------DDDNR-------------VEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXIN------SVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDP-LSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKE-WTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKEL------------KNKKRENNPWTADEQARLIILVEESRDQPIPIKEIMNGLKATAVD--------------PD----------KLRSRGSVIKKILELGLVENKDQLG 2985
            +DL AC  C+G  +   +  D D   SLR ILR+LR E+  C+IR ELG+ K+I + L+ L+K  +  + LFDL IRLL+NLTQP+ +CF+ ELPKD      +++VD +L+ CK  F D     VL+S++ +++ K W +RS D+ LL+ERILIL+RN+LHI  + S     +   S HD L+  M  SGW +LL++++NAE+E + F FHTLEIISLM REQ+ E + +      + ++ + ES   ++LR R++E +  A    N R  RFGGTFEL + K+ S RP IYHHD+                            +   +DL   + +RRKA+N+    E     +S   V   LQ FC  FL   YN LM  A S + RQ  QA+DETYYLWA+ FFM  CR      E VSET+++PVFHWVYQ +M Y +          T  +A+ S R+L L +SAY++ L                  L+   + EE+ + L A      S+ + +FY ++Y+++YP+LL  +    Q++ +L  L EG+ L + ++    +     V  + + +RR++ + +  +E Q     E+              P E+       R +W  D    T            L++  NG ++   N   LP ++DP      E+   D + V +QL+ A+ LV   L++   ++A+ I  L  ++WPE      T       DDD +                E   LK I   +    EE+L  L K I E    + +E E +    ++       SV  +EV  D    +  F H + +    +L E+   NPP+TN+ L+R+ H +A + + P   +Q++LF  F   + DP +S   EF+ L KF+ +I++KF E   +NR + +E LF K+  E+ E   GY   D  +    WT EL++EL +LF+  + E +  G D A V++   SD  KTRRQI+ RL+ L  I SAK L            +  +R   PWT +E  RL  L EE    P  + ++MN LK    D              PD           LRSR  V +K++ELGLV +  Q G
Sbjct:   10 ADLQACCVCIGFKDEDAYKVDADAEASLRSILRYLRAESSSCDIRRELGRLKIITSDLLPLMKTPDITNALFDLTIRLLVNLTQPAIVCFRHELPKDRDLYTCYMQVDNLLKDCKKAFADEQAFRVLASRVENLFNKTWVERSNDDRLLIERILILIRNVLHITPDTSSEHRTDEDVSVHDQLLWAMHLSGWDELLLFMANAEDERDNFAFHTLEIISLMLREQTPELLASAGKPADVAAAMNPESQVLERLRLREKEWKRAALVELNMRHNRFGGTFELLNTKSLSDRPLIYHHDVTAPLMCAKMRHDPIDGTESSGDVGSLTADVGLVDLNLGKTVRRKARNRKPLLERDLHRRSIFAVQLYLQNFCWQFLCNCYNPLMNAARSAILRQTTQANDETYYLWAMHFFMAFCRLYNFRAELVSETLSVPVFHWVYQLSMSYREAVLADRKGGGTNVTALHSSRRLALAVSAYRQFLLSLQEMARPGSTVVTPAALICQENPEERSQRLKAHKQAAESLMANIFYIADYLDLYPLLLREYNESVQTKQYLIDLAEGANLFLNLISAQEKTNKTLVVSQRQRRRRRTEEQRKKREQQKQRRRELQAARRRAQRRAGQTPEER---AAERRLVWTGDPAAGTNNTTSLSYRLLRLLADQNGSLQTAENAEELPQLFDP----TAETEADDRDAVAAQLRNAIRLVHTALQEGRLMQALRIARLMWEIWPESAPTTATMNEQDEHDDDGQDMTRALEAGLAPSAVSEFIALKRIFMLD--LVEEELEAL-KRIGEDITDDAEEEEEDLIARELEDSDDEFSVINKEVSLDLDNLLLKFAHAHTIRNLTLLLENYALNPPTTNDCLVRLFHRVAVRRRLPGACFQVRLFRVFQSIVNDPGISKQDEFQELLKFIKYILRKFFEAFERNRNVSVEALFLKSAKESFEAFNGYGTFDAGSRASVWTPELDQELGQLFDAYRFEPVPKGEDLADVLQRLLSDPGKTRRQIIMRLIYLTKIDSAKSLRMMTCRSAEDERRGSRRPKRPWTEEEVERLKTLFEEHSGTPYFLSDLMNTLKFEYEDRVKSLENAGSLEEVPDIAAADSSTQPLLRSRKEVGQKLIELGLVSSPSQFG 1125          
BLAST of Timeless circadian clock vs. TrEMBL
Match: G4LZH9 (Timeless, putative OS=Schistosoma mansoni OX=6183 GN=Smp_163340 PE=4 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 3.614e-113
Identity = 367/1098 (33.42%), Postives = 560/1098 (51.00%), Query Frame = 1
Query:   85 SDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQLRRQRELELMAKS---------AENPRVKRFGGTFELQDIKTESGRPAIYHHDINW-------------SKIDLTRDRKL------RRKAKNQVHNKE--ETYIHK-STDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDN-------SKTKESAVSSYRKLHLVMSAYKELLEFCL--ML-------------DNHQ---EEKYRT---LSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDH-NEFGMKFVGXXXXXXXXXXXXXXANQE-------NQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEE------------IKILKDIMFANKFYKEEDLIKLSKEIS-----------EIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXD-PLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPK-EWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELK-------------NKKRENNP----WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPD-----------------------KLRSRGSVIKKILELGLVENKDQL 2982
            +D+ AC +CLG  E   +  D D   S+R +LR+LR ET +C+IR ELG+ +++ + LI LL+  + +  LF+LVIRLLMNLTQP+ +CF+QE+PKD      +++VD++L+  K  F D +   VL   +  +  + WE+RSE++ LL+ERILIL+RN+LHI  +       +   S HD ++  M  SGW +LL++L+N+++E  F FHTLEIISLM REQ+ E +    + N  E+ S+   RR+    L  +          A N R  RFGG FEL +  + S RP IYHHDI               S +D+  +  +      +RK +   H K   +  IH+ S   V   LQ FC  FL+  YN +M+   S L RQ  Q +DETY+LW +RFFM  CR  +   + +SET+++P+FHW+Y Q + Y ++         + + A+ + R+L L ++ YKE L  CL  ML             D  Q   EE+ R+   ++ SI + VFY +EY E++P LL  +  I  S+ +LR L+EGS L I +L +       K + K+ R  R K   SKA +E       NQ    + I   +    N L G    ++E L+     E E   +   + D  L    ++   +SE  D QLK A+  VQ  L   ++  A+++ +   +LWPE   + + +D++ ++              +  L+ I       +EE+   L+   S           E+G+ + ++  + T+ E +       + F   R + ++          +L ED   NP S N  ++  +H +A K +     +QL+LF  F KFL D  L+ +PEFK L   + +I++KF E   +N  +L+E LF K   E++ETV GY   + N     WT E ++EL +LFE  +H+ +  G D A ++   FSD +KTRRQI+ RL+TLGLI+S K+LK             N++  NN     WT  E ARL  +VE  +     + EIMN +K   VD D                        +R+R  V  KILELGLV+N++QL
Sbjct:   10 ADIQACCSCLGFREGDTYKIDTDAEVSIRTLLRYLRNETAECDIRRELGQLRIVSSDLIPLLRCCSGNKTLFELVIRLLMNLTQPAIVCFRQEVPKDRDLYSAYLQVDDLLKSYKKDFADEELFRVLCDLVGSLLDRSWEERSEEDRLLIERILILIRNVLHIAPDVVGEQRTDEDVSVHDQILWAMHLSGWDELLLFLANSDDERMFAFHTLEIISLMLREQTPELLAC--AGNRAETKSELNKRRKLIERLKIRDDAERKNFLYACNLRQARFGGAFELVNTPSLSERPLIYHHDITHTAQMATVISKQLDSSVDVVDNVGIVELDVGKRKFRKPKHRKPLVDRSIHRRSILAVQLYLQGFCWQFLKFCYNPIMRVVQSGLTRQATQENDETYFLWTMRFFMAFCRVYRFRSDYISETLSVPIFHWIYDQVINYKEHLVTNKRGGASNQRAMQAARRLELAVACYKEFLT-CLNRMLHVTGADKTVQPGDDETQDGVEERLRSQANVAESIIANVFYVAEYQEVFPNLLRDYNEIFMSKDYLRDLVEGSHLFITLLSNKICGSNKKIIVKRRRVHRMKKRSSKAKKETRKKAILNQEPEDVRISRLKQQWSNQLEG---PLIEILLGTAYQESEQDESDDEMNDTRL---FDATTGNSE--DQQLKSAIRRVQAALFAGSAKRALSMAKRMWRLWPEVAPVSIEEDNSAIDAGRAAGLRPECLNVLGALQQIHMTELEEEEEEQEALNNSSSNSSDGDDLYNEELGISDSNDELVTTEKEVVLDFSAFMLKFVHPRVVHAYT---------LLLEDYDNNPESVNRAIVHTIHRLAVKERLTGCFFQLRLFRVFQKFLHDRALATSPEFKELANLIKYILRKFFEAEERNNYILIETLFFKTPKESYETVQGYGTFESNKKTIHWTSEHDKELTQLFEAYRHDPVPSGNDLADLLVKYFSDSSKTRRQIVARLITLGLITSLKQLKEITVRPPKPLSGRNRRLLNNGESSEWTEQEIARLRDIVELHKGSKNMLTEIMNEIK---VDHDLAVQRCLEQELIMDENQSGKYIPPIRARRVVAAKILELGLVDNENQL 1084          
BLAST of Timeless circadian clock vs. TrEMBL
Match: R7U1C1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_19701 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 4.511e-110
Identity = 326/980 (33.27%), Postives = 526/980 (53.67%), Query Frame = 1
Query:   88 DLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNS-TESASDQ-QLRRQRELELMAKSAE----NPRVKRFGGTFELQDIKTESGRPAIYHHDINWS-KIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEP----DSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXX-XXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNN--PK-EWTDXXXXXXXXXXXXXQHEDIL-PGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNK--KRENNPWTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVEN 2970
            +L A    LG TE  ++LK+ D + +++D++R L+RE + C+IR +LG+ ++++N LI L+K Y ++ +L + VIRL++NLTQP+ +CF+ ++P D      F++++  LQ  K  F D     +L+ K+ D+   ++E+R E++ LL+ERILIL+RNILH+  N       +   S HD ++  +  SG +DLL++L+ +++E +FT H LEIISLMFREQ+ E + +  ++ S TE   D+ +L   RE E + K  +    N R  RFGGTF + ++K+ + R  I+H  ++ + +I    ++  ++  KN+     E    +ST  +   L+EFC  FLQ  +N LM+     L R + Q +DETYYLWA+RFFMEV RR+    + VSET+++  FH+V  Q  +Y++   T K+  +   R++HL + AY ELL     +D  +++  R  +  I+  VFY  EY +I+ ++L  F   +QSRAFLR L+E + L +K+L+ + +     + +K++ K+ +  K KA     N   +E+  EQ      L  +WD        +V+G V       V+     P   E + P       P+D Q   A+  +Q  LR   + EAVA+F+  +++WP  DR    +++   E E   L++I+  N      D   L +   E    EE++ E    +E        E  FDF  F+  F  P VV  + +L +D   N    N   ++++H IA    Q  +L+Q +L     N  L D   +   F+ L  F   I++KF +   KNRK+  EV F K   EA E V GY   +D +  PK  W++E   EL RL EE + ++   PG D    I     D +KTRRQ++ +LV L +I+ AK+LK +   R    W  +E+A L  L E  ++ P P+  I++ + A        RS+  V KK+L +G+V +
Sbjct:    5 ELQATCASLGYTEGDKYLKEPDCLETVKDLIRFLKREDDSCDIRRDLGESQIVQNDLIPLVKHYADERILLETVIRLMVNLTQPAKLCFQNQIPDDKTQRNHFLQIEAHLQGYKQAFTDEALFAILTKKLGDLLSLDYENREEEDRLLIERILILIRNILHVPPNTQKEQRTDDDASTHDQVLWALHMSGMEDLLLFLATSDDENQFTLHVLEIISLMFREQTPEQIASSGAARSLTEREKDERELTIAREKEKVRKKTQVLKYNSRHSRFGGTFTVANMKSITDRDLIFHRPVSKANEISFDHNKTRKKAPKNRQPITAEEVTRRSTLSIRMFLKEFCLQFLQNCFNPLMRAVKDALNRSKAQENDETYYLWAVRFFMEVNRRHSFRIDLVSETLSVASFHYVQTQLQLYLEMMITNKKEGIVWSRRMHLALKAYHELLLNLFEMDRSKDKAVRDSAKVIEGNVFYMMEYRDIFLIMLRKFDESRQSRAFLRELVETTHLFLKMLEGYCKQHRHLMVQKTKKKKPQKSKKKATANINN--NVELTQEQ------LIELWD--------SVSGGVS-----AVLQSGEEPSGAEGVVPFDAASQVPLDQQRIDAVFRIQEFLRADKAAEAVALFKASREVWP--DRPEFGEENMTTEAEFMSLREILLTN---LPRDACSLPEHQEENEEQEEEQEEEVEQEEYAGMADTTEQEFDFKEFVTRFASPLVVKAYTMLLQDFPRNSAQINRCCVKMLHRIAFDLNQVGMLFQARLFRVFQNVMLKDEHRSLSCFQELSTFGKHILRKFFDAALKNRKIFAEVFFWKGTKEALEIVDGYGTYNDRSKAPKVTWSEEENMELQRLCEEFKEKNAADPGADLGDYIVQNLIDDSKTRRQVVRQLVHLDIITCAKDLKRRTGARSLRGWREEEEAELRQLYELHKEDPDPLGSIISEMSAP-------RSKPVVSKKLLSMGIVSD 951          
BLAST of Timeless circadian clock vs. TrEMBL
Match: A0A0R3W7S8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6354 PE=4 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 4.464e-108
Identity = 339/1100 (30.82%), Postives = 537/1100 (48.82%), Query Frame = 1
Query:   85 SDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENE-ERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQLRRQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPAIYHHDIN----------------------WSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYID-------NSKTKESAVSSYRKLHLVMSAYKELLEFCL-------------------------------MLDNHQEEKY--RTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFV----GXXXXXXXXXXXXXXANQENQN----------IGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVEL--PLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWP-----------EEDRIMVTDDDNRVEEEI---KILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXIN---------SVQV--REVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNN-PEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPK-EWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENN------------PWTADEQARLIILVEESRDQPIPIKEIMNGLK---------------ATAVDPDKLRSRGSVIKKILELGLVENKDQLG 2985
            +DL AC  CLG  +  ++  D D   SLR ILR+LR E+  C+IR ELG  K++ + LI LLK+   D  LFDLVIRL+++LTQP+ +CF+ E+P D      F+KVD +L+  K  F D     VL+ ++ D++ K WEDRS+D+ LL+ERILIL+RN+LHI+ + +     +   S HD L+  +  SGW DLL++L+NA++E   F FH LEI SLM RE+  E     K S S  +                 S+ N    RFGGTFEL + ++ S RP IYHHD+                         ++DL   +++RRKA N+    E  +  +S   V   LQ+FC +FL+  YN LM  A   + R+ +QA+DETYYLW+++FFM  CR  +  P+ +SE++   VF+WVY  +M Y +            +SA+   R+L L +SA ++ L  CL                                L+  +   +  + ++ S+ S +FY +EY +++  LL  +    QS+ +L  L+EG+ L I +L    +  +  +     ++   + +K +K  A++E Q               E P E+      L  IW  +   L+SA++   +L    +LP ++DP        +  D E + +QL+ A+ LV   L    ++ ++AI      +WP           EE   +V +    +E  +   ++L+ +     F    DL     EI+E  + E    +   ++  +          S+QV  +E+ FD + F+  F HP+++ +  +L  +   NP STN  L+ ++H +  K   P VL+QL+LF  F   + DP+     EF+ +  F+ +I++KF E   ++  +++E LF K+  EA E   GY   +  + K  WT EL++EL +LFE  +++ +  G D   V++   SD   TRRQI+ RL+ LG ++SAK LK     +             PW+ +E   L  L  E       + ++M  L+               AT V    LRSR  V +K+ ELGL    +  G
Sbjct:   10 ADLQACCVCLGFLDENKYKVDADAPASLRSILRYLRNESSSCDIRRELGNLKILTSDLIPLLKVSGADPTLFDLVIRLMVSLTQPAVVCFRNEIPNDRDLYAAFLKVDAILKDYKYAFADEHLFRVLAERVEDLFNKSWEDRSDDDRLLIERILILIRNVLHISPDAATEHRTDDDVSVHDQLLWTIHISGWDDLLLFLANAKDELNVFAFHILEIASLMLREKFTE-----KRSTSLPT---------------IHSSHN----RFGGTFELLNTQSISSRPLIYHHDVTVPLRQSCSTCVKTGAKHAEFGAIDQVDLDLGKRMRRKACNRKPLIEREFRRRSVLSVQLFLQKFCWLFLRNCYNLLMYEARGAILRRSIQANDETYYLWSMQFFMAFCRLYRFRPQYLSESLNASVFNWVYALSMGYREALLTDRRGGARNQSALQWSRRLALAVSANRQFL-LCLQEMSKPSKEALRGKGFGGCGGGNDEEEGGEETLETREHRLFVQKQVAESLMSNIFYVAEYQDLFVFLLKEYNESIQSKEYLVELVEGAHLFISLLIAQAKSTVTLIVSRRQRRRHRREQKRLKYSAHRERQKKLAEARKRLLKRANETPEER---SAFLARIWTPLSSNLISALSSTPQLMSSDDLPQLFDP------ADVSADGESMAAQLRNAIRLVHTNLHNNQAVRSLAIARSMWDIWPEALPSNDMEEGEETEDLVKEKARAIEAGLGPSQVLEYLALRKIFLL--DLTAEELEITEAAIEEARNIDDAGEELALQESEDSNDECSLQVLDKEIAFDINAFLLRFTHPHIIRSLTLLLANYALNPSSTNTHLVHLLHKVTVKQHLPGVLFQLRLFYVFQTIIKDPVVGKLDEFQEMLCFIKYILRKFFETFERSHLVVVETLFLKSTREAAEAHNGYGTYESGHKKFYWTAELDKELDQLFEVYRYDPVPKGEDLVDVLKRNLSDPKMTRRQIIMRLIHLGKVASAKNLKMMTIRSGDGRTVRRSRRRPPWSEEEVNLLRSLFIEHEGSFHRLNDVMTELRLDYEQRMRQEDSEMPATVV----LRSRREVERKLTELGLARGLNDFG 1069          
BLAST of Timeless circadian clock vs. Ensembl Cavefish
Match: timeless (timeless circadian regulator [Source:NCBI gene;Acc:103032261])

HSP 1 Score: 338.961 bits (868), Expect = 1.553e-96
Identity = 300/994 (30.18%), Postives = 509/994 (51.21%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQ--------LRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFV-GXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKE---WTDXXXXXXXXXXXXXQHEDILPGFDKASVIES---RFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E + + K+ D + S++D++R+LR E +  +IR +LG  ++++N L+ ++  +  D  LFD  IRL++NLTQP+ +CF + +P D      F+++   L   K  F +     VLS  + ++   +WE R E+++LL+ERIL+L+RN+LH+  +  +    +   S HD L+  +  SG  DLL +L++A++E++++ H LE+ISLMFR+Q+ E    L S+  + SA ++Q        LR++ + E  ++  +   R  RF G++ ++ +K+   +  I+H  + N+        +  RR  K +   ++     +S   V   L+EFC  FL+  YN LM      L R+  Q  DETYY+WAL FFM   R N    E VSET+++  FH++ +    Y +   T K+ A S  R++HL + AY+ELL     +D+ ++E  R  +  IKS +FY  EY EI+  LL  F    Q R+FLR L+E + L +++L+       +F  G+ +   ++K  K    ++  +  T   P         L   W  + E L S      E      V +D             SE PV  Q   A+  +Q  +  R   EA+++    +++WPE +  +    + + EEE+++LK I+FA       +L + ++  +E  + E+D+     ++E++ SV+V E  F+F  FI+ F  PN+V  + +L     TN P TN+ ++R++H +    K   +L+QL +F  FNK L DP ++  +        I           +N K  +E+LF KN+    E   GYS   D   K+   WT   EEE        +H+D     +   ++E+     S+ N+TRR ++ ++V++GL+ S K+LK +++      WT D++  L +L EE +D    +  I+  L A        RSR  V+ KIL +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLEGETYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAGQILQNDLLPIITQHGQDKPLFDACIRLMVNLTQPALLCFGK-IPDDPAFRHHFLQIVSYLHAYKEAFANEKVFAVLSETLYNLLQLDWEQRQEEDNLLIERILLLIRNVLHVPPDPYEEKNVDDDASVHDKLLWAIHMSGMDDLLKFLASAQSEQQWSMHVLEVISLMFRDQTPE---QLVSAGHSRSAQEKQKDTSELESLRQKEQAEKRSRIMQRGNRHSRFRGSYVVEGLKSIGEKDVIFHSGLHNFKNYSHDAGKATRRVPKRKQMARDTDSQRRSVLNVRLFLREFCVDFLENCYNRLMYLVKESLIREHAQQHDETYYMWALSFFMAFNRGNGCKAELVSETLSVRAFHFIEKNITNYYEMMLTDKKEATSWSRRMHLALKAYQELLMTVNEMDHSKDENIRQSANVIKSNIFYLMEYREIFLTLLRKFDERMQPRSFLRDLVESTHLFLRMLE-------RFCKGRNNLLVQKKKAKRTTRKKKPSAPTENTP-------EALEETWKIISEELQSCGFQLSEALTEGAVPFDAA-----------SEIPVTEQRTEAMIRIQDAVLARTGPEALSLLRAAREVWPEGN--VFGSAEVQPEEELELLKQILFA-------ELPRPTQ--TEAAMDEDDDGAELEEEEELESVRVSETEFNFLDFIKRFASPNIVRPYLILLRSYATNTPHTNHCVVRMLHRVGVDLKMDALLFQLSVFYLFNKILSDPAASAYKELVTFAKYILNRFFAL--AARNNKAFIELLFWKNVGAVREMTEGYSKDGDGAGKKKVIWT--PEEEEELRQLYEEHKDS----EDPDIVETLLPLLSNTNRTRRHVVAQMVSMGLVDSVKDLKKERKGTRIVLWTEDQEQELQMLFEEYKDSEDILGNILKHLTAK-------RSRARVVDKILSMGLVSDRREL 939          
BLAST of Timeless circadian clock vs. Ensembl Cavefish
Match: timeless (timeless circadian regulator [Source:NCBI gene;Acc:103032261])

HSP 1 Score: 338.961 bits (868), Expect = 1.553e-96
Identity = 300/994 (30.18%), Postives = 509/994 (51.21%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQ--------LRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFV-GXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKE---WTDXXXXXXXXXXXXXQHEDILPGFDKASVIES---RFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E + + K+ D + S++D++R+LR E +  +IR +LG  ++++N L+ ++  +  D  LFD  IRL++NLTQP+ +CF + +P D      F+++   L   K  F +     VLS  + ++   +WE R E+++LL+ERIL+L+RN+LH+  +  +    +   S HD L+  +  SG  DLL +L++A++E++++ H LE+ISLMFR+Q+ E    L S+  + SA ++Q        LR++ + E  ++  +   R  RF G++ ++ +K+   +  I+H  + N+        +  RR  K +   ++     +S   V   L+EFC  FL+  YN LM      L R+  Q  DETYY+WAL FFM   R N    E VSET+++  FH++ +    Y +   T K+ A S  R++HL + AY+ELL     +D+ ++E  R  +  IKS +FY  EY EI+  LL  F    Q R+FLR L+E + L +++L+       +F  G+ +   ++K  K    ++  +  T   P         L   W  + E L S      E      V +D             SE PV  Q   A+  +Q  +  R   EA+++    +++WPE +  +    + + EEE+++LK I+FA       +L + ++  +E  + E+D+     ++E++ SV+V E  F+F  FI+ F  PN+V  + +L     TN P TN+ ++R++H +    K   +L+QL +F  FNK L DP ++  +        I           +N K  +E+LF KN+    E   GYS   D   K+   WT   EEE        +H+D     +   ++E+     S+ N+TRR ++ ++V++GL+ S K+LK +++      WT D++  L +L EE +D    +  I+  L A        RSR  V+ KIL +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLEGETYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAGQILQNDLLPIITQHGQDKPLFDACIRLMVNLTQPALLCFGK-IPDDPAFRHHFLQIVSYLHAYKEAFANEKVFAVLSETLYNLLQLDWEQRQEEDNLLIERILLLIRNVLHVPPDPYEEKNVDDDASVHDKLLWAIHMSGMDDLLKFLASAQSEQQWSMHVLEVISLMFRDQTPE---QLVSAGHSRSAQEKQKDTSELESLRQKEQAEKRSRIMQRGNRHSRFRGSYVVEGLKSIGEKDVIFHSGLHNFKNYSHDAGKATRRVPKRKQMARDTDSQRRSVLNVRLFLREFCVDFLENCYNRLMYLVKESLIREHAQQHDETYYMWALSFFMAFNRGNGCKAELVSETLSVRAFHFIEKNITNYYEMMLTDKKEATSWSRRMHLALKAYQELLMTVNEMDHSKDENIRQSANVIKSNIFYLMEYREIFLTLLRKFDERMQPRSFLRDLVESTHLFLRMLE-------RFCKGRNNLLVQKKKAKRTTRKKKPSAPTENTP-------EALEETWKIISEELQSCGFQLSEALTEGAVPFDAA-----------SEIPVTEQRTEAMIRIQDAVLARTGPEALSLLRAAREVWPEGN--VFGSAEVQPEEELELLKQILFA-------ELPRPTQ--TEAAMDEDDDGAELEEEEELESVRVSETEFNFLDFIKRFASPNIVRPYLILLRSYATNTPHTNHCVVRMLHRVGVDLKMDALLFQLSVFYLFNKILSDPAASAYKELVTFAKYILNRFFAL--AARNNKAFIELLFWKNVGAVREMTEGYSKDGDGAGKKKVIWT--PEEEEELRQLYEEHKDS----EDPDIVETLLPLLSNTNRTRRHVVAQMVSMGLVDSVKDLKKERKGTRIVLWTEDQEQELQMLFEEYKDSEDILGNILKHLTAK-------RSRARVVDKILSMGLVSDRREL 939          
BLAST of Timeless circadian clock vs. Ensembl Cavefish
Match: timeless (timeless circadian regulator [Source:NCBI gene;Acc:103032261])

HSP 1 Score: 338.961 bits (868), Expect = 1.553e-96
Identity = 300/994 (30.18%), Postives = 509/994 (51.21%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQ--------LRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFV-GXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKE---WTDXXXXXXXXXXXXXQHEDILPGFDKASVIES---RFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M+ Y+ +     TC  LG  E + + K+ D + S++D++R+LR E +  +IR +LG  ++++N L+ ++  +  D  LFD  IRL++NLTQP+ +CF + +P D      F+++   L   K  F +     VLS  + ++   +WE R E+++LL+ERIL+L+RN+LH+  +  +    +   S HD L+  +  SG  DLL +L++A++E++++ H LE+ISLMFR+Q+ E    L S+  + SA ++Q        LR++ + E  ++  +   R  RF G++ ++ +K+   +  I+H  + N+        +  RR  K +   ++     +S   V   L+EFC  FL+  YN LM      L R+  Q  DETYY+WAL FFM   R N    E VSET+++  FH++ +    Y +   T K+ A S  R++HL + AY+ELL     +D+ ++E  R  +  IKS +FY  EY EI+  LL  F    Q R+FLR L+E + L +++L+       +F  G+ +   ++K  K    ++  +  T   P         L   W  + E L S      E      V +D             SE PV  Q   A+  +Q  +  R   EA+++    +++WPE +  +    + + EEE+++LK I+FA       +L + ++  +E  + E+D+     ++E++ SV+V E  F+F  FI+ F  PN+V  + +L     TN P TN+ ++R++H +    K   +L+QL +F  FNK L DP ++  +        I           +N K  +E+LF KN+    E   GYS   D   K+   WT   EEE        +H+D     +   ++E+     S+ N+TRR ++ ++V++GL+ S K+LK +++      WT D++  L +L EE +D    +  I+  L A        RSR  V+ KIL +GLV ++ +L
Sbjct:    1 MDLYMMNCELLATCSALGYLEGETYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAGQILQNDLLPIITQHGQDKPLFDACIRLMVNLTQPALLCFGK-IPDDPAFRHHFLQIVSYLHAYKEAFANEKVFAVLSETLYNLLQLDWEQRQEEDNLLIERILLLIRNVLHVPPDPYEEKNVDDDASVHDKLLWAIHMSGMDDLLKFLASAQSEQQWSMHVLEVISLMFRDQTPE---QLVSAGHSRSAQEKQKDTSELESLRQKEQAEKRSRIMQRGNRHSRFRGSYVVEGLKSIGEKDVIFHSGLHNFKNYSHDAGKATRRVPKRKQMARDTDSQRRSVLNVRLFLREFCVDFLENCYNRLMYLVKESLIREHAQQHDETYYMWALSFFMAFNRGNGCKAELVSETLSVRAFHFIEKNITNYYEMMLTDKKEATSWSRRMHLALKAYQELLMTVNEMDHSKDENIRQSANVIKSNIFYLMEYREIFLTLLRKFDERMQPRSFLRDLVESTHLFLRMLE-------RFCKGRNNLLVQKKKAKRTTRKKKPSAPTENTP-------EALEETWKIISEELQSCGFQLSEALTEGAVPFDAA-----------SEIPVTEQRTEAMIRIQDAVLARTGPEALSLLRAAREVWPEGN--VFGSAEVQPEEELELLKQILFA-------ELPRPTQ--TEAAMDEDDDGAELEEEEELESVRVSETEFNFLDFIKRFASPNIVRPYLILLRSYATNTPHTNHCVVRMLHRVGVDLKMDALLFQLSVFYLFNKILSDPAASAYKELVTFAKYILNRFFAL--AARNNKAFIELLFWKNVGAVREMTEGYSKDGDGAGKKKVIWT--PEEEEELRQLYEEHKDS----EDPDIVETLLPLLSNTNRTRRHVVAQMVSMGLVDSVKDLKKERKGTRIVLWTEDQEQELQMLFEEYKDSEDILGNILKHLTAK-------RSRARVVDKILSMGLVSDRREL 939          
BLAST of Timeless circadian clock vs. Ensembl Cavefish
Match: timeless (timeless circadian regulator [Source:NCBI gene;Acc:103032261])

HSP 1 Score: 335.109 bits (858), Expect = 7.130e-96
Identity = 331/1163 (28.46%), Postives = 553/1163 (47.55%), Query Frame = 1
Query:   70 MEKYLSDLHACITC--LGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQ--------LRRQRELELMAKSAENP-RVKRFGGTFELQDIKTESGRPAIYHHDI-NWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFV-GXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIES---RFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL-GIRDKNSKLIPNYDSGSXXXXXXXXXXXXXXXXXXSRFMNDLFHQSLSSIKRNPPALKVKRKIDWDTLKIIYAQLDTKVQEWFVETLEDNIDSR-ANGIVGPLAIVPLREHDSEILENKLLQRLLYICEFLYPDQSKGHLFWRIPEEMTAKELEYFKNCVTSLTESELEALA 3495
            M+ Y+ +     TC  LG  E + + K+ D + S++D++R+LR E +  +IR +LG  ++++N L+ ++  +  D  LFD  IRL++NLTQP+ +CF + +P D      F+++   L   K  F +     VLS  + ++   +WE R E+++LL+ERIL+L+RN+LH+  +  +    +   S HD L+  +  SG  DLL +L++A++E++++ H LE+ISLMFR+Q+ E    L S+  + SA ++Q        LR++ + E  ++  +   R  RF G++ ++ +K+   +  I+H  + N+        +  RR  K +   ++     +S   V   L+EFC  FL+  YN LM      L R+  Q  DETYY+WAL FFM   R N    E VSET+++  FH++ +    Y +   T K+ A S  R++HL + AY+ELL     +D+ ++E  R  +  IKS +FY  EY EI+  LL  F    Q R+FLR L+E + L +++L+       +F  G+ +   ++K  K    ++  +  T   P         L   W  + E L S      E      V +D               PV  Q   A+  +Q  +  R   EA+++    +++WPE +  +    + + EEE+++LK I+FA          +L + I  I VV                                F  PN+V  + +L     TN P TN+ ++R++H +    K   +L+QL +F  FNK L DP ++  +        I           +N K  +E+LF KN+    E   GYS  D      WT   EEE        +H+D     +   ++E+     S+ N+TRR ++ ++V++GL+ S K+LK +++      WT D++  L +L EE +D    +  I+  L A        RSR  V+ KIL +GLV ++ +L   R +N+    +  SG+   +    + E+++E E+     D   +    ++  P        I W T       L   V  W    L    D R  +G+  P+ +VPL E + + +ENK  QRLL       P   +   FWRIP  ++  +L      +  L E+E+   A
Sbjct:    1 MDLYMMNCELLATCSALGYLEGETYHKEPDCLESVKDLIRYLRHEDDTRDIRQQLGAGQILQNDLLPIITQHGQDKPLFDACIRLMVNLTQPALLCFGK-IPDDPAFRHHFLQIVSYLHAYKEAFANEKVFAVLSETLYNLLQLDWEQRQEEDNLLIERILLLIRNVLHVPPDPYEEKNVDDDASVHDKLLWAIHMSGMDDLLKFLASAQSEQQWSMHVLEVISLMFRDQTPE---QLVSAGHSRSAQEKQKDTSELESLRQKEQAEKRSRIMQRGNRHSRFRGSYVVEGLKSIGEKDVIFHSGLHNFKNYSHDAGKATRRVPKRKQMARDTDSQRRSVLNVRLFLREFCVDFLENCYNRLMYLVKESLIREHAQQHDETYYMWALSFFMAFNRGNGCKAELVSETLSVRAFHFIEKNITNYYEMMLTDKKEATSWSRRMHLALKAYQELLMTVNEMDHSKDENIRQSANVIKSNIFYLMEYREIFLTLLRKFDERMQPRSFLRDLVESTHLFLRMLE-------RFCKGRNNLLVQKKKAKRTTRKKKPSAPTENTP-------EALEETWKIISEELQSCGFQLSEALTEGAVPFDA----------ASEIPVTEQRTEAMIRIQDAVLARTGPEALSLLRAAREVWPEGN--VFGSAEVQPEEELELLKQILFA----------ELPRPIRSIKVV--------------------------------FASPNIVRPYLILLRSYATNTPHTNHCVVRMLHRVGVDLKMDALLFQLSVFYLFNKILSDPAASAYKELVTFAKYILNRFFAL--AARNNKAFIELLFWKNVGAVREMTEGYSK-DGCKKVIWTP--EEEEELRQLYEEHKDS----EDPDIVETLLPLLSNTNRTRRHVVAQMVSMGLVDSVKDLKKERKGTRIVLWTEDQEQELQMLFEEYKDSEDILGNILKHLTAK-------RSRARVVDKILSMGLVSDRRELYKKRRRNTDFFADL-SGAPRRDAITGDEEEEDELEDELMDEDEDEEEKEEVRVLPFIF-----IFWLT------GLSGPVL-WLQNCLNRAADDREEDGVSHPVPLVPLTEENEDAMENKSFQRLLRKVGIRAPADEQES-FWRIPATLSIYQLRVLATSLNPLKENEVGGPA 1061          
BLAST of Timeless circadian clock vs. Ensembl Sea Lamprey
Match: timeless (timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE-030131-8978])

HSP 1 Score: 269.24 bits (687), Expect = 1.856e-74
Identity = 288/978 (29.45%), Postives = 469/978 (47.96%), Query Frame = 1
Query:  163 SLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLD---SKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQS-AEFMDTLKSSNSTESASDQ---QLRRQREL-----ELMAKSAENPRVKRFGGTFELQDIKTESGRPAIYH----------HDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAM-IYIDNSKTKESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIK-SRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEED---RIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDN------NPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIE---SRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP-WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            +++D++R LRRE +  +IR +LG   +++N L+ LL  ++ND VLF  +IRLL+NLTQP+ + F + +P D      ++ V   LQ  K  F +     VLS  + ++   EWE R E++ LL+ER+L+L+RN++H+     D  +   +D   S HD ++  +  SG  DLL +L +A +E+++  H LEI+ LMFR Q+ ++ + T  +    E  +D    +L RQREL      +  +S+   R  RF GT+ +Q  K+ S    ++H          HDI          ++ +R+ K ++   E     +S   V   L+ FC  FL   YN LM +    L  ++ Q +DE+YY+WAL FFME  R     PE VSET+ +  FH++ +     Y      K+ A+   R++HL + AY+EL+     +D  +EE  R     IK   +FY  EY E++  L   F   KQ R+FLR L+E +   +++LQ         V +K R KR+K  +++A            PS  +         W ++ + L++   G   +P       D  +P      +  SE PV+ Q  +A   +Q  L    +  AV +    +++WPE +    + +T +D     E+++L+ I  A          KL  E   +      E   E ++E++ +V V E  F+F+ +I+ F    V+     L      N   TN+ ++ I+H +        +L+QL  F  F   L DP ++  +  +     I       E   +N K  +E+LF K+    HE   GY ++ D        P+ WT+E + EL +LF E Q  D + G     V++       D  +TR+QI+ +LV  GL++S+KELK +K      W  +++  L  L EE       +  I+  L A        RSR  V  K+L +GLV ++ QL
Sbjct:    2 TVKDLIRFLRREDDSKDIRQQLGDAMILQNDLVPLLLYHHNDQVLFQAIIRLLVNLTQPAIVLFGK-VPTDPTTRHHYLAVTCHLQAYKQAFANEKVFTVLSETLYNLLQLEWEQRQEEDTLLIERMLLLVRNVMHV---PPDPTLEKNVDDDASLHDRVLWALHMSGMDDLLRFLCSAPSEQQWCMHVLEIVCLMFRMQTPSQLVSTGGARPEREKEADTTELELLRQRELAEKRNRMWHRSS---RHSRFVGTYVVQGHKSISDNDLVFHLGVQKLAGYSHDIG---------KEPQRRPKRRLLAPEAEERRRSAMNVRLFLRTFCIDFLDACYNRLMYSVKDTLLLEKGQQNDESYYMWALAFFMEFNRLRGFRPELVSETVGVRTFHFIEKNLTNCYEMMLMEKKDALPWSRRMHLALKAYQELIMTLEEMDKSKEESVRESGNVIKCGNLFYVMEYRELFVTLFRKFDETKQPRSFLRDLVETTHTFLRLLQRFCRGRKAVVVQKKRVKRKKKSRAQAQ-----------PSSSERSPEECEAQWQQLSQQLIAYAQGAEAVP-------DSAVP-----FDAASEVPVEEQRGQATARIQAALLAGQAGTAVGLLRSAREVWPEGEVFGAVGITPED-----ELELLRQIHAA----------KLPFEDVPVEDDVGPEEMEEEENEEVEAVSVSEKEFNFTEYIKRFASAPVMKACMSLLRGYRENSAHTNHCIVVILHRVTVGLHMEGLLFQLSAFRVFQAILADPAAHVYQELSKFARHIVRKFF--EVAAQNNKSFVELLFWKSPANVHEMTEGYGSAHDGGGLSKKGPR-WTEEEQTELDKLFSEFQ--DQIGGSQDKDVVDHIMEHIRDATRTRKQIVAQLVRQGLVNSSKELKRRKGVKLVLWREEQEMELQRLFEEFHKSDDLLDNIVRNLTAK-------RSRKKVADKLLSMGLVSDRAQL 913          

HSP 2 Score: 54.299 bits (129), Expect = 2.150e-7
Identity = 28/83 (33.73%), Postives = 43/83 (51.81%), Query Frame = 1
Query: 3226 WFVETLEDNIDSRA-NGIVGPLAIVPLREHDSEILENKLLQRLLYICEFLYPDQSKGHLFWRIPEEMTAKELEYFKNCVTSLT 3471
            W    L    D R  +GI  P+ +VPL E + + +EN++ +RLL       P   +   FWRIP E+T   L    +C+++LT
Sbjct:  990 WLGNCLRRTADDREEDGISLPVPLVPLSEENEDAMENRVFRRLLRALGVCSPANHE-ETFWRIPAELTPSRLREISDCLSALT 1071          
BLAST of Timeless circadian clock vs. Ensembl Nematostella
Match: EDO48937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHY6])

HSP 1 Score: 348.591 bits (893), Expect = 3.811e-101
Identity = 301/986 (30.53%), Postives = 516/986 (52.33%), Query Frame = 1
Query:   70 MEKYLSDLHAC-ITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLK-LYNNDSVLFDLVIRLLMNLTQPSYICFKQ-ELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFM----DTLKSSNSTESASDQQLRRQRELELMAKSAE--NPRVKRFGGTFELQDIKT-ESGRPAIYHHDINWSK-IDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDN-SKTKESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSE-PVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKA-SVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNPWTADEQARLIILVEESRDQPIPIKE-IMNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQL 2982
            M +YL+    C +  LG  E  ++ K  D + SL+D+++ LRR+   CEIR +LG  KV+EN LI+++K     +  +FD+VIRL++NLTQP+ +CF+  ++P+D  G   ++++   LQ  K  F D++ + V+  ++S    K+W+DR E+++LL+ER+L+L+RNILH+  N       +   S HD +V  + ++G  DLL+Y++++ +E R+  HTLEIISLM REQ+ E +    D+   S  +E     +  R+REL    K+A+  + R  RFGGTF + ++ +    R  IYHH +  +K +   R++   RK KNQ+  KE T   +ST  +   LQ FC+ FL+  YN L+      L  ++ Q +DE+Y+LWA++FFME  R      + V ET+++  F +V +  M Y D+  + K++ V+  R+LHL + AYKELL + L ++   +E  R+ +  IK+ +FY  EY +++  L+  F   KQS+A+LR L+E   + +K+L+D+       V      +++K  K+K  +  Q    + + +EQ D       +W  M   L S + G           ++  +PE     +  S+ P+D Q   AL  +Q +L+     E++A+    +++WP  D     D D   E+E   L DI      +K  DL   +  +++      +E  L+  +    S+   + P +F  + R  C P+++  +  L      N   TN+ L++++H +A   K   +++QL LF  FN+ L DP ++  ++K + KF  +I+  F E + KN  L +E+   K     +E   GY +  +    + +            +  +     G D     I     D  +TRRQI+N+L  LGL++  +  +    +   W ADE+ +L  + EE +     I E I++ L  T+      RSR  V+ +++++GLVE++  L
Sbjct:    1 MNQYLNTEIVCTLAGLGCAEGTEYYKSPDCLESLKDLIKFLRRDDSTCEIRRQLGNSKVLENDLIAIVKSCTPKEQDIFDMVIRLMVNLTQPAALCFEHGKIPEDKTGQHYYLELVNQLQSYKEAFTDKEAMAVIGRELSRTLQKDWDDRQEEDYLLIERVLLLIRNILHVPANPQAEKRTDDDASIHDQVVWGLHQNGVDDLLLYIASSPDERRWCMHTLEIISLMLREQNPESLARAGDSRSKSEKSEDVRQLETIRERELAEKKKNAKKFSGRHSRFGGTFYINNMMSIADKRQMIYHHSVADAKNLTFDREKSAPRKRKNQIIAKEMTVERRSTLSIRLFLQGFCKQFLEHCYNPLLYVVRDNLMHERSQENDESYFLWAMKFFMEFTRHFDFRVDFVGETMSVSNFQYVLKILMQYYDSFVEDKQNPVTWGRRLHLAVQAYKELLMYVLFMEKSNDETLRSNAKVIKANIFYMVEYRDVFLFLVRKFDKSKQSKAYLRDLVETFHVFLKMLEDYCSGKSHIV----IQQKKKKKKTKKRKSKQAPARVNLSAEQAD------EMWQAMASELSSWIQG-----------HNGTIPESVVPFDAASDIPIDQQRVSALSRIQTQLQNCEYGESIALLRAAREVWP-NDSFGAADGDP--EDEFMCLHDI------FKMTDLPIETTPLADAEAEVNEEEILQLVESKFISLSCWKFP-NFLSYSRLAC-PSILQPYCWLLGFYRENSAKTNHYLVKMLHRVAVDLKIVPMMFQLSLFVTFNRVLHDPAAS--QYKEMVKFARYILGNFFEMLPKNPVLCVELSTWKTTDACYEISEGYGSLQNRRSLKKSGATWSYEEEEELKSLYHQYQEGEDDVIDKILDNLQDDTRTRRQIINKLFLLGLVTDKRAFRKPAAKKGAWGADEEEQLRAVYEEYKQSDGDIVEKILSHLTNTS------RSRRQVVNQLVKMGLVEDRKTL 946          
BLAST of Timeless circadian clock vs. Ensembl Medaka
Match: timeless (timeless circadian regulator [Source:NCBI gene;Acc:101171325])

HSP 1 Score: 327.791 bits (839), Expect = 8.783e-93
Identity = 303/967 (31.33%), Postives = 503/967 (52.02%), Query Frame = 1
Query:   97 ACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASD-----QQLRRQRELELMAKSAE-NPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKIDLTRD--RKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLV 2964
            A  + LG  E   + K+ D + S++D++R+LR E +  ++R +LG  ++++N L+ L+  +  D  LFD  IRL++NLTQP+ +CF + +P D V    F++V   LQ  K  F       +LS  + +    +WE R E+++LL+ERIL+L+RNILH+  +  +    +   S HD ++  +  SG+ DL+ +L++A++E++++ H LEIISLMFR+Q+AE + +   S S E         + LR++   E  +++ +   R  RFGG F +Q +K    +  IYH  ++  K   T D  + +RR  K      E     +S   V   L+EFC  FL+  YN LM      L R+Q Q  DETYYLWAL FFM   R N    + VSET++I  FH++ +    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  +KS +FY  E+ EI+  LL  +   KQ   +L+ L+E + L +++L+   +     V      ++R   K   N++ Q++         +     L   W +++E  + A   ++   L   +I  P   +    I     P++ Q   A+  VQ  L      EA+A+    +++WP  D  +    D   EEE+++LK+I+ AN          L +  +E  +VEE+++ +E ++E++ S+QV E  F+F  FI+ F +P++V  + ++      N P TN+ ++R++H +A   K   +L+QL +F+ FNK L DP +   +        +           +N K  +E+LF KN+    E   GYS   +     W++E EEEL +L+ E +  D+ P  D    +    S+ ++TRRQ++ +LV +GL+ +AKELK +K+      WT D++  L +L EE +D    +  IM  L A        RSR  V+ K+L +GLV
Sbjct:    7 ATCSALGYLEGDNYHKETDCLESVKDLIRYLRHEDDSRDVRRQLGASQILQNDLLPLIVQFRQDKTLFDACIRLMVNLTQPAVLCFGK-VPDDPVFTHHFMEVTSHLQAYKEAFASERVFGILSETLYNFLQLDWEQRQEEDNLLIERILLLVRNILHVPADPCEEKKVDDDASIHDKVLWAIHMSGFDDLVKFLASAQSEQQWSMHVLEIISLMFRDQTAELLVSAGHSRSAEEKQRDLQELEALRQKENAEKRSRTLQRGTRHSRFGGCFVVQGLKAIGDKDVIYHRRLHKFK-SYTHDEGKAVRRVPKRNQRASECKEQRRSALNVRLFLREFCVDFLENCYNRLMYLVKENLIREQSQQHDETYYLWALSFFMAFNRGNNFRADLVSETMSIRAFHFIERNITNYYEMLLTDRKEATSWSRRMHLALKAYQELLLTVNEMDRSHDEGIRQSSNVLKSNIFYMMEFREIFLTLLRKYDETKQPGTYLKDLVETTHLFLRMLERFCKGRKNLV----VQRKRVKRKKSHNRKKQSVA--------ETSPEALAETW-KIVEEELRASGFQLSESLTGSII--PF--DATSKI-----PLEEQRIEAMVRVQDALLAHTGPEALALLRAAREVWP--DGNVFGSPDVEPEEELELLKEILHAN----------LPRSTAET-LVEEEDDGIEFEEEELESIQVSETEFNFKDFIKKFANPSIVRPYILMLRTYSKNTPHTNHCVVRMLHRLAVDLKMDALLFQLSVFHLFNKILSDPAAEAYKELVTFAKFVVNRFFSV--AAQNNKAFVELLFWKNVGAVREMTEGYSKDGEGKKPAWSEEEEEELRKLYMEHRDSDV-P--DIVETLLPLLSNSSRTRRQVVTQLVRMGLVDNAKELKKQKKGTGIVLWTEDQEEELQMLFEEFKDSEDVLGNIMKKLTAK-------RSRARVVDKLLSMGLV 924          
BLAST of Timeless circadian clock vs. Ensembl Medaka
Match: timeless (timeless circadian regulator [Source:NCBI gene;Acc:101171325])

HSP 1 Score: 249.595 bits (636), Expect = 3.992e-67
Identity = 175/505 (34.65%), Postives = 281/505 (55.64%), Query Frame = 1
Query:   97 ACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASD-----QQLRRQRELELMAKSAE-NPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKIDLTRD--RKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKT-KESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQ 1584
            A  + LG  E   + K+ D + S++D++R+LR E +  ++R +LG  ++++N L+ L+  +  D  LFD  IRL++NLTQP+ +CF + +P D V    F++V   LQ  K  F       +LS  + +    +WE R E+++LL+ERIL+L+RNILH+  +  +    +   S HD ++  +  SG+ DL+ +L++A++E++++ H LEIISLMFR+Q+AE + +   S S E         + LR++   E  +++ +   R  RFGG F +Q +K    +  IYH  ++  K   T D  + +RR  K      E     +S   V   L+EFC  FL+  YN LM      L R+Q Q  DETYYLWAL FFM   R N    + VSET++I  FH++ +    Y +   T ++ A S  R++HL + AY+ELL     +D   +E  R  S  +KS +FY  E+ EI+  LL  +   KQ   +L+ L+E + L +++L+
Sbjct:   14 ATCSALGYLEGDNYHKETDCLESVKDLIRYLRHEDDSRDVRRQLGASQILQNDLLPLIVQFRQDKTLFDACIRLMVNLTQPAVLCFGK-VPDDPVFTHHFMEVTSHLQAYKEAFASERVFGILSETLYNFLQLDWEQRQEEDNLLIERILLLVRNILHVPADPCEEKKVDDDASIHDKVLWAIHMSGFDDLVKFLASAQSEQQWSMHVLEIISLMFRDQTAELLVSAGHSRSAEEKQRDLQELEALRQKENAEKRSRTLQRGTRHSRFGGCFVVQGLKAIGDKDVIYHRRLHKFK-SYTHDEGKAVRRVPKRNQRASECKEQRRSALNVRLFLREFCVDFLENCYNRLMYLVKENLIREQSQQHDETYYLWALSFFMAFNRGNNFRADLVSETMSIRAFHFIERNITNYYEMLLTDRKEATSWSRRMHLALKAYQELLLTVNEMDRSHDEGIRQSSNVLKSNIFYMMEFREIFLTLLRKYDETKQPGTYLKDLVETTHLFLRMLE 516          

HSP 2 Score: 99.7525 bits (247), Expect = 1.215e-20
Identity = 88/274 (32.12%), Postives = 141/274 (51.46%), Query Frame = 1
Query: 2170 SVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSN------SDDNNPK-EWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNKKRENNP--WTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLRSRGSVIKKILELGLV 2964
            S+QV E  F+F  FI+ F +P++V  + ++      N P TN+ ++R++H +A   K   +L+QL +F+ FNK L DP +   +        +           +N K  +E+LF KN+    E   GYS       S+ N  K  W++E EEEL +L+ E +  D+         +    S+ ++TRRQ++ +LV +GL+ +AKELK +K+      WT D++  L +L EE +D    +  IM  L A        RSR  V+ K+L +GLV
Sbjct:  672 SIQVSETEFNFKDFIKKFANPSIVRPYILMLRTYSKNTPHTNHCVVRMLHRLAVDLKMDALLFQLSVFHLFNKILSDPAAEAYKELVTFAKFVVNRFFSV--AAQNNKAFVELLFWKNVGAVREMTEGYSKDGCVRASERNGKKPAWSEEEEEELRKLYMEHRDSDV-------ETLLPLLSNSSRTRRQVVTQLVRMGLVDNAKELKKQKKGTGIVLWTEDQEEELQMLFEEFKDSEDVLGNIMKKLTAK-------RSRARVVDKLLSMGLV 929          
BLAST of Timeless circadian clock vs. Planmine SMEST
Match: SMESG000030307.1 (SMESG000030307.1)

HSP 1 Score: 1641.71 bits (4250), Expect = 0.000e+0
Identity = 899/903 (99.56%), Postives = 901/903 (99.78%), Query Frame = 1
Query:   70 MEKYLSDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQLRRQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGXXXXXXXXXXXXXXANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVXXXXXXXXXXXXXINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQXXXXXXXXXXXXDPLSNNPEXXXXXXXXXXXXXXXTENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDXXXXXXXXXXXXXQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNK 2778
            MEKYLSDLHACITCLGITENKQFLKDVDTI SLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDEHLLVERILILLRNILHINTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFR+QSAEFM TLKSSNSTESASDQQLRRQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGKKSRTKRRKSIKSKANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVEEDENELETDDEDINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQLKLFNGFNKFLLDPLSNNPEFKALKKFVIFIIKKFTE+VNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDELEEELVRLFEEVQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNK
Sbjct:    1 MEKYLSDLHACITCLGITENKQFLKDVDTIVSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDEHLLVERILILLRNILHINTNKSDGIIANGLDSKHDNLVMHMMESGWKDLLIYLSNAENEERFTFHTLEIISLMFRDQSAEFMGTLKSSNSTESASDQQLRRQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKIDLTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLMKNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVFHWVYQQAMIYIDNSKTKESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEEKYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLIIKILQDHNEFGMKFVGKKSRTKRRKSIKSKANQENQNIGTMEIPSEQDDGGNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEPVDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRVEEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVEEDENELETDDEDINSVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMHIIAEKTKQPYVLYQLKLFNGFNKFLLDPLSNNPEFKALKKFVIFIIKKFTEHVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDELEEELVRLFEEVQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKELKNK 903          
BLAST of Timeless circadian clock vs. Planmine SMEST
Match: SMESG000030309.1 (SMESG000030309.1)

HSP 1 Score: 445.662 bits (1145), Expect = 4.232e-174
Identity = 265/267 (99.25%), Postives = 267/267 (100.00%), Query Frame = 1
Query: 2875 MNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPNYDSGSXXXXXXXXXXXXXXXXXXSRFMNDLFHQSLSSIKRNPPALKVKRKIDWDTLKIIYAQLDTKVQEWFVETLEDNIDSRANGIVGPLAIVPLREHDSEILENKLLQRLLYICEFLYPDQSKGHLFWRIPEEMTAKELEYFKNCVTSLTESELEALAMENVNDQSLNDQNQDLFSSKYKDXXXXXXXXXXXXGSENISPXXXXXXXXXXXXXIPVQT 3675
            MNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPNYDSGSDDNEREPENNEDDEEE+ESRFMNDLFHQSLSSIKRNPPALKVKRKI+WDTLKIIYAQLDTKVQEWFVETLEDNIDSRANGIVGPLAIVPLREHDSEILENKLLQRLLYICEFLYPDQSKGHLFWRIPEEMTAKELEYFKNCVTSLTESELEALAMENVNDQSLNDQNQDLFSSKYKDINNENQIVNNVNGSENISPLSSDDDDDLDDMDIPVQT
Sbjct:    1 MNGLKATAVDPDKLRSRGSVIKKILELGLVENKDQLGIRDKNSKLIPNYDSGSDDNEREPENNEDDEEEDESRFMNDLFHQSLSSIKRNPPALKVKRKINWDTLKIIYAQLDTKVQEWFVETLEDNIDSRANGIVGPLAIVPLREHDSEILENKLLQRLLYICEFLYPDQSKGHLFWRIPEEMTAKELEYFKNCVTSLTESELEALAMENVNDQSLNDQNQDLFSSKYKDINNENQIVNNVNGSENISPLSSDDDDDLDDMDIPVQT 267          

HSP 2 Score: 187.578 bits (475), Expect = 4.232e-174
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 3
Query: 3723 KSKIRRLISDDEEDENTQRAIINSKSFETILSDTANTKNVFKNTKNSFDMFMSDEDEVDPMKNANLMDNSIEDRENIHKKTKRIFXXXXXXXXXXXNRKKRVKVLDDDS 4049
            KSKIRRLISDDEEDENTQRAIINSKSFETILSDTANTKNVFKNTKNSFDMFMSDEDEVDPMKNANLMDNSIEDRENIHKKTKRIFEDSDEEDEIISNRKKRVKVLDDDS
Sbjct:  268 KSKIRRLISDDEEDENTQRAIINSKSFETILSDTANTKNVFKNTKNSFDMFMSDEDEVDPMKNANLMDNSIEDRENIHKKTKRIFEDSDEEDEIISNRKKRVKVLDDDS 376          
BLAST of Timeless circadian clock vs. Planmine SMEST
Match: SMESG000030310.1 (SMESG000030310.1)

HSP 1 Score: 304.679 bits (779), Expect = 2.203e-95
Identity = 171/177 (96.61%), Postives = 174/177 (98.31%), Query Frame = 1
Query:   70 MEKYLSDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGII 600
            MEKYLSDLHACI CLGITEN+QFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLT+PSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFID DFLEVLSSKISDIYLKEWEDRSEDEHLLVERILIL+RNILHIN NKSDGII
Sbjct:    1 MEKYLSDLHACIICLGITENEQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTKPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDIDFLEVLSSKISDIYLKEWEDRSEDEHLLVERILILMRNILHINANKSDGII 177          
BLAST of Timeless circadian clock vs. Planmine SMEST
Match: SMESG000030310.1 (SMESG000030310.1)

HSP 1 Score: 303.908 bits (777), Expect = 3.311e-95
Identity = 170/179 (94.97%), Postives = 176/179 (98.32%), Query Frame = 1
Query:   70 MEKYLSDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSEDXXXXXXXXXXXXXXXXXXXTNKSDGIIAN 606
            MEKYLSDLHACI CLGITEN+QFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLT+PSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFID DFLEVLSSKISDIYLKEWEDRSEDEHLLVERILIL+RNILHIN NKSDGI+++
Sbjct:    1 MEKYLSDLHACIICLGITENEQFLKDVDTIFSLRDILRHLRRETEKCEIRLELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTKPSYICFKQELPKDLVGMEIFIKVDEMLQRCKSHFIDIDFLEVLSSKISDIYLKEWEDRSEDEHLLVERILILMRNILHINANKSDGIVSD 179          
The following BLAST results are available for this feature:
BLAST of Timeless circadian clock vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TIMELESS8.170e-9230.72timeless circadian regulator [Source:HGNC Symbol;A... [more]
TIMELESS1.146e-9130.82timeless circadian regulator [Source:HGNC Symbol;A... [more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tim-11.054e-4325.55pep chromosome:WBcel235:III:12240403:12250164:-1 g... [more]
tim-11.054e-4325.55pep chromosome:WBcel235:III:12240367:12250164:-1 g... [more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
timeout5.302e-6327.37gene:FBgn0038118 transcript:FBtr0082712[more]
tim1.803e-722.12gene:FBgn0014396 transcript:FBtr0333253[more]
tim1.805e-722.12gene:FBgn0014396 transcript:FBtr0333259[more]
tim1.815e-722.12gene:FBgn0014396 transcript:FBtr0333255[more]
tim2.055e-722.12gene:FBgn0014396 transcript:FBtr0077567[more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
timeless3.177e-9331.04timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE... [more]
timeless3.212e-9331.04timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE... [more]
timeless9.156e-9331.04timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE... [more]
timeless1.057e-9231.04timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsph16.117e-9632.39heat shock protein family H (Hsp110) member 1 [Sou... [more]
hsph17.832e-9531.35heat shock protein family H (Hsp110) member 1 [Sou... [more]
hsph14.719e-9131.43heat shock protein family H (Hsp110) member 1 [Sou... [more]
hsph12.578e-9031.85heat shock protein family H (Hsp110) member 1 [Sou... [more]
hsph13.149e-8531.98heat shock protein family H (Hsp110) member 1 [Sou... [more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Timeless2.997e-8830.66timeless circadian clock 1 [Source:MGI Symbol;Acc:... [more]
Timeless7.954e-8830.69timeless circadian clock 1 [Source:MGI Symbol;Acc:... [more]
Timeless7.954e-8830.69timeless circadian clock 1 [Source:MGI Symbol;Acc:... [more]
Timeless8.561e-8830.69timeless circadian clock 1 [Source:MGI Symbol;Acc:... [more]
Timeless1.660e-6635.19timeless circadian clock 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Timeless circadian clock vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UNS1|TIM_HUMAN3.924e-9130.72Protein timeless homolog OS=Homo sapiens OX=9606 G... [more]
sp|Q9R1X4|TIM_MOUSE5.564e-8730.69Protein timeless homolog OS=Mus musculus OX=10090 ... [more]
sp|Q9Z2Y1|TIM_RAT2.082e-8630.74Protein timeless homolog OS=Rattus norvegicus OX=1... [more]
sp|G5EDN3|TIM_CAEEL1.340e-4225.55Protein timeless homolog OS=Caenorhabditis elegans... [more]
sp|O17482|TIM_DROVI5.178e-822.42Protein timeless OS=Drosophila virilis OX=7244 GN=... [more]
back to top
BLAST of Timeless circadian clock vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KRK02.312e-12234.04Timeless, putative OS=Schistosoma mansoni OX=6183 ... [more]
A0A0X3PCW47.002e-11733.13Uncharacterized protein OS=Schistocephalus solidus... [more]
G4LZH93.614e-11333.42Timeless, putative OS=Schistosoma mansoni OX=6183 ... [more]
R7U1C14.511e-11033.27Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A0R3W7S84.464e-10830.82Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
timeless1.553e-9630.18timeless circadian regulator [Source:NCBI gene;Acc... [more]
timeless1.553e-9630.18timeless circadian regulator [Source:NCBI gene;Acc... [more]
timeless1.553e-9630.18timeless circadian regulator [Source:NCBI gene;Acc... [more]
timeless7.130e-9628.46timeless circadian regulator [Source:NCBI gene;Acc... [more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
timeless1.856e-7429.45timeless circadian clock [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Timeless circadian clock vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489373.811e-10130.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Timeless circadian clock vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
timeless8.783e-9331.33timeless circadian regulator [Source:NCBI gene;Acc... [more]
timeless3.992e-6734.65timeless circadian regulator [Source:NCBI gene;Acc... [more]
back to top
BLAST of Timeless circadian clock vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000030307.10.000e+099.56SMESG000030307.1[more]
SMESG000030309.14.232e-17499.25SMESG000030309.1[more]
SMESG000030310.12.203e-9596.61SMESG000030310.1[more]
SMESG000030310.13.311e-9594.97SMESG000030310.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017903 ID=SMED30017903|Name=Timeless circadian clock|organism=Schmidtea mediterranea sexual|type=transcript|length=4060bp
AAATTCTTTAATTAAATTAACTCTTCTAAATTTGAAACTTTTTTCTTATT
CCTTCATTAATAAGTATAAATGGAAAAATATTTGTCTGACCTTCATGCAT
GCATAACTTGTCTGGGTATTACAGAAAATAAACAATTTCTCAAAGATGTT
GATACTATATTTAGTCTTCGAGATATTTTAAGGCACTTACGAAGAGAAAC
TGAAAAATGCGAAATAAGACTAGAATTGGGAAAGTTTAAAGTCATTGAAA
ATTGCTTGATTTCTCTGTTGAAATTATACAATAATGATTCAGTGCTTTTT
GATCTAGTTATTCGACTTTTGATGAATCTGACCCAACCAAGTTATATATG
CTTTAAACAAGAATTGCCAAAAGACTTGGTCGGGATGGAAATTTTTATAA
AAGTTGATGAAATGTTACAAAGATGCAAATCTCATTTTATTGATAGAGAT
TTTCTCGAAGTTTTGTCGTCCAAAATTAGTGATATTTATCTTAAAGAATG
GGAAGACCGATCAGAAGACGAGCACTTGTTAGTTGAAAGAATACTCATTT
TATTGAGGAATATTTTGCATATTAACACAAACAAATCGGATGGGATTATC
GCTAATGGACTTGATAGTAAGCACGATAACTTGGTAATGCACATGATGGA
GAGTGGCTGGAAGGATTTATTGATCTATCTATCAAATGCTGAGAATGAGG
AACGATTTACATTCCATACACTCGAGATTATCTCCCTCATGTTCCGGGAG
CAATCGGCTGAGTTTATGGACACTCTGAAATCGAGCAATTCCACGGAATC
TGCAAGCGACCAGCAGTTGAGGAGGCAACGTGAGCTCGAGCTAATGGCAA
AATCGGCAGAAAATCCCCGAGTCAAGCGATTTGGCGGAACATTCGAGTTG
CAGGACATCAAAACCGAATCTGGGCGGCCAGCGATTTACCATCACGATAT
TAATTGGTCCAAAATTGATCTGACCCGAGATAGGAAGCTCAGGAGAAAAG
CCAAGAATCAAGTTCATAACAAGGAAGAGACTTATATTCACAAATCAACT
GATAAAGTTCTTAACGCATTGCAGGAATTTTGCCAAATATTTCTGCAAAT
CGGTTACAACTGCCTGATGAAAAATGCTTTATCGATGTTGCAAAGGCAAC
AAATGCAAGCTGATGATGAAACGTATTATTTGTGGGCGTTAAGATTCTTC
ATGGAGGTTTGTAGACGCAATAAATTGAGCCCGGAATCAGTTAGCGAAAC
CATTACTATCCCAGTGTTTCATTGGGTATATCAACAGGCAATGATTTACA
TTGACAACAGTAAAACCAAAGAGTCCGCCGTTTCCAGTTACCGCAAATTG
CATCTAGTAATGAGTGCCTATAAAGAACTACTAGAATTCTGCTTGATGCT
CGACAACCACCAGGAGGAAAAATACCGCACTTTATCAGCATCAATTAAAA
GCCGCGTGTTTTACTCATCAGAATATATAGAAATCTATCCGATGCTTCTT
TCGCATTTCAAACCAATCAAACAGAGTCGCGCATTTCTTCGCACATTGAT
TGAAGGCTCATTTCTCATCATCAAAATTCTCCAAGATCATAATGAGTTTG
GAATGAAATTCGTTGGGAAAAAGTCTCGAACTAAACGTCGTAAATCGATC
AAATCGAAAGCGAATCAAGAAAACCAGAATATTGGAACAATGGAAATTCC
ATCGGAACAGGATGATGGTGGGAATGTTTTGAGGGGGATTTGGGATGAAA
TGTTAGAAACACTAATGTCAGCAGTAAATGGCGAGGTTGAGTTGCCGCTG
AATCTTCCAGTTATTTATGATCCGTTGCTACCGGAATGTCGGGAATCTAT
TGAACCGGATTCTGAGCCGGTGGATTCACAACTGAAACGCGCTCTGGGAT
TGGTTCAGATTCGGCTGCGTCAAAGGAATTCCATTGAAGCTGTGGCGATA
TTTGAATTGTGCCAGAAACTGTGGCCGGAAGAAGATCGGATTATGGTTAC
TGATGACGATAATCGAGTGGAGGAAGAGATTAAAATACTCAAAGATATAA
TGTTTGCAAACAAGTTTTATAAAGAAGAAGATTTAATAAAACTGTCAAAG
GAAATTAGTGAAATTGGTGTTGTGGAAGAGGATGAAAACGAGCTAGAAAC
TGATGATGAAGACATCAATAGCGTACAAGTTCGAGAAGTTCCATTCGATT
TTTCGAGATTTATACGAAGTTTCTGTCATCCAAATGTTGTAAATACTTTC
GGAGTTCTATTCGAAGACATCATAACTAATCCACCGTCCACCAATAACCG
GCTGTTGAGAATAATGCACATCATTGCAGAAAAAACAAAACAGCCGTATG
TATTGTATCAATTGAAACTCTTTAATGGTTTCAACAAATTTCTTCTGGAT
CCACTTTCAAATAATCCGGAATTCAAAGCGTTGAAAAAATTTGTCATTTT
CATTATCAAAAAGTTCACAGAAAATGTTAATAAAAATCGGAAATTGTTGT
TAGAGGTTTTATTTTCGAAAAATATCCATGAAGCACATGAAACGGTTTAT
GGTTATTCCAATTCTGATGATAATAACCCGAAAGAATGGACAGATGAACT
TGAAGAAGAATTGGTTCGATTGTTTGAAGAAGTGCAACACGAAGACATTC
TACCAGGATTTGATAAGGCTTCTGTTATTGAAAGTCGATTCTCTGACAAA
AATAAAACCAGAAGACAAATCCTTAATAGATTGGTGACTTTAGGTTTGAT
ATCATCTGCGAAAGAGCTGAAAAATAAAAAACGAGAAAATAATCCTTGGA
CAGCCGATGAACAAGCACGTTTGATTATATTGGTAGAGGAATCTAGAGAC
CAACCAATTCCAATAAAGGAAATTATGAATGGATTGAAAGCAACTGCTGT
TGATCCCGATAAATTACGGTCCAGGGGATCTGTAATTAAGAAAATCCTTG
AGTTAGGTTTAGTAGAAAATAAAGATCAATTAGGAATTCGAGATAAAAAT
AGCAAGCTAATACCGAATTATGATTCTGGTAGTGATGACAATGAAAGAGA
ACCCGAAAATAACGAAGACGATGAGGAGGAGGAGGAGTCCAGATTCATGA
ATGACTTATTTCATCAAAGTTTGTCATCAATTAAAAGAAATCCACCCGCA
CTTAAAGTGAAAAGGAAAATTGATTGGGATACACTAAAGATAATTTATGC
ACAATTGGATACAAAAGTACAAGAATGGTTTGTGGAAACTTTGGAAGATA
ATATTGATTCTCGTGCTAATGGGATTGTGGGCCCATTGGCTATAGTTCCT
CTTCGGGAACATGATAGTGAAATTCTAGAAAACAAACTTTTACAAAGGTT
GCTGTACATTTGCGAGTTCCTTTATCCAGATCAAAGTAAAGGTCATCTAT
TCTGGAGAATTCCAGAGGAAATGACTGCAAAGGAATTAGAATATTTCAAG
AATTGTGTTACAAGTCTCACGGAGAGTGAATTAGAAGCGTTAGCCATGGA
AAATGTCAATGATCAGTCATTAAATGATCAAAATCAAGATTTATTCAGTT
CGAAATATAAAGATATTAATAATGAAAATCAAATTGTAAATAATGTCAAT
GGTTCCGAGAATATATCTCCATTGTCATCGGATGATGATGATGACCTTGA
TGATATGGACATTCCTGTTCAAACGTATGTTAATGAATTTTAAAGGCATT
TAACAATTACAGAAATGTTAGAAAATCAAAAATCCGAAGATTGATATCAG
ATGATGAAGAGGATGAAAATACTCAGCGAGCAATTATTAATAGTAAATCT
TTCGAAACAATTCTTTCAGACACGGCTAATACGAAAAATGTTTTCAAGAA
TACGAAGAACTCATTTGATATGTTCATGTCAGACGAGGATGAAGTAGATC
CGATGAAGAATGCAAATTTGATGGACAACAGCATCGAAGATAGAGAAAAT
ATTCACAAAAAAACTAAAAGAATTTTTGAAGATTCTGACGAGGAGGATGA
AATTATTTCTAACAGAAAAAAACGAGTGAAGGTGCTAGATGACGACAGCA
GATCGGAAGA
back to top

protein sequence of SMED30017903-orf-1

>SMED30017903-orf-1 ID=SMED30017903-orf-1|Name=SMED30017903-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1208bp
MEKYLSDLHACITCLGITENKQFLKDVDTIFSLRDILRHLRRETEKCEIR
LELGKFKVIENCLISLLKLYNNDSVLFDLVIRLLMNLTQPSYICFKQELP
KDLVGMEIFIKVDEMLQRCKSHFIDRDFLEVLSSKISDIYLKEWEDRSED
EHLLVERILILLRNILHINTNKSDGIIANGLDSKHDNLVMHMMESGWKDL
LIYLSNAENEERFTFHTLEIISLMFREQSAEFMDTLKSSNSTESASDQQL
RRQRELELMAKSAENPRVKRFGGTFELQDIKTESGRPAIYHHDINWSKID
LTRDRKLRRKAKNQVHNKEETYIHKSTDKVLNALQEFCQIFLQIGYNCLM
KNALSMLQRQQMQADDETYYLWALRFFMEVCRRNKLSPESVSETITIPVF
HWVYQQAMIYIDNSKTKESAVSSYRKLHLVMSAYKELLEFCLMLDNHQEE
KYRTLSASIKSRVFYSSEYIEIYPMLLSHFKPIKQSRAFLRTLIEGSFLI
IKILQDHNEFGMKFVGKKSRTKRRKSIKSKANQENQNIGTMEIPSEQDDG
GNVLRGIWDEMLETLMSAVNGEVELPLNLPVIYDPLLPECRESIEPDSEP
VDSQLKRALGLVQIRLRQRNSIEAVAIFELCQKLWPEEDRIMVTDDDNRV
EEEIKILKDIMFANKFYKEEDLIKLSKEISEIGVVEEDENELETDDEDIN
SVQVREVPFDFSRFIRSFCHPNVVNTFGVLFEDIITNPPSTNNRLLRIMH
IIAEKTKQPYVLYQLKLFNGFNKFLLDPLSNNPEFKALKKFVIFIIKKFT
ENVNKNRKLLLEVLFSKNIHEAHETVYGYSNSDDNNPKEWTDELEEELVR
LFEEVQHEDILPGFDKASVIESRFSDKNKTRRQILNRLVTLGLISSAKEL
KNKKRENNPWTADEQARLIILVEESRDQPIPIKEIMNGLKATAVDPDKLR
SRGSVIKKILELGLVENKDQLGIRDKNSKLIPNYDSGSDDNEREPENNED
DEEEEESRFMNDLFHQSLSSIKRNPPALKVKRKIDWDTLKIIYAQLDTKV
QEWFVETLEDNIDSRANGIVGPLAIVPLREHDSEILENKLLQRLLYICEF
LYPDQSKGHLFWRIPEEMTAKELEYFKNCVTSLTESELEALAMENVNDQS
LNDQNQDLFSSKYKDINNENQIVNNVNGSENISPLSSDDDDDLDDMDIPV
QTYVNEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006906Timeless
IPR007725TIMELESS_C
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0002009morphogenesis of an epithelium
GO:0006260DNA replication
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0007275multicellular organism development
GO:0007623circadian rhythm
GO:0009582detection of abiotic stimulus
GO:0009628response to abiotic stimulus
GO:0030324lung development
GO:0042752regulation of circadian rhythm
GO:0044770cell cycle phase transition
GO:0045892negative regulation of transcription, DNA-templated
GO:0048511rhythmic process
GO:0048754branching morphogenesis of an epithelial tube
GO:0051301cell division
GO:0072711cellular response to hydroxyurea
GO:0072719cellular response to cisplatin
GO:1904976cellular response to bleomycin
GO:2000781positive regulation of double-strand break repair
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0005634nucleus
GO:0005654nucleoplasm
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042803protein homodimerization activity
GO:0046982protein heterodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007725Timeless, C-terminalPFAMPF05029TIMELESS_Ccoord: 748..1152
e-value: 9.5E-33
score: 114.2
IPR006906Timeless proteinPFAMPF04821TIMELESScoord: 25..276
e-value: 3.5E-43
score: 147.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 992..1007
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 976..1007
NoneNo IPR availablePANTHERPTHR22940TIMEOUT/TIMELESS-2coord: 10..1165