SMED30017899

Overview
NameSMED30017899
Smed IDSMED30017899
Length (bp)386
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30017899 (SMED30017899) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30017899 (SMED30017899) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30017899 (SMED30017899) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30017899 (SMED30017899) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30017899 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.019091:4809..5194 +1759
Homology
BLAST of SMED30017899 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 47.3654 bits (111), Expect = 6.192e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  111 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 175          
BLAST of SMED30017899 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 47.3654 bits (111), Expect = 6.714e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  109 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 173          

HSP 2 Score: 46.595 bits (109), Expect = 1.129e-6
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 2
Query:  104 CSTCQRIGHRSENC-FRNYTCQKCGRRGHTEKICRQPN---NKACYNCGQQGHFARQCN 268
            C  C   GH +++C  +   C  CGR GH  K C++P     + CYNCG+ GH AR C+
Sbjct:   54 CYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCD 112          
BLAST of SMED30017899 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 47.3654 bits (111), Expect = 6.831e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  104 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 168          
BLAST of SMED30017899 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 47.3654 bits (111), Expect = 7.286e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  110 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 174          

HSP 2 Score: 45.4394 bits (106), Expect = 3.342e-6
Identity = 24/60 (40.00%), Postives = 33/60 (55.00%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCF--RNYTCQKCGRRGHTEKICRQPN---NKACYNCGQQGHFARQCN 268
            C  C   GH +++C    +  C  CGR GH  K C++P     + CYNCG+ GH AR C+
Sbjct:   54 CYRCGESGHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCD 113          
BLAST of SMED30017899 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 46.9802 bits (110), Expect = 7.866e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  102 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 166          

HSP 2 Score: 46.595 bits (109), Expect = 1.258e-6
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 2
Query:  104 CSTCQRIGHRSENC-FRNYTCQKCGRRGHTEKICRQPN---NKACYNCGQQGHFARQCN 268
            C  C   GH +++C  +   C  CGR GH  K C++P     + CYNCG+ GH AR C+
Sbjct:   47 CYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCD 105          
BLAST of SMED30017899 vs. Ensembl Celegans
Match: glh-4 (ATP-dependent RNA helicase glh-4 [Source:UniProtKB/Swiss-Prot;Acc:O76743])

HSP 1 Score: 53.1434 bits (126), Expect = 5.426e-9
Identity = 26/71 (36.62%), Postives = 37/71 (52.11%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCFRNYT----CQKCGRRGHTEKICRQPN--NKACYNCGQQGHFARQCN---IRREPNQ 289
            C  C+++GH + +C +       C+ CG  GH    C QP      C NCGQ+GHFA+ C    +R EP +
Sbjct:  595 CRNCEQLGHFASDCDQPRVPRGPCRNCGIEGHFAVDCDQPKVPRGPCRNCGQEGHFAKDCQNERVRMEPTE 665          

HSP 2 Score: 47.7506 bits (112), Expect = 4.189e-7
Identity = 29/89 (32.58%), Postives = 41/89 (46.07%), Query Frame = 2
Query:   44 GNNQVSYNNNFRSNPNANEK---CSTCQRIGHRSENCFR----NYTCQKCGRRGHTEKICRQPN--NKACYNCGQQGHFARQCNIRREP 283
            GN     ++N R N +  E+   C  C   GH S+ C +     + C+ C + GH    C QP      C NCG +GHFA  C+  + P
Sbjct:  549 GNTFGEPSDNQRGNWDGGERPRGCHNCGEEGHISKECDKPKVPRFPCRNCEQLGHFASDCDQPRVPRGPCRNCGIEGHFAVDCDQPKVP 637          
BLAST of SMED30017899 vs. Ensembl Celegans
Match: glh-4 (ATP-dependent RNA helicase glh-4 [Source:UniProtKB/Swiss-Prot;Acc:O76743])

HSP 1 Score: 53.1434 bits (126), Expect = 5.426e-9
Identity = 26/71 (36.62%), Postives = 37/71 (52.11%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCFRNYT----CQKCGRRGHTEKICRQPN--NKACYNCGQQGHFARQCN---IRREPNQ 289
            C  C+++GH + +C +       C+ CG  GH    C QP      C NCGQ+GHFA+ C    +R EP +
Sbjct:  595 CRNCEQLGHFASDCDQPRVPRGPCRNCGIEGHFAVDCDQPKVPRGPCRNCGQEGHFAKDCQNERVRMEPTE 665          

HSP 2 Score: 47.7506 bits (112), Expect = 4.189e-7
Identity = 29/89 (32.58%), Postives = 41/89 (46.07%), Query Frame = 2
Query:   44 GNNQVSYNNNFRSNPNANEK---CSTCQRIGHRSENCFR----NYTCQKCGRRGHTEKICRQPN--NKACYNCGQQGHFARQCNIRREP 283
            GN     ++N R N +  E+   C  C   GH S+ C +     + C+ C + GH    C QP      C NCG +GHFA  C+  + P
Sbjct:  549 GNTFGEPSDNQRGNWDGGERPRGCHNCGEEGHISKECDKPKVPRFPCRNCEQLGHFASDCDQPRVPRGPCRNCGIEGHFAVDCDQPKVP 637          
BLAST of SMED30017899 vs. Ensembl Fly
Match: CNBP (gene:FBgn0034802 transcript:FBtr0303464)

HSP 1 Score: 43.1282 bits (100), Expect = 9.097e-6
Identity = 26/71 (36.62%), Postives = 38/71 (53.52%), Query Frame = 2
Query:   77 RSNPNANEKCSTCQRIGHRSENCFR--NYTCQKCGRRGHTEKIC------RQPNNKACYNCGQQGHFARQC 265
            R+ P   E+C  C  IGH S++C +  N TC +C + GH  + C      R P N +CY C + GH ++ C
Sbjct:   68 RACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKNC 138          
BLAST of SMED30017899 vs. Ensembl Fly
Match: CNBP (gene:FBgn0034802 transcript:FBtr0071994)

HSP 1 Score: 43.1282 bits (100), Expect = 9.097e-6
Identity = 26/71 (36.62%), Postives = 38/71 (53.52%), Query Frame = 2
Query:   77 RSNPNANEKCSTCQRIGHRSENCFR--NYTCQKCGRRGHTEKIC------RQPNNKACYNCGQQGHFARQC 265
            R+ P   E+C  C  IGH S++C +  N TC +C + GH  + C      R P N +CY C + GH ++ C
Sbjct:   68 RACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKNC 138          
BLAST of SMED30017899 vs. Ensembl Zebrafish
Match: cnbpb (CCHC-type zinc finger, nucleic acid binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-7782])

HSP 1 Score: 48.1358 bits (113), Expect = 1.994e-7
Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 2
Query:   53 QVSYN-----NNFRSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            QV YN     +  R   +ANE KC +C   GH  + C     C +CG  GH    C + +   CYNCG+ GH A++C I
Sbjct:   80 QVCYNCGKAGHMARDCDHANEQKCYSCGGFGHIQKGC-EKVKCYRCGEIGHVAVQCSKASEVNCYNCGKSGHVAKECTI 157          

HSP 2 Score: 44.669 bits (104), Expect = 3.940e-6
Identity = 24/59 (40.68%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCFRNY-TCQKCGRRGHTEKICRQPNNK---ACYNCGQQGHFARQCN 268
            C  C   GH + +C R    C  CGR GH  + C++P  +    CYNCG+ GH AR C+
Sbjct:   38 CYRCGEPGHVARDCERTEDACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHMARDCD 96          
BLAST of SMED30017899 vs. Ensembl Zebrafish
Match: cnbpb (CCHC-type zinc finger, nucleic acid binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-7782])

HSP 1 Score: 48.1358 bits (113), Expect = 1.994e-7
Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 2
Query:   53 QVSYN-----NNFRSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            QV YN     +  R   +ANE KC +C   GH  + C     C +CG  GH    C + +   CYNCG+ GH A++C I
Sbjct:   80 QVCYNCGKAGHMARDCDHANEQKCYSCGGFGHIQKGC-EKVKCYRCGEIGHVAVQCSKASEVNCYNCGKSGHVAKECTI 157          

HSP 2 Score: 44.669 bits (104), Expect = 3.940e-6
Identity = 24/59 (40.68%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCFRNY-TCQKCGRRGHTEKICRQPNNK---ACYNCGQQGHFARQCN 268
            C  C   GH + +C R    C  CGR GH  + C++P  +    CYNCG+ GH AR C+
Sbjct:   38 CYRCGEPGHVARDCERTEDACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHMARDCD 96          
BLAST of SMED30017899 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 46.595 bits (109), Expect = 6.667e-7
Identity = 27/66 (40.91%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +ANE KC +C   GH  + C +   C +CG  GH    C +     CYNCG+ GH AR C+I
Sbjct:   95 RDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVQCSKATEVNCYNCGKTGHLARDCSI 159          
BLAST of SMED30017899 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 46.595 bits (109), Expect = 6.667e-7
Identity = 27/66 (40.91%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +ANE KC +C   GH  + C +   C +CG  GH    C +     CYNCG+ GH AR C+I
Sbjct:   95 RDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVQCSKATEVNCYNCGKTGHLARDCSI 159          
BLAST of SMED30017899 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 46.595 bits (109), Expect = 6.667e-7
Identity = 27/66 (40.91%), Postives = 35/66 (53.03%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +ANE KC +C   GH  + C +   C +CG  GH    C +     CYNCG+ GH AR C+I
Sbjct:   95 RDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVQCSKATEVNCYNCGKTGHLARDCSI 159          
BLAST of SMED30017899 vs. Ensembl Mouse
Match: Zcchc13 (zinc finger, CCHC domain containing 13 [Source:MGI Symbol;Acc:MGI:1922314])

HSP 1 Score: 51.2174 bits (121), Expect = 1.673e-8
Identity = 33/90 (36.67%), Postives = 43/90 (47.78%), Query Frame = 2
Query:   80 SNPNANEKCSTCQRIGHRSENC-FRNYTCQKCGRRGHTEKICRQPN---NKACYNCGQQGHFARQCNIRREPNQSRLNNSMGNPQINVMQ 337
            S  N ++ C  C   GH +++C     TC  CGRRGH  K C Q      + CY C Q GH AR CN R+E  +       G+ Q +  Q
Sbjct:   39 STANQSDVCYRCGETGHYAKDCDLLQDTCYNCGRRGHIAKDCTQAKREREQCCYICSQPGHLARDCN-RQEEQKCYTCGEFGHIQKDCTQ 127          

HSP 2 Score: 46.2098 bits (108), Expect = 1.126e-6
Identity = 24/63 (38.10%), Postives = 34/63 (53.97%), Query Frame = 2
Query:   83 NPNANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            N    +KC TC   GH  ++C +   C +CG  GH    C + +  +CY CG+ GH AR+C I
Sbjct:  105 NRQEEQKCYTCGEFGHIQKDCTQ-IKCYRCGENGHMAVNCSKTSEVSCYRCGESGHLARECPI 166          
BLAST of SMED30017899 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 47.3654 bits (111), Expect = 4.609e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  109 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 173          

HSP 2 Score: 46.595 bits (109), Expect = 7.748e-7
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 2
Query:  104 CSTCQRIGHRSENC-FRNYTCQKCGRRGHTEKICRQPN---NKACYNCGQQGHFARQCN 268
            C  C   GH +++C  +   C  CGR GH  K C++P     + CYNCG+ GH AR C+
Sbjct:   54 CYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCD 112          
BLAST of SMED30017899 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 47.3654 bits (111), Expect = 4.609e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  109 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 173          

HSP 2 Score: 46.595 bits (109), Expect = 7.748e-7
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 2
Query:  104 CSTCQRIGHRSENC-FRNYTCQKCGRRGHTEKICRQPN---NKACYNCGQQGHFARQCN 268
            C  C   GH +++C  +   C  CGR GH  K C++P     + CYNCG+ GH AR C+
Sbjct:   54 CYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCD 112          
BLAST of SMED30017899 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 47.3654 bits (111), Expect = 5.002e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  110 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 174          

HSP 2 Score: 45.4394 bits (106), Expect = 2.295e-6
Identity = 24/60 (40.00%), Postives = 33/60 (55.00%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCF--RNYTCQKCGRRGHTEKICRQPN---NKACYNCGQQGHFARQCN 268
            C  C   GH +++C    +  C  CGR GH  K C++P     + CYNCG+ GH AR C+
Sbjct:   54 CYRCGESGHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCD 113          
BLAST of SMED30017899 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 46.9802 bits (110), Expect = 5.400e-7
Identity = 25/66 (37.88%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +A+E KC +C   GH  ++C +   C +CG  GH    C + +   CY CG+ GH AR+C I
Sbjct:  102 RDCDHADEQKCYSCGEFGHIQKDCTK-VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTI 166          

HSP 2 Score: 46.595 bits (109), Expect = 8.639e-7
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 2
Query:  104 CSTCQRIGHRSENC-FRNYTCQKCGRRGHTEKICRQPN---NKACYNCGQQGHFARQCN 268
            C  C   GH +++C  +   C  CGR GH  K C++P     + CYNCG+ GH AR C+
Sbjct:   47 CYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCD 105          
BLAST of SMED30017899 vs. UniProt/SwissProt
Match: sp|O65639|CSP1_ARATH (Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.126e-8
Identity = 27/77 (35.06%), Postives = 40/77 (51.95%), Query Frame = 2
Query:   68 NNFRSNPNANEKCSTCQRIGHRSENCFR----NYTCQKCGRRGHTEKICRQ------PNNKACYNCGQQGHFARQCN 268
             N RS    +  C +C  +GH + +C      +  C +CG  GH  + C Q       N+ ACY CG++GHFAR+C+
Sbjct:  220 GNVRSGGGGSGTCYSCGGVGHIARDCATKRQPSRGCYQCGGSGHLARDCDQRGSGGGGNDNACYKCGKEGHFARECS 296          

HSP 2 Score: 47.3654 bits (111), Expect = 6.740e-6
Identity = 27/78 (34.62%), Postives = 36/78 (46.15%), Query Frame = 2
Query:   89 NANEKCSTCQRIGHRSENCFRNY-------------TCQKCGRRGHTEKIC---RQPNNKACYNCGQQGHFARQCNIR 274
              N+ C TC  +GH + +C +               TC  CG  GH  + C   RQP+ + CY CG  GH AR C+ R
Sbjct:  195 GGNDGCYTCGDVGHFARDCTQKVAAGNVRSGGGGSGTCYSCGGVGHIARDCATKRQPS-RGCYQCGGSGHLARDCDQR 271          
BLAST of SMED30017899 vs. UniProt/SwissProt
Match: sp|O76743|GLH4_CAEEL (ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 6.901e-8
Identity = 26/71 (36.62%), Postives = 37/71 (52.11%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCFRNYT----CQKCGRRGHTEKICRQPN--NKACYNCGQQGHFARQCN---IRREPNQ 289
            C  C+++GH + +C +       C+ CG  GH    C QP      C NCGQ+GHFA+ C    +R EP +
Sbjct:  595 CRNCEQLGHFASDCDQPRVPRGPCRNCGIEGHFAVDCDQPKVPRGPCRNCGQEGHFAKDCQNERVRMEPTE 665          

HSP 2 Score: 47.7506 bits (112), Expect = 5.328e-6
Identity = 29/89 (32.58%), Postives = 41/89 (46.07%), Query Frame = 2
Query:   44 GNNQVSYNNNFRSNPNANEK---CSTCQRIGHRSENCFR----NYTCQKCGRRGHTEKICRQPN--NKACYNCGQQGHFARQCNIRREP 283
            GN     ++N R N +  E+   C  C   GH S+ C +     + C+ C + GH    C QP      C NCG +GHFA  C+  + P
Sbjct:  549 GNTFGEPSDNQRGNWDGGERPRGCHNCGEEGHISKECDKPKVPRFPCRNCEQLGHFASDCDQPRVPRGPCRNCGIEGHFAVDCDQPKVP 637          
BLAST of SMED30017899 vs. UniProt/SwissProt
Match: sp|Q89928|POL_HV2EH (Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate EHO) OX=388821 GN=gag-pol PE=3 SV=3)

HSP 1 Score: 53.1434 bits (126), Expect = 7.778e-8
Identity = 19/43 (44.19%), Postives = 26/43 (60.47%), Query Frame = 2
Query:  149 RNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRR 277
            R  TC  CG+ GHT + C+ P  + C+ CGQQGH   +C  R+
Sbjct:  385 RTVTCWNCGKAGHTARQCKAPRRQGCWKCGQQGHIMSKCPERQ 427          
BLAST of SMED30017899 vs. UniProt/SwissProt
Match: sp|Q9Q720|POL_HV1V9 (Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype H (isolate VI991) OX=388888 GN=gag-pol PE=3 SV=3)

HSP 1 Score: 51.9878 bits (123), Expect = 1.700e-7
Identity = 18/43 (41.86%), Postives = 24/43 (55.81%), Query Frame = 2
Query:  149 RNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRR 277
            R   C  CG+ GH  + CR P  K C+ CGQ+GH  + C  R+
Sbjct:  391 RTVKCSNCGKEGHIARNCRAPRKKGCWKCGQEGHQMKDCTGRQ 433          
BLAST of SMED30017899 vs. UniProt/SwissProt
Match: sp|Q76634|POL_HV2UC (Gag-Pol polyprotein OS=Human immunodeficiency virus type 2 subtype B (isolate UC1) OX=388822 GN=gag-pol PE=3 SV=3)

HSP 1 Score: 51.9878 bits (123), Expect = 1.786e-7
Identity = 19/40 (47.50%), Postives = 25/40 (62.50%), Query Frame = 2
Query:  158 TCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRR 277
            TC  CG+ GHT K CR P  + C+ CG+QGH   +C  R+
Sbjct:  389 TCWNCGKVGHTAKQCRAPRRQGCWKCGKQGHIMSKCPERQ 428          
BLAST of SMED30017899 vs. TrEMBL
Match: A0A261Y734 (Uncharacterized protein OS=Bifiguratus adelaidae OX=1938954 GN=BZG36_00744 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.445e-10
Identity = 28/55 (50.91%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCN 268
            C TC + GHR+ NC     C  CG+ GH    C QP  KACY CGQ GH +R+CN
Sbjct:   69 CYTCGQTGHRAANCPNGQKCYNCGQTGHISSQCSQPQTKACYQCGQPGHISRECN 123          
BLAST of SMED30017899 vs. TrEMBL
Match: A0A1R0H6H2 (DNA-binding protein HEXBP OS=Smittium mucronatum OX=133383 GN=AYI68_g1092 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 2.792e-9
Identity = 29/68 (42.65%), Postives = 40/68 (58.82%), Query Frame = 2
Query:   62 YNNNFRSNPNANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQC 265
            YN N R   N+ E C +C  +GHRS +C     C  CG  GH    C++ +NK+CYNCG+ GH ++ C
Sbjct:  146 YNRNDRGGNNSRESCFSCGEVGHRSRDCPNGTKCYNCGEFGHMSSDCKKASNKSCYNCGEAGHTSKAC 213          
BLAST of SMED30017899 vs. TrEMBL
Match: A0A396HR19 (Putative nucleotidyltransferase, Ribonuclease H OS=Medicago truncatula OX=3880 GN=MtrunA17_Chr5g0422121 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 8.089e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 2
Query:   80 SNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQ-PNNKACYNCGQQGHFARQC 265
            S P+  E KC  C  +GH + +C  ++TC KCG+ GH    CR       CYNCG++GH + +C
Sbjct:  268 SRPSLAEVKCFKCGAMGHYASDCKNDFTCHKCGKAGHKAVDCRGVARETTCYNCGEKGHISTKC 331          
BLAST of SMED30017899 vs. TrEMBL
Match: A0A146I6E9 (Uncharacterized protein OS=Mycena chlorophos OX=658473 GN=MCHLO_12297 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.445e-8
Identity = 23/58 (39.66%), Postives = 33/58 (56.90%), Query Frame = 2
Query:   92 ANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQC 265
            +++ C TC  +GH S +C +   C  CG  GH  + C Q   +ACY CG +GH +R C
Sbjct: 1347 SSKTCYTCGGVGHLSRDCVQGSKCYNCGEIGHISRDCPQAQRRACYTCGSEGHISRDC 1404          
BLAST of SMED30017899 vs. TrEMBL
Match: A0A146I6C1 (Uncharacterized protein OS=Mycena chlorophos OX=658473 GN=MCHLO_12297 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.446e-8
Identity = 23/58 (39.66%), Postives = 33/58 (56.90%), Query Frame = 2
Query:   92 ANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQC 265
            +++ C TC  +GH S +C +   C  CG  GH  + C Q   +ACY CG +GH +R C
Sbjct: 1360 SSKTCYTCGGVGHLSRDCVQGSKCYNCGEIGHISRDCPQAQRRACYTCGSEGHISRDC 1417          
BLAST of SMED30017899 vs. Ensembl Cavefish
Match: ENSAMXT00000005562.2 (cellular nucleic acid-binding protein [Source:NCBI gene;Acc:103027392])

HSP 1 Score: 48.521 bits (114), Expect = 1.119e-7
Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 2
Query:   53 QVSYN-----NNFRSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            QV YN     +  R   +ANE KC +C   GH  + C     C +CG  GH    C + +   CYNCG+ GH A++C I
Sbjct:   80 QVCYNCGKAGHVARDCDHANEQKCYSCGGFGHIQKGC-EKVKCYRCGEIGHVAVQCSKASEVNCYNCGKSGHLAKECTI 157          

HSP 2 Score: 44.669 bits (104), Expect = 3.339e-6
Identity = 24/59 (40.68%), Postives = 32/59 (54.24%), Query Frame = 2
Query:  104 CSTCQRIGHRSENCFRNY-TCQKCGRRGHTEKICRQPNNK---ACYNCGQQGHFARQCN 268
            C  C   GH + +C R    C  CGR GH  + C++P  +    CYNCG+ GH AR C+
Sbjct:   38 CYRCGEPGHVARDCERTEDACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHVARDCD 96          
BLAST of SMED30017899 vs. Ensembl Cavefish
Match: cnbpa (cellular nucleic acid-binding protein-like [Source:NCBI gene;Acc:103024401])

HSP 1 Score: 47.7506 bits (112), Expect = 2.523e-7
Identity = 27/66 (40.91%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +ANE KC +C   GH  + C +   C +CG  GH    C + +   CYNCG+ GH AR+C I
Sbjct:  104 RDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVQCSKASEVNCYNCGKTGHLARECTI 168          
BLAST of SMED30017899 vs. Ensembl Cavefish
Match: ENSAMXT00000033510.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000951.1:16495:20219:1 gene:ENSAMXG00000033087.1 transcript:ENSAMXT00000033510.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 3.304e-6
Identity = 28/97 (28.87%), Postives = 39/97 (40.21%), Query Frame = 2
Query:   44 GNNQVSYNNNFRSNPNANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRREPNQSRLNNS-MGNPQINV 331
            G+  +  +  F   P     C  C   GH  E C     C+ CG  GH    CR P  K+C  CG + H  R C  +  P  S +    +G P  ++
Sbjct:  157 GSFAIGPHQGFLHYPGQPLYCRRCGGPGHTKEAC-TGLRCRFCGEEGHVAANCRAP--KSCSLCGSRDHLFRDCPEKSAPAASVVTGGPVGRPSPSL 250          
BLAST of SMED30017899 vs. Ensembl Yeast
Match: GIS2 (Translational activator for mRNAs with internal ribosome entry sites; associates with polysomes and binds to a specific subset of mRNAs; localizes to RNA processing bodies (P bodies) and to stress granules; may have a role in translation regulation under stress conditions; ortholog of human ZNF9/CNBP, a gene involved in myotonic dystrophy type 2 [Source:SGD;Acc:S000005199])

HSP 1 Score: 48.521 bits (114), Expect = 1.260e-8
Identity = 23/65 (35.38%), Postives = 34/65 (52.31%), Query Frame = 2
Query:   92 ANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNN---KACYNCGQQGHFARQCNIRR 277
            + + C  C +IGH +E+C     C  C + GH +  C  P     K CYNCG+ GH   +C ++R
Sbjct:    2 SQKACYVCGKIGHLAEDCDSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTVQR 66          
BLAST of SMED30017899 vs. Ensembl Medaka
Match: ENSORLT00000043369.1 (pep primary_assembly:ASM223467v1:17:15543647:15547570:1 gene:ENSORLG00000023375.1 transcript:ENSORLT00000043369.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 6.691e-8
Identity = 21/57 (36.84%), Postives = 29/57 (50.88%), Query Frame = 2
Query:  128 HRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRREPNQSRL 298
             R E       C +CGR GH  + C    NK C NCG++GHFA+ C  +     +R+
Sbjct:  206 QRQEGGEHRIKCFRCGRSGHLSRECTITKNKKCNNCGKEGHFAKMCKTKMTHKVNRV 262          
BLAST of SMED30017899 vs. Ensembl Medaka
Match: cnbpa (CCHC-type zinc finger nucleic acid binding protein [Source:NCBI gene;Acc:101173222])

HSP 1 Score: 46.9802 bits (110), Expect = 2.973e-7
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +ANE KC +C   GH  + C +   C +CG  GH    C + +   CYNCG+ GH A++C I
Sbjct:   76 RDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVHCSKASETNCYNCGKAGHLAKECTI 140          
BLAST of SMED30017899 vs. Ensembl Medaka
Match: cnbpa (CCHC-type zinc finger nucleic acid binding protein [Source:NCBI gene;Acc:101173222])

HSP 1 Score: 47.3654 bits (111), Expect = 3.415e-7
Identity = 26/66 (39.39%), Postives = 36/66 (54.55%), Query Frame = 2
Query:   77 RSNPNANE-KCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNI 271
            R   +ANE KC +C   GH  + C +   C +CG  GH    C + +   CYNCG+ GH A++C I
Sbjct:   98 RDCDHANEQKCYSCGGFGHIQKLCDK-VKCYRCGEIGHVAVHCSKASETNCYNCGKAGHLAKECTI 162          
BLAST of SMED30017899 vs. Planmine SMEST
Match: SMESG000074160.1 (SMESG000074160.1)

HSP 1 Score: 242.662 bits (618), Expect = 2.756e-75
Identity = 121/128 (94.53%), Postives = 124/128 (96.88%), Query Frame = 2
Query:    2 QMFKPPATRNPEDRGNNQVSYNNNFRSNPNANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRREPNQSRLNNSMGNPQINVMQEIDMLRETLQRMPMEL 385
            QMFKPP TRNPED+GNNQVSYNNNFR+NPNANEKCSTCQRIGHRSENCFRNY CQ CG+RGHTEKICRQPNNKACYNCGQQGH ARQCNIRREPNQSRLNNSMGNPQINVMQEIDMLRETLQRMPMEL
Sbjct:  396 QMFKPPVTRNPEDKGNNQVSYNNNFRNNPNANEKCSTCQRIGHRSENCFRNYNCQICGKRGHTEKICRQPNNKACYNCGQQGHLARQCNIRREPNQSRLNNSMGNPQINVMQEIDMLRETLQRMPMEL 523          
BLAST of SMED30017899 vs. Planmine SMEST
Match: SMESG000019863.1 (SMESG000019863.1)

HSP 1 Score: 232.261 bits (591), Expect = 1.348e-71
Identity = 109/129 (84.50%), Postives = 118/129 (91.47%), Query Frame = 2
Query:    2 QMFKPPATRNPEDRGNNQVSYNNNFRSNPNANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRREPNQSRLNNS-MGNPQINVMQEIDMLRETLQRMPMEL 385
            QMFKPP TRNPED+GNNQVSYNNNFR+ PNANE+CSTCQ++GHRSENCFRNY CQKCGRRGHTE+ICRQ +NKACYNCGQQGH AR+CNIR E NQ R NN+ M NPQINVMQEIDMLRETLQRMPMEL
Sbjct:  234 QMFKPPTTRNPEDKGNNQVSYNNNFRNKPNANEQCSTCQKMGHRSENCFRNYNCQKCGRRGHTERICRQLDNKACYNCGQQGHIARRCNIRGEANQPRPNNNPMRNPQINVMQEIDMLRETLQRMPMEL 362          
BLAST of SMED30017899 vs. Planmine SMEST
Match: SMESG000019863.1 (SMESG000019863.1)

HSP 1 Score: 232.261 bits (591), Expect = 1.442e-71
Identity = 109/129 (84.50%), Postives = 118/129 (91.47%), Query Frame = 2
Query:    2 QMFKPPATRNPEDRGNNQVSYNNNFRSNPNANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRREPNQSRLNNS-MGNPQINVMQEIDMLRETLQRMPMEL 385
            QMFKPP TRNPED+GNNQVSYNNNFR+ PNANE+CSTCQ++GHRSENCFRNY CQKCGRRGHTE+ICRQ +NKACYNCGQQGH AR+CNIR E NQ R NN+ M NPQINVMQEIDMLRETLQRMPMEL
Sbjct:  234 QMFKPPTTRNPEDKGNNQVSYNNNFRNKPNANEQCSTCQKMGHRSENCFRNYNCQKCGRRGHTERICRQLDNKACYNCGQQGHIARRCNIRGEANQPRPNNNPMRNPQINVMQEIDMLRETLQRMPMEL 362          
BLAST of SMED30017899 vs. Planmine SMEST
Match: SMESG000019863.1 (SMESG000019863.1)

HSP 1 Score: 232.261 bits (591), Expect = 1.528e-71
Identity = 109/129 (84.50%), Postives = 118/129 (91.47%), Query Frame = 2
Query:    2 QMFKPPATRNPEDRGNNQVSYNNNFRSNPNANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRREPNQSRLNNS-MGNPQINVMQEIDMLRETLQRMPMEL 385
            QMFKPP TRNPED+GNNQVSYNNNFR+ PNANE+CSTCQ++GHRSENCFRNY CQKCGRRGHTE+ICRQ +NKACYNCGQQGH AR+CNIR E NQ R NN+ M NPQINVMQEIDMLRETLQRMPMEL
Sbjct:  234 QMFKPPTTRNPEDKGNNQVSYNNNFRNKPNANEQCSTCQKMGHRSENCFRNYNCQKCGRRGHTERICRQLDNKACYNCGQQGHIARRCNIRGEANQPRPNNNPMRNPQINVMQEIDMLRETLQRMPMEL 362          
BLAST of SMED30017899 vs. Planmine SMEST
Match: SMESG000059476.1 (SMESG000059476.1)

HSP 1 Score: 218.394 bits (555), Expect = 8.902e-67
Identity = 99/128 (77.34%), Postives = 112/128 (87.50%), Query Frame = 2
Query:    2 QMFKPPATRNPEDRGNNQVSYNNNFRSNPNANEKCSTCQRIGHRSENCFRNYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRREPNQSRLNNSMGNPQINVMQEIDMLRETLQRMPMEL 385
            QMFKPP TRNPE+ GNNQVSYNNNFR+NP ANE C+TCQRIGHR+E+C+RNY CQKCGRRGH EK+C Q +N+ACYNC ++GH AR CN+RR PNQ R NNS GNPQINVMQEID+LRET QRMPMEL
Sbjct:  309 QMFKPPPTRNPENGGNNQVSYNNNFRNNPKANEICTTCQRIGHRAEDCYRNYNCQKCGRRGHIEKVCGQLDNRACYNCNRKGHLARNCNMRRGPNQQRTNNSTGNPQINVMQEIDLLRETSQRMPMEL 436          
The following BLAST results are available for this feature:
BLAST of SMED30017899 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNBP6.192e-737.88CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP6.714e-737.88CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP6.831e-737.88CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP7.286e-737.88CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP7.866e-737.88CCHC-type zinc finger nucleic acid binding protein... [more]
back to top
BLAST of SMED30017899 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
glh-45.426e-936.62ATP-dependent RNA helicase glh-4 [Source:UniProtK... [more]
glh-45.426e-936.62ATP-dependent RNA helicase glh-4 [Source:UniProtK... [more]
back to top
BLAST of SMED30017899 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CNBP9.097e-636.62gene:FBgn0034802 transcript:FBtr0303464[more]
CNBP9.097e-636.62gene:FBgn0034802 transcript:FBtr0071994[more]
back to top
BLAST of SMED30017899 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnbpb1.994e-737.97CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpb1.994e-737.97CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa6.667e-740.91CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa6.667e-740.91CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa6.667e-740.91CCHC-type zinc finger, nucleic acid binding protei... [more]
back to top
BLAST of SMED30017899 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017899 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zcchc131.673e-836.67zinc finger, CCHC domain containing 13 [Source:MGI... [more]
Cnbp4.609e-737.88cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp4.609e-737.88cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp5.002e-737.88cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp5.400e-737.88cellular nucleic acid binding protein [Source:MGI ... [more]
back to top
BLAST of SMED30017899 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O65639|CSP1_ARATH4.126e-835.06Cold shock protein 1 OS=Arabidopsis thaliana OX=37... [more]
sp|O76743|GLH4_CAEEL6.901e-836.62ATP-dependent RNA helicase glh-4 OS=Caenorhabditis... [more]
sp|Q89928|POL_HV2EH7.778e-844.19Gag-Pol polyprotein OS=Human immunodeficiency viru... [more]
sp|Q9Q720|POL_HV1V91.700e-741.86Gag-Pol polyprotein OS=Human immunodeficiency viru... [more]
sp|Q76634|POL_HV2UC1.786e-747.50Gag-Pol polyprotein OS=Human immunodeficiency viru... [more]
back to top
BLAST of SMED30017899 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A261Y7344.445e-1050.91Uncharacterized protein OS=Bifiguratus adelaidae O... [more]
A0A1R0H6H22.792e-942.65DNA-binding protein HEXBP OS=Smittium mucronatum O... [more]
A0A396HR198.089e-940.63Putative nucleotidyltransferase, Ribonuclease H OS... [more]
A0A146I6E91.445e-839.66Uncharacterized protein OS=Mycena chlorophos OX=65... [more]
A0A146I6C11.446e-839.66Uncharacterized protein OS=Mycena chlorophos OX=65... [more]
back to top
BLAST of SMED30017899 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000005562.21.119e-737.97cellular nucleic acid-binding protein [Source:NCBI... [more]
cnbpa2.523e-740.91cellular nucleic acid-binding protein-like [Source... [more]
ENSAMXT00000033510.13.304e-628.87pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30017899 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017899 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GIS21.260e-835.38Translational activator for mRNAs with internal ri... [more]
back to top
BLAST of SMED30017899 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017899 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000043369.16.691e-836.84pep primary_assembly:ASM223467v1:17:15543647:15547... [more]
cnbpa2.973e-739.39CCHC-type zinc finger nucleic acid binding protein... [more]
cnbpa3.415e-739.39CCHC-type zinc finger nucleic acid binding protein... [more]
back to top
BLAST of SMED30017899 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074160.12.756e-7594.53SMESG000074160.1[more]
SMESG000019863.11.348e-7184.50SMESG000019863.1[more]
SMESG000019863.11.442e-7184.50SMESG000019863.1[more]
SMESG000019863.11.528e-7184.50SMESG000019863.1[more]
SMESG000059476.18.902e-6777.34SMESG000059476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017899 ID=SMED30017899|Name=SMED30017899|organism=Schmidtea mediterranea sexual|type=transcript|length=386bp
GCAGATGTTCAAGCCACCAGCAACGAGAAATCCGGAGGATAGAGGTAATA
ACCAAGTAAGTTATAATAATAATTTCAGGAGCAATCCAAACGCAAACGAA
AAATGCTCCACATGCCAAAGAATAGGACATCGGTCAGAGAATTGTTTCCG
AAATTACACTTGTCAAAAATGTGGTAGACGAGGGCATACTGAGAAAATAT
GTAGACAACCTAATAACAAAGCATGTTACAATTGTGGACAACAAGGACAT
TTCGCAAGGCAATGTAACATAAGAAGAGAACCAAACCAGTCAAGATTAAA
CAACTCTATGGGAAATCCACAAATTAACGTGATGCAAGAGATAGACATGC
TACGAGAAACACTACAACGAATGCCCATGGAATTAA
back to top

protein sequence of SMED30017899-orf-1

>SMED30017899-orf-1 ID=SMED30017899-orf-1|Name=SMED30017899-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=128bp
QMFKPPATRNPEDRGNNQVSYNNNFRSNPNANEKCSTCQRIGHRSENCFR
NYTCQKCGRRGHTEKICRQPNNKACYNCGQQGHFARQCNIRREPNQSRLN
NSMGNPQINVMQEIDMLRETLQRMPMEL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
IPR025836Zn_knuckle_CX2CX4HX4C
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding