Activator of 90 kDa heat shock protein ATPase-like protein 1

Overview
NameActivator of 90 kDa heat shock protein ATPase-like protein 1
Smed IDSMED30017896
Length (bp)1348
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Activator of 90 kDa heat shock protein ATPase-like protein 1 (SMED30017896) t-SNE clustered cells

Violin plots show distribution of expression levels for Activator of 90 kDa heat shock protein ATPase-like protein 1 (SMED30017896) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Activator of 90 kDa heat shock protein ATPase-like protein 1 (SMED30017896) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Activator of 90 kDa heat shock protein ATPase-like protein 1 (SMED30017896) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017896

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017896SMESG000066442.1 SmedASXL_009507SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30017896SMESG000066442.1 SmedASXL_009507SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30017896SMESG000066442.1 dd_Smed_v4_2497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017896SMESG000066442.1 dd_Smed_v4_2497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017896SMESG000066442.1 dd_Smed_v4_2497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017896SMESG000066442.1 dd_Smed_v4_2497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017896SMESG000066442.1 dd_Smed_v4_2497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017896SMESG000066442.1 dd_Smed_v4_2497_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017896SMESG000066442.1 Contig31172newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30017896SMESG000066442.1 Contig31172uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30017896SMESG000066442.1 Contig31172newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30017896SMESG000066442.1 Contig31172uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30017896SMESG000066442.1 dd_Smed_v4_2497_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Human
Match: AHSA1 (activator of HSP90 ATPase activity 1 [Source:HGNC Symbol;Acc:HGNC:1189])

HSP 1 Score: 255.373 bits (651), Expect = 3.747e-81
Identity = 131/342 (38.30%), Postives = 201/342 (58.77%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNT--DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DA NVNNWHW E++A+ WS D +K L   + V+N+E   E+ E+SK++GEA  NNRK K+I FYEW ++  W G+   S +  ++KG  +IPNLS+E    E+ ++V++  +  + N L   ++ E  K+++E +G YI+ LKTE+++ +ILPT    +        + T ++           +   VK    ++  +     +P +L++VF   + V AF+ +P+ +    GG+F M    VSG F +L     I +KWR KSW   HF+T+ + F   +  T L +  + IP  +   T++GWQR+YF  IK TFGYG ++F
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASINNRKGKLIFFYEWSVKLNWTGT---SKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTN-LVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF 338          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Human
Match: AHSA1 (activator of HSP90 ATPase activity 1 [Source:HGNC Symbol;Acc:HGNC:1189])

HSP 1 Score: 202.986 bits (515), Expect = 1.600e-61
Identity = 108/284 (38.03%), Postives = 166/284 (58.45%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNT--DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWA 911
            MAKWGEGDPRWIVEER DA NVNNWHW E++A+ WS D +K L   + V+N+E   E+ E+SK++GEA  NNRK K+I FYEW ++  W G+   S +  ++KG  +IPNLS+E    E+ ++V++  +  + N L   ++ E  K+++E +G YI+ LKTE+++ +ILPT    +        + T ++           +   VK    ++  +     +P +L++VF   + V AF+ +P+ +    GG+F M    VSG F +L     I +KWR KSW 
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASINNRKGKLIFFYEWSVKLNWTGT---SKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTN-LVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWP 280          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Human
Match: AHSA1 (activator of HSP90 ATPase activity 1 [Source:HGNC Symbol;Acc:HGNC:1189])

HSP 1 Score: 119.783 bits (299), Expect = 3.034e-32
Identity = 55/94 (58.51%), Postives = 69/94 (73.40%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLK 353
            MAKWGEGDPRWIVEER DA NVNNWHW E++A+ WS D +K L   + V+N+E   E+ E+SK++GEA  NNRK K+I FYEW ++  W G  K
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASINNRKGKLIFFYEWSVKLNWTGKSK 94          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Human
Match: AHSA1 (activator of HSP90 ATPase activity 1 [Source:HGNC Symbol;Acc:HGNC:1189])

HSP 1 Score: 119.783 bits (299), Expect = 6.004e-31
Identity = 64/203 (31.53%), Postives = 107/203 (52.71%), Query Frame = 3
Query:  489 VRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNT--DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            ++ E  K+++E +G YI+ LKTE+++ +ILPT    +        + T ++           +   VK    ++  +     +P +L++VF   + V AF+ +P+ +    GG+F M    VSG F +L     I +KWR KSW   HF+T+ + F   +  T L +  + IP  +   T++GWQR+YF  IK TFGYG ++F
Sbjct:    1 MKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF 203          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Human
Match: AHSA1 (activator of HSP90 ATPase activity 1 [Source:HGNC Symbol;Acc:HGNC:1189])

HSP 1 Score: 112.464 bits (280), Expect = 3.678e-28
Identity = 66/212 (31.13%), Postives = 116/212 (54.72%), Query Frame = 3
Query:  240 EIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNT--DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEEL 863
            E+ E+SK++GEA  NNRK K+I FYEW ++  W G+   S +  ++KG  +IPNLS+E    E+ ++V++  +  + N L   ++ E  K+++E +G YI+ LKTE+++ +ILPT    +        + T ++           +   VK    ++  +     +P +L++VF   + V AF+ +P+ +    GG+F M    VSG F +L
Sbjct:    3 EVTEVSKLDGEASINNRKGKLIFFYEWSVKLNWTGT---SKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTN-LVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDL 210          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Celegans
Match: ahsa-1 (Activator of HSp90 (HSP90) Atpase (ATPase) activity homolog [Source:UniProtKB/TrEMBL;Acc:Q93168])

HSP 1 Score: 255.758 bits (652), Expect = 1.196e-81
Identity = 141/344 (40.99%), Postives = 202/344 (58.72%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATG---VNTYKQTMNEIVVSKNCKDSS---VKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFS-RSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKM 1082
            MAKWGEGDPRWIVEER DA NVNNWHW+EKNAT WS + +++LL G   E+      I E+ KI+GEA ANNRKAK+I  +EWVIE  +   +  S++  E+KG FDIPNLS+E DASE+ VN ++  N   A++++  +       I++ +G YI +LK E+SK LILPT +V      TG   V   +Q  N +V  K+   S         +   + +  TP  +F+    T FV  ++  S  + N   GG F +FGE V+G FE++E    I  KWR K +  NH +T+    K T +GT + +  K++P +    T++G  R+Y ++I  TFG+  +M
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWSEKNATPWSLNRLRELLTGFSSEDGPIVVTIDEIKKIDGEATANNRKAKLIFLFEWVIEGTFIARVSGSED--EYKGTFDIPNLSDENDASEVDVNSSLSGNGPMAHQIRQVLNKSFIAKIQDVMGIYIRELKEEFSKGLILPTDKVKPQVVTTGKTSVVDKRQFQNTVVAEKDASTSGNEVFSTKEVSTSDTYKATPDRVFEALTETQFVRGWTNNSIGEWNFKEGGSFALFGENVTGTFEKIEPNKEIVKKWRLKKYPNNHHATIHFQLKDTGSGTDIKIIAKDVPTHLAEETQQGLDRYYLSSIGRTFGFSQRM 342          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Celegans
Match: ahsa-1 (Activator of HSp90 (HSP90) Atpase (ATPase) activity homolog [Source:UniProtKB/TrEMBL;Acc:Q93168])

HSP 1 Score: 255.758 bits (652), Expect = 1.196e-81
Identity = 141/344 (40.99%), Postives = 202/344 (58.72%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATG---VNTYKQTMNEIVVSKNCKDSS---VKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFS-RSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKM 1082
            MAKWGEGDPRWIVEER DA NVNNWHW+EKNAT WS + +++LL G   E+      I E+ KI+GEA ANNRKAK+I  +EWVIE  +   +  S++  E+KG FDIPNLS+E DASE+ VN ++  N   A++++  +       I++ +G YI +LK E+SK LILPT +V      TG   V   +Q  N +V  K+   S         +   + +  TP  +F+    T FV  ++  S  + N   GG F +FGE V+G FE++E    I  KWR K +  NH +T+    K T +GT + +  K++P +    T++G  R+Y ++I  TFG+  +M
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWSEKNATPWSLNRLRELLTGFSSEDGPIVVTIDEIKKIDGEATANNRKAKLIFLFEWVIEGTFIARVSGSED--EYKGTFDIPNLSDENDASEVDVNSSLSGNGPMAHQIRQVLNKSFIAKIQDVMGIYIRELKEEFSKGLILPTDKVKPQVVTTGKTSVVDKRQFQNTVVAEKDASTSGNEVFSTKEVSTSDTYKATPDRVFEALTETQFVRGWTNNSIGEWNFKEGGSFALFGENVTGTFEKIEPNKEIVKKWRLKKYPNNHHATIHFQLKDTGSGTDIKIIAKDVPTHLAEETQQGLDRYYLSSIGRTFGFSQRM 342          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Fly
Match: CG1416 (gene:FBgn0032961 transcript:FBtr0085904)

HSP 1 Score: 260.381 bits (664), Expect = 3.744e-83
Identity = 138/348 (39.66%), Postives = 199/348 (57.18%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTK-----RVNT-----DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX----CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYG 1073
            MAKWGEGDPRWIVEER DA NVNNWHW EKNAT WSKD + +L     +   +    +  + K  GEA  NNRK K+I FYEW +  +W G L + ++K   KGK  IPNLSEE + +++ + VT++ ++DE+  LK ++       ++++L  YI +LK EYSK+LILP K       NT     D + T        +N  V +   K+S +                C+  DL+      + V AF+R+P+KV+   GGEFI++G  V G FEEL     I+  WR K+W   H+S V +  + T + T+++L Q  IP ++F + K  W R+Y+++IK TFG+G
Sbjct:    1 MAKWGEGDPRWIVEERPDATNVNNWHWTEKNATPWSKDRLHQLFQDFKIGQSDIECAVDSVDKCSGEATVNNRKGKLIFFYEWELVLKWSGKLLK-NSKLIHKGKLTIPNLSEENELADVEITVTIDESNDESETLKQFMYNVGRDRVRQQLASYIRELKEEYSKNLILPKKGDEAGAGNTVANFKDANNTRNAAQNIALNSSVAAPRLKNSGIGCKLDVRTLSMTEEFHCSANDLYNALTKPEMVTAFTRAPAKVDAVRGGEFILYGGNVLGKFEELVPEKKIQQSWRLKNWTSGHYSNVVIELEETSSSTMMSLKQTGIPASEFDAMKTNWYRYYWHSIKQTFGFG 347          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Fly
Match: CG1416 (gene:FBgn0032961 transcript:FBtr0085905)

HSP 1 Score: 260.381 bits (664), Expect = 3.744e-83
Identity = 138/348 (39.66%), Postives = 199/348 (57.18%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTK-----RVNT-----DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX----CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYG 1073
            MAKWGEGDPRWIVEER DA NVNNWHW EKNAT WSKD + +L     +   +    +  + K  GEA  NNRK K+I FYEW +  +W G L + ++K   KGK  IPNLSEE + +++ + VT++ ++DE+  LK ++       ++++L  YI +LK EYSK+LILP K       NT     D + T        +N  V +   K+S +                C+  DL+      + V AF+R+P+KV+   GGEFI++G  V G FEEL     I+  WR K+W   H+S V +  + T + T+++L Q  IP ++F + K  W R+Y+++IK TFG+G
Sbjct:    1 MAKWGEGDPRWIVEERPDATNVNNWHWTEKNATPWSKDRLHQLFQDFKIGQSDIECAVDSVDKCSGEATVNNRKGKLIFFYEWELVLKWSGKLLK-NSKLIHKGKLTIPNLSEENELADVEITVTIDESNDESETLKQFMYNVGRDRVRQQLASYIRELKEEYSKNLILPKKGDEAGAGNTVANFKDANNTRNAAQNIALNSSVAAPRLKNSGIGCKLDVRTLSMTEEFHCSANDLYNALTKPEMVTAFTRAPAKVDAVRGGEFILYGGNVLGKFEELVPEKKIQQSWRLKNWTSGHYSNVVIELEETSSSTMMSLKQTGIPASEFDAMKTNWYRYYWHSIKQTFGFG 347          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Fly
Match: CG1416 (gene:FBgn0032961 transcript:FBtr0085903)

HSP 1 Score: 260.381 bits (664), Expect = 3.744e-83
Identity = 138/348 (39.66%), Postives = 199/348 (57.18%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTK-----RVNT-----DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX----CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYG 1073
            MAKWGEGDPRWIVEER DA NVNNWHW EKNAT WSKD + +L     +   +    +  + K  GEA  NNRK K+I FYEW +  +W G L + ++K   KGK  IPNLSEE + +++ + VT++ ++DE+  LK ++       ++++L  YI +LK EYSK+LILP K       NT     D + T        +N  V +   K+S +                C+  DL+      + V AF+R+P+KV+   GGEFI++G  V G FEEL     I+  WR K+W   H+S V +  + T + T+++L Q  IP ++F + K  W R+Y+++IK TFG+G
Sbjct:    1 MAKWGEGDPRWIVEERPDATNVNNWHWTEKNATPWSKDRLHQLFQDFKIGQSDIECAVDSVDKCSGEATVNNRKGKLIFFYEWELVLKWSGKLLK-NSKLIHKGKLTIPNLSEENELADVEITVTIDESNDESETLKQFMYNVGRDRVRQQLASYIRELKEEYSKNLILPKKGDEAGAGNTVANFKDANNTRNAAQNIALNSSVAAPRLKNSGIGCKLDVRTLSMTEEFHCSANDLYNALTKPEMVTAFTRAPAKVDAVRGGEFILYGGNVLGKFEELVPEKKIQQSWRLKNWTSGHYSNVVIELEETSSSTMMSLKQTGIPASEFDAMKTNWYRYYWHSIKQTFGFG 347          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Zebrafish
Match: ahsa1a (AHA1, activator of heat shock protein ATPase homolog 1a [Source:ZFIN;Acc:ZDB-GENE-030131-1869])

HSP 1 Score: 257.299 bits (656), Expect = 4.592e-82
Identity = 141/343 (41.11%), Postives = 201/343 (58.60%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANR-LKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRV--NTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DA NVNNWHW E++ T WS+D I  LL G+ VE +E   EI ++S I+GEA  NNRK K+I FYEWV++A W G+ K      ++KG  +IPNLS+E D  ++ ++VT+    D+ N  L D +R E  K I+  LG Y+  LKTE+++ +ILPT+      +  A       +T      + N   + VK   +    +     +P +L+++F+  + V AF+   + V+G  GG+F +    V G F EL     I ++WR  SW   H +TV ++F    + T L L  K +P N+    KEGWQR+YFNAIK TFG+G  ++
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDVTSWSQDAINGLLLGIRVEGEEGTCEITDVSNIDGEASINNRKGKLIYFYEWVVKASWTGTNKIG---IKYKGIVEIPNLSDENDMDDLDISVTL--CKDQPNTPLTDLMRREGVKKIRMALGNYVKHLKTEFAQGMILPTENALFQQNQEAKAKVKLDKTQIGSPSTANAPSTGVKIATVSFSLKDTFLTSPEELYRIFITQEMVQAFTHLAAFVDGRCGGKFRLLEGNVHGQFAELIPDKKIAMRWRFASWPAGHAATVILNFVNQGSETELILEAKGVPSNEEERMKEGWQRYYFNAIKQTFGFGALLY 338          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Zebrafish
Match: ahsa1b (AHA1, activator of heat shock protein ATPase homolog 1b [Source:ZFIN;Acc:ZDB-GENE-030131-664])

HSP 1 Score: 256.914 bits (655), Expect = 6.208e-82
Identity = 138/341 (40.47%), Postives = 201/341 (58.94%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNT--DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKM 1082
            MAKWGEGDPRWIVEER DA NVNNWHW E++ T WS + +K+LL GL VE++E   EI E+SK+EGEA  NNRK K+I FYEW ++A W G+   S +  ++KG  DIPNLS+E D  +  + V++  +  E   L   +R E +  I+  L  Y+  LKTE+++ +ILPT    T   T      T K  +     +    ++ VK    +         +P +L++VF+N + V AF+RS + V G  GG+F +    V+G F EL     I +KWR  +W   H++TV + F      T L +  + +P+++   T++GWQR+Y +AIK TFGYG ++
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDVTSWSSEKLKELLMGLQVESEEGKCEITEVSKVEGEASINNRKGKLIFFYEWNLKAAWTGT---STSGIKYKGNIDIPNLSDENDIDDFDIGVSLCKDEPETALL-SLMRKEGANKIRTALASYVGFLKTEFTQGMILPTANGMTKQPTGQAITETSKTQIGSCSTAPPPSNTGVKIPTCKFSIRDTFLTSPEELYRVFLNQELVQAFTRSGAMVEGEKGGKFRLLNGNVNGEFLELVSEQKIVMKWRFNTWPCEHYATVTLTFTDKGNETELKVDCRGVPESEEERTRDGWQRYYCHAIKQTFGYGARL 337          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Zebrafish
Match: ahsa1a (AHA1, activator of heat shock protein ATPase homolog 1a [Source:ZFIN;Acc:ZDB-GENE-030131-1869])

HSP 1 Score: 198.749 bits (504), Expect = 1.202e-59
Identity = 116/315 (36.83%), Postives = 176/315 (55.87%), Query Frame = 3
Query:  156 EKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANR-LKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRV--NTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            E++ T WS+D I  LL G+ VE +E   EI ++S I+GEA  NNRK K+I FYEWV++A W G+ K      ++KG  +IPNLS+E D  ++ ++VT+    D+ N  L D +R E  K I+  LG Y+  LKTE+++ +ILPT+      +  A       +T      + N   + VK   +    +     +P +L+++F+  + V AF+   + V+G  GG+F +    V G F EL     I ++WR  SW   H +TV ++F    + T L L  K +P N+    KEGWQR+YFNAIK TFG+G  ++
Sbjct:    7 ERDVTSWSQDAINGLLLGIRVEGEEGTCEITDVSNIDGEASINNRKGKLIYFYEWVVKASWTGTNKIG---IKYKGIVEIPNLSDENDMDDLDISVTL--CKDQPNTPLTDLMRREGVKKIRMALGNYVKHLKTEFAQGMILPTENALFQQNQEAKAKVKLDKTQIGSPSTANAPSTGVKIATVSFSLKDTFLTSPEELYRIFITQEMVQAFTHLAAFVDGRCGGKFRLLEGNVHGQFAELIPDKKIAMRWRFASWPAGHAATVILNFVNQGSETELILEAKGVPSNEEERMKEGWQRYYFNAIKQTFGFGALLY 316          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Zebrafish
Match: ahsa1a (AHA1, activator of heat shock protein ATPase homolog 1a [Source:ZFIN;Acc:ZDB-GENE-030131-1869])

HSP 1 Score: 146.747 bits (369), Expect = 3.905e-42
Identity = 77/147 (52.38%), Postives = 100/147 (68.03%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANR-LKDYVRTECSK 509
            MAKWGEGDPRWIVEER DA NVNNWHW E++ T WS+D I  LL G+ VE +E   EI ++S I+GEA  NNRK K+I FYEWV++A W G+ K      ++KG  +IPNLS+E D  ++ ++VT+    D+ N  L D +R E  K
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDVTSWSQDAINGLLLGIRVEGEEGTCEITDVSNIDGEASINNRKGKLIYFYEWVVKASWTGTNKIG---IKYKGIVEIPNLSDENDMDDLDISVTL--CKDQPNTPLTDLMRREGVK 142          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Zebrafish
Match: ahsa1a (AHA1, activator of heat shock protein ATPase homolog 1a [Source:ZFIN;Acc:ZDB-GENE-030131-1869])

HSP 1 Score: 106.301 bits (264), Expect = 7.940e-27
Identity = 60/136 (44.12%), Postives = 85/136 (62.50%), Query Frame = 3
Query:  150 WAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANR-LKDYVRTECSKVIKEKLGKYITDLKT 554
            W E++ T WS+D I  LL G+ VE +E   EI ++S I+GEA  NNRK K+I FYEWV++A W G+ K      ++KG  +IPNLS+E D  ++ ++VT+    D+ N  L D +R E  K I+  LG Y+  LKT
Sbjct:   20 WTERDVTSWSQDAINGLLLGIRVEGEEGTCEITDVSNIDGEASINNRKGKLIYFYEWVVKASWTGTNKIG---IKYKGIVEIPNLSDENDMDDLDISVTL--CKDQPNTPLTDLMRREGVKKIRMALGNYVKHLKT 150          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Xenopus
Match: tmem14c (transmembrane protein 14C [Source:Xenbase;Acc:XB-GENE-876311])

HSP 1 Score: 264.618 bits (675), Expect = 8.234e-85
Identity = 137/341 (40.18%), Postives = 204/341 (59.82%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQT-MNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVE R DA NVNNWHW E++AT WS + IK+L+  + VE++E   EI E+SK+EGEA  NNRK K+I FYEW I+  W G    S +  ++KG  +IPNLS+E D SE+ + V++  +  E N L   +R + S  I+E +  YI+ LKTE+++ +ILPT    + +  T +    +T M +   S+ C+++ VK    ++  +     +P +L++V    + V  F+ +P+ +    GG+F + G  VSG F ELE    I + WR KSW   H +++ + F      T L +  + +P  +   TKEGW+R+YF+ IK TFGYG  + 
Sbjct:    1 MAKWGEGDPRWIVEMRADATNVNNWHWTERDATSWSSEKIKELMMDIRVESEEGTCEITEVSKLEGEASINNRKGKLIFFYEWDIKLNWTGV---SKSGVKYKGHVEIPNLSDENDPSEVEIRVSMAKDEPETN-LIGVMRRQGSNQIREAVALYISMLKTEFTQGMILPTANGVSHSRVTEIKQKAETNMPQTSKSQTCQNAGVKIPTCKVNIKDTFLTSPEELYRVLTRQELVQGFTHAPASLTADKGGKFQLLGGNVSGEFLELEPEKKIVMSWRFKSWPQGHHASITLTFTDKGGETELQMEARGVPQGEEDRTKEGWKRYYFDGIKQTFGYGALLL 337          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Mouse
Match: Ahsa1 (AHA1, activator of heat shock protein ATPase 1 [Source:MGI Symbol;Acc:MGI:2387603])

HSP 1 Score: 252.292 bits (643), Expect = 4.000e-80
Identity = 133/348 (38.22%), Postives = 202/348 (58.05%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXC----------TPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DA NVNNWHW E++A+ WS + +K L   + VEN+E   E+ E++K++GEA  NNRK K+I FYEW I+  W G+   S +  ++KG  +IPNLS+E    E+ ++V++  +  + N L   ++ +  K+++E +G YI+ LKTE+++ +ILPT  VN ++    V+   Q   +    K     S         +   C          +P +L++VF   + V AF+ +P+ +    GG+F M    V+G F +L     I +KWR KSW   HF+T+ + F   +  T L +  + IP  +   T++GWQR+YF  IK TFGYG ++F
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTEKLKTLFLAVRVENEEGKCEVTEVNKLDGEASINNRKGKLIFFYEWTIKLNWTGT---SKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTN-LVALMKEDGVKLLREAVGIYISTLKTEFTQGMILPT--VNGES----VDPVGQPALKTETCKAKSAPSKSQAKPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPAALEADRGGKFHMVDGNVTGEFTDLVPEKHIAMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF 338          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Mouse
Match: Ahsa2 (AHA1, activator of heat shock protein ATPase 2 [Source:MGI Symbol;Acc:MGI:1916133])

HSP 1 Score: 238.81 bits (608), Expect = 6.910e-75
Identity = 139/330 (42.12%), Postives = 198/330 (60.00%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNE--IVVSKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIK 1055
            MAKWG+GDPRWIVEERED  NVNNWHW E++AT WSK  +++LL G+ +EN+    EI EL ++EGEA  N+RK K+I FYEW I+  WKG++K+S  K   KG  +IP+LSEE + ++  VNV+ +    E   LKD +RT  +  ++E LG+Y+  LKTE++  +ILPTK V     AT   T ++ +NE  +  S       +  +AL L E F  T   L+ +F   + V  FS+SP+ +    GG+F MF   +SG + EL     I +KWR ++W   H++TVE++F      T L L  K +P     + K  WQ+ +F  IK
Sbjct:    1 MAKWGQGDPRWIVEEREDGTNVNNWHWTERDATIWSKGKLRELLVGIAMENEAGRCEISELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGTVKESGAK--HKGLIEIPSLSEENEINDTEVNVSKKKGDGEI--LKDLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAV-----ATQELTLQRKLNENKLQASPVALGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNISGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIK 321          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Mouse
Match: Ahsa2 (AHA1, activator of heat shock protein ATPase 2 [Source:MGI Symbol;Acc:MGI:1916133])

HSP 1 Score: 180.259 bits (456), Expect = 1.441e-52
Identity = 115/302 (38.08%), Postives = 173/302 (57.28%), Query Frame = 3
Query:  156 EKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNE--IVVSKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIK 1055
            E++AT WSK  +++LL G+ +EN+    EI EL ++EGEA  N+RK K+I FYEW I+  WKG++K+S  K   KG  +IP+LSEE + ++  VNV+ +    E   LKD +RT  +  ++E LG+Y+  LKTE++  +ILPTK V     AT   T ++ +NE  +  S       +  +AL L E F  T   L+ +F   + V  FS+SP+ +    GG+F MF   +SG + EL     I +KWR ++W   H++TVE++F      T L L  K +P     + K  WQ+ +F  IK
Sbjct:   15 ERDATIWSKGKLRELLVGIAMENEAGRCEISELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGTVKESGAK--HKGLIEIPSLSEENEINDTEVNVSKKKGDGEI--LKDLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAV-----ATQELTLQRKLNENKLQASPVALGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNISGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIK 307          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Mouse
Match: Ahsa2 (AHA1, activator of heat shock protein ATPase 2 [Source:MGI Symbol;Acc:MGI:1916133])

HSP 1 Score: 164.466 bits (415), Expect = 5.437e-48
Identity = 83/161 (51.55%), Postives = 113/161 (70.19%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKT 554
            MAKWG+GDPRWIVEERED  NVNNWHW E++AT WSK  +++LL G+ +EN+    EI EL ++EGEA  N+RK K+I FYEW I+  WKG++K+S  K   KG  +IP+LSEE + ++  VNV+ +    E   LKD +RT  +  ++E LG+Y+  LKT
Sbjct:    1 MAKWGQGDPRWIVEEREDGTNVNNWHWTERDATIWSKGKLRELLVGIAMENEAGRCEISELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGTVKESGAK--HKGLIEIPSLSEENEINDTEVNVSKKKGDGEI--LKDLMRTTGTAKVREALGEYLKALKT 157          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Mouse
Match: Ahsa2 (AHA1, activator of heat shock protein ATPase 2 [Source:MGI Symbol;Acc:MGI:1916133])

HSP 1 Score: 162.155 bits (409), Expect = 4.354e-46
Identity = 106/282 (37.59%), Postives = 158/282 (56.03%), Query Frame = 3
Query:  216 VENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNE--IVVSKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIK 1055
            +EN+    EI EL ++EGEA  N+RK K+I FYEW I+  WKG++K+S  K   KG  +IP+LSEE + ++  VNV+ +    E   LKD +RT  +  ++E LG+Y+  LKTE++  +ILPTK V     AT   T ++ +NE  +  S       +  +AL L E F  T   L+ +F   + V  FS+SP+ +    GG+F MF   +SG + EL     I +KWR ++W   H++TVE++F      T L L  K +P     + K  WQ+ +F  IK
Sbjct:    1 MENEAGRCEISELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGTVKESGAK--HKGLIEIPSLSEENEINDTEVNVSKKKGDGEI--LKDLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAV-----ATQELTLQRKLNENKLQASPVALGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNISGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIK 273          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. UniProt/SwissProt
Match: sp|O95433|AHSA1_HUMAN (Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1 PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 1.800e-80
Identity = 131/342 (38.30%), Postives = 201/342 (58.77%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNT--DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DA NVNNWHW E++A+ WS D +K L   + V+N+E   E+ E+SK++GEA  NNRK K+I FYEW ++  W G+   S +  ++KG  +IPNLS+E    E+ ++V++  +  + N L   ++ E  K+++E +G YI+ LKTE+++ +ILPT    +        + T ++           +   VK    ++  +     +P +L++VF   + V AF+ +P+ +    GG+F M    VSG F +L     I +KWR KSW   HF+T+ + F   +  T L +  + IP  +   T++GWQR+YF  IK TFGYG ++F
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDKLKTLFLAVQVQNEEGKCEVTEVSKLDGEASINNRKGKLIFFYEWSVKLNWTGT---SKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTN-LVALMKEEGVKLLREAMGIYISTLKTEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF 338          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. UniProt/SwissProt
Match: sp|Q8BK64|AHSA1_MOUSE (Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Mus musculus OX=10090 GN=Ahsa1 PE=1 SV=2)

HSP 1 Score: 252.292 bits (643), Expect = 2.798e-79
Identity = 133/348 (38.22%), Postives = 202/348 (58.05%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXC----------TPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DA NVNNWHW E++A+ WS + +K L   + VEN+E   E+ E++K++GEA  NNRK K+I FYEW I+  W G+   S +  ++KG  +IPNLS+E    E+ ++V++  +  + N L   ++ +  K+++E +G YI+ LKTE+++ +ILPT  VN ++    V+   Q   +    K     S         +   C          +P +L++VF   + V AF+ +P+ +    GG+F M    V+G F +L     I +KWR KSW   HF+T+ + F   +  T L +  + IP  +   T++GWQR+YF  IK TFGYG ++F
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTEKLKTLFLAVRVENEEGKCEVTEVNKLDGEASINNRKGKLIFFYEWTIKLNWTGT---SKSGVQYKGHVEIPNLSDENSVDEVEISVSLAKDEPDTN-LVALMKEDGVKLLREAVGIYISTLKTEFTQGMILPT--VNGES----VDPVGQPALKTETCKAKSAPSKSQAKPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPAALEADRGGKFHMVDGNVTGEFTDLVPEKHIAMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGARLF 338          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. UniProt/SwissProt
Match: sp|Q8N9S3|AHSA2_MOUSE (Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Mus musculus OX=10090 GN=Ahsa2 PE=1 SV=2)

HSP 1 Score: 238.81 bits (608), Expect = 4.833e-74
Identity = 139/330 (42.12%), Postives = 198/330 (60.00%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNE--IVVSKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIK 1055
            MAKWG+GDPRWIVEERED  NVNNWHW E++AT WSK  +++LL G+ +EN+    EI EL ++EGEA  N+RK K+I FYEW I+  WKG++K+S  K   KG  +IP+LSEE + ++  VNV+ +    E   LKD +RT  +  ++E LG+Y+  LKTE++  +ILPTK V     AT   T ++ +NE  +  S       +  +AL L E F  T   L+ +F   + V  FS+SP+ +    GG+F MF   +SG + EL     I +KWR ++W   H++TVE++F      T L L  K +P     + K  WQ+ +F  IK
Sbjct:    1 MAKWGQGDPRWIVEEREDGTNVNNWHWTERDATIWSKGKLRELLVGIAMENEAGRCEISELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGTVKESGAK--HKGLIEIPSLSEENEINDTEVNVSKKKGDGEI--LKDLMRTTGTAKVREALGEYLKALKTEFTTGMILPTKAV-----ATQELTLQRKLNENKLQASPVALGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGKFQMFDGNISGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIK 321          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. UniProt/SwissProt
Match: sp|A6QQC0|AHSA2_BOVIN (Activator of 90 kDa heat shock protein ATPase homolog 2 OS=Bos taurus OX=9913 GN=AHSA2 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.499e-56
Identity = 105/256 (41.02%), Postives = 152/256 (59.38%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGET 839
            MAKWG+GDPRWIVEERED  NVNNWHW E++AT WSK  +++LL G+ VEN+    EI EL ++EGEA  ++RK K+I FYEW I+  WKG +++S  K   KG  +IP+LSEE +  +  VNV+      + + LKD ++T  +  ++E LG Y+  LKTE++  +ILPTK +            +  +     S+      +  +AL + E F      L+++F   D V  FS+SP+ +    GG+F M  ET
Sbjct:    1 MAKWGQGDPRWIVEEREDGTNVNNWHWTERDATSWSKGRLRELLVGITVENEAGRCEISELKQVEGEASCSSRKGKLIFFYEWNIKLGWKGIIRESGAK--HKGLIEIPSLSEENEVDDTEVNVS--KKKGDGDILKDLMKTAGTAKVREALGDYLKALKTEFTMGMILPTKAMAAQELTVERKLSENALQIQASSRVALGVRIPTVALHMTELFDTAIEQLYRIFTVKDLVQKFSKSPAVLEAEKGGKFQMLMET 252          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. UniProt/SwissProt
Match: sp|Q719I0|AHSA2_HUMAN (Putative activator of 90 kDa heat shock protein ATPase homolog 2 OS=Homo sapiens OX=9606 GN=AHSA2P PE=5 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 6.941e-47
Identity = 114/336 (33.93%), Postives = 170/336 (50.60%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXCTP---YDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPN-FIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQ-KNIPDNDFTSTKEGWQRHYFNAIKMTF 1064
            MAKWG+G+P WIVEERED  NVNNW W E++AT  SK   ++LL G++VEND    EI EL ++EGEA  ++RK K+I FYEW I+  WKG +K+S  K   KG  +IPNLSEE +  +  V+++      +   LKD ++T  +  ++E LG Y+  LKTE++  +ILPTK + T               E+ V +    ++++  A          P     + ++F  T                         E +  IF   E  N  I +KWR  +W   H++ V ++F  T   T L L +  +I   +  + K  WQ+ +F  IK + 
Sbjct:    1 MAKWGQGNPHWIVEEREDGTNVNNWRWTERDATSLSKGKFQELLVGIVVENDAGRGEINELKQVEGEASCSSRKGKLIFFYEWNIKLGWKGIVKESGVK--HKGLIEIPNLSEENEVDDTEVSLS--KKKGDGVILKDLMKTAGTAKVREALGDYLKALKTEFTTGMILPTKAMAT--------------QELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTV------------------------EQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEE--NMKFCWQKQHFEEIKGSL 292          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. TrEMBL
Match: A0A0X3P918 (Activator of heat shock protein ATPase homolog 1 OS=Schistocephalus solidus OX=70667 GN=AHSA1 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.893e-113
Identity = 169/345 (48.99%), Postives = 231/345 (66.96%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHAT-----GVNTYKQTMNEIVVSKNCKDS--SVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DAKNVNNWHW EKNA+QWS D I  LL+GL++++D+ F EI  ++K +GEA+ANNRKAK+I FYEWVIE +W G  K+S NKT+F GK ++ NLSEEY A E+ V VT +S+S++A  +K+++R E +K+I+ +L  YI+DLK EY KDLILPTK   T +++T     G+ T  +  N  V    C       K + + LEE+F C+P DLF  F + +   +F+RS +K+N  V G +  FG  +SG F EL+ P+ I + WR ++W  +H S V++ F  +D+GT L L+Q N+P +D   TK GW  HYF  I+  F  GG  F
Sbjct:    1 MAKWGEGDPRWIVEERADAKNVNNWHWTEKNASQWSIDKIHSLLDGLVIDSDDIFCEITSITKCDGEAVANNRKAKLIFFYEWVIEGDWTGHKKKSQNKTKFTGKIEVNNLSEEYTADELDVTVTCQSSSEDAQEVKEFMRIEGTKMIRRQLSTYISDLKEEYGKDLILPTKDSTTKSNSTAVPTEGIATMLRNSNSAVAGPTCNTPVEKSKMVDITLEEDFPCSPQDLFNFFTSEELTKSFTRSDAKINAVVDGAYRAFGGNISGTFCELKPPSLISMSWRKQNWPADHLSLVKLEFTPSDSGTHLTLTQSNVPASDVDGTKSGWSSHYFMGIRRIFDCGGGRF 345          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. TrEMBL
Match: A0A3P7E2U4 (Aha1_N domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS7146 PE=4 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 2.107e-113
Identity = 169/345 (48.99%), Postives = 231/345 (66.96%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHAT-----GVNTYKQTMNEIVVSKNCKDS--SVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DAKNVNNWHW EKNA+QWS D I  LL+GL++++D+ F EI  ++K +GEA+ANNRKAK+I FYEWVIE +W G  K+S NKT+F GK ++ NLSEEY A E+ V VT +S+S++A  +K+++R E +K+I+ +L  YI+DLK EY KDLILPTK   T +++T     G+ T  +  N  V    C       K + + LEE+F C+P DLF  F + +   +F+RS +K+N  V G +  FG  +SG F EL+ P+ I + WR ++W  +H S V++ F  +D+GT L L+Q N+P +D   TK GW  HYF  I+  F  GG  F
Sbjct:   13 MAKWGEGDPRWIVEERADAKNVNNWHWTEKNASQWSIDKIHSLLDGLVIDSDDIFCEITSITKCDGEAVANNRKAKLIFFYEWVIEGDWTGHKKKSQNKTKFTGKIEVNNLSEEYTADELDVTVTCQSSSEDAQEVKEFMRIEGTKMIRRQLSTYISDLKEEYGKDLILPTKDSTTKSNSTAVPTEGIATMLRNSNSAVAGPTCNTPVEKSKMVDITLEEDFPCSPQDLFNFFTSEELTKSFTRSDAKINAVVDGAYRAFGGNISGTFCELKPPSLISMSWRKQNWPADHLSLVKLEFTPSDSGTHLTLTQSNVPASDVDGTKSGWSSHYFMGIRRIFDCGGGRF 357          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. TrEMBL
Match: A0A183SSE8 (Activator of heat shock protein ATPase homolog 1 OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 2.177e-113
Identity = 169/345 (48.99%), Postives = 231/345 (66.96%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHAT-----GVNTYKQTMNEIVVSKNCKDS--SVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DAKNVNNWHW EKNA+QWS D I  LL+GL++++D+ F EI  ++K +GEA+ANNRKAK+I FYEWVIE +W G  K+S NKT+F GK ++ NLSEEY A E+ V VT +S+S++A  +K+++R E +K+I+ +L  YI+DLK EY KDLILPTK   T +++T     G+ T  +  N  V    C       K + + LEE+F C+P DLF  F + +   +F+RS +K+N  V G +  FG  +SG F EL+ P+ I + WR ++W  +H S V++ F  +D+GT L L+Q N+P +D   TK GW  HYF  I+  F  GG  F
Sbjct:   13 MAKWGEGDPRWIVEERADAKNVNNWHWTEKNASQWSIDKIHSLLDGLVIDSDDIFCEITSITKCDGEAVANNRKAKLIFFYEWVIEGDWTGHKKKSQNKTKFTGKIEVNNLSEEYTADELDVTVTCQSSSEDAQEVKEFMRIEGTKMIRRQLSTYISDLKEEYGKDLILPTKDSTTKSNSTAVPTEGIATMLRNSNSAVAGPTCNTPVEKSKMVDITLEEDFPCSPQDLFNFFTSEELTKSFTRSDAKINAVVDGAYRAFGGNISGTFCELKPPSLISMSWRKQNWPADHLSLVKLEFTPSDSGTHLTLTQSNVPASDVDGTKSGWSSHYFMGIRRIFDCGGGRF 357          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. TrEMBL
Match: A0A1S8X8P4 (Activator of Hsp90 ATPase OS=Opisthorchis viverrini OX=6198 GN=X801_01040 PE=4 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.393e-110
Identity = 174/343 (50.73%), Postives = 232/343 (67.64%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVV-----SKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DAKNVNNWHW EKNATQWS D IKKLL  L +++DE+    +E++K EGEA  NNRK K+I FYEW IEAEW G+ K  DNKT+FKGK +IPNLSEEY   E+ V+VT  S+S + + ++++++T  +K IKEKLG+Y+  L  EYS+DLILPTK  NT T+     + K   N++       SK  KD S++   + L +EFFCTP DL++V    + V AF+R  + VN   GGE+ +FG  +SG F  L     I+++WR + W  +H S + +   + + GT LNLSQK IP  D  +TK GWQ ++F ++K T+GYGG+MF
Sbjct:    1 MAKWGEGDPRWIVEERADAKNVNNWHWTEKNATQWSIDTIKKLLGSLTIDSDEFLCNKLEVTKCEGEAHVNNRKGKLISFYEWQIEAEWSGTRKTGDNKTKFKGKVEIPNLSEEYSVEELDVSVTCTSSSGDGDAIRNFMQTVGAKAIKEKLGQYLKLLHEEYSRDLILPTKGQNT-TNQIPKESSKALPNDVRKKDTDHSKQPKDLSIR--EIHLNDEFFCTPDDLYKVLTTKELVQAFTRGEATVNAVQGGEYCIFGGNISGTFTSLTPGKLIEMQWRKREWPESHHSILCIELNSFEGGTQLNLSQKGIPAYDVENTKNGWQSNFFASVKQTYGYGGRMF 340          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. TrEMBL
Match: A0A4S2LZF6 (Aha1_N domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003798 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 4.501e-109
Identity = 174/343 (50.73%), Postives = 229/343 (66.76%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVV-----SKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DAKNVNNWHW EKNATQWS D IKKLL  L +E+DE+    IE++K EGEA  NNRK K+I FYEW IEAEW G+ K  DNKT+FKGK +IPNLSEEY   E+ V+VT  S+S + + ++ +++T  +K IKEKLG+Y+  L  EYS+DLILPTK  NT T+       +   N++       SK  KD S++   + L +EFFCTP DL++V    + V AF+R  + VN   GGE+ +FG  +SG F  L     I++ WR + W  +H S + +   + + GT LNLSQ+ IP  D  +TK GWQ ++F ++K T+GYGG+MF
Sbjct:    1 MAKWGEGDPRWIVEERADAKNVNNWHWTEKNATQWSIDTIKKLLGSLTIESDEFLCNKIEVTKCEGEAHVNNRKGKLISFYEWQIEAEWSGTRKTGDNKTKFKGKVEIPNLSEEYSVEELDVSVTCTSSSADGDAIRKFMQTVGAKSIKEKLGQYLKLLHEEYSRDLILPTKGQNT-TNQIPKEPSRTLSNDVRKKDTDHSKQPKDLSIR--EIHLNDEFFCTPDDLYKVLTTKELVQAFTRGEATVNAVQGGEYCIFGGNISGTFTSLTPGKSIEMHWRKREWPESHHSILCIELNSFEGGTQLNLSQRGIPAYDVENTKNGWQSNFFASVKQTYGYGGRMF 340          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Cavefish
Match: ahsa1b (activator of HSP90 ATPase activity 1 [Source:NCBI gene;Acc:103037304])

HSP 1 Score: 257.684 bits (657), Expect = 2.703e-82
Identity = 140/348 (40.23%), Postives = 208/348 (59.77%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPT-----------KRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKM 1082
            MAKWGEGDPRWIVEER DA NVNNWHW E++AT WS + +K+LL GL VEND+   EI E+SK+EGEA  NNRK K+I FYEW ++A+WKG    S +  ++KG  ++PNLS+E D  ++ ++V++    +    L D ++ E +  ++  L  Y+  LKTE+++ +ILPT            +V  D    G ++    ++  V    CK S        L + F  +P DL++VF+N + V AF+ + + V    GG+F + G  V G F+EL     I +KWR+ +W   H++TV + F      T L +  + +P+++   T+EGWQR+Y  AIK TFGYG ++
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDATNWSSEKLKELLVGLSVENDDGKCEITEVSKLEGEASINNRKGKLIFFYEWNLKAKWKGI---STSGIKYKGNIEVPNLSDENDMDDLDISVSL-CKDEPDTPLFDLMKKEGADKVRLALDSYVGLLKTEFTQGMILPTANGLSKQPTSQAKVKMDKTQIGSSSTAAPISTGVKIPTCKFS--------LRDTFLTSPEDLYRVFLNQEMVQAFTHTAAVVEPEKGGKFRLLGGNVFGEFQELVSEEKIVMKWRYNTWPSEHYATVTLTFTDKGNETELKIECRAVPESEEERTREGWQRYYCQAIKQTFGYGARL 336          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Cavefish
Match: ahsa1a (activator of 90 kDa heat shock protein ATPase homolog 1-like [Source:NCBI gene;Acc:103038188])

HSP 1 Score: 254.988 bits (650), Expect = 3.586e-81
Identity = 139/340 (40.88%), Postives = 201/340 (59.12%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXX--XXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DA NVNNWHW E++A+ WS++++ +LL  + VE ++   +I ++SKIEGEA  NNRK K+I FYEW I+A W G+   S N  ++KG  +IPNLS+E D  ++ + VT          L D+++    K IK  L  Y++ LK E+S+ +ILPT   +   H        +   +   +     S VK   ++  L+E F  +  +L++VF+N + V AF+   + V G  GG+F +    V G F EL     I ++WR  SW   H+S V ++F    + T LNL  K +P N+    K+GWQR+YF+AIK TFGYG ++F
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDASSWSQEVLNELLLRVHVEGEDGVCQITDVSKIEGEASINNRKGKLIFFYEWDIKASWTGT---SKNGIKYKGNIEIPNLSDENDMDDLDIRVTA-CKDQPTTPLTDFMKKMGVKEIKLALAGYVSHLKKEFSQGMILPTASEDNKQHVQKKIKVDKIQLDSSPTTKASSSGVKISTVKFNLKETFLTSAEELYRVFLNQEMVQAFTHLAAVVEGERGGKFRLMEGNVHGEFAELIPDQKIVMRWRFSSWPAGHYSVVTLNFTDQGSETELNLEAKGVPTNEEERMKQGWQRYYFDAIKQTFGYGVRIF 336          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Cavefish
Match: ahsa1b (activator of HSP90 ATPase activity 1 [Source:NCBI gene;Acc:103037304])

HSP 1 Score: 236.884 bits (603), Expect = 3.624e-74
Identity = 132/335 (39.40%), Postives = 197/335 (58.81%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPT-----------KRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYF 1043
            MAKWGEGDPRWIVEER DA NVNNWHW E++AT WS + +K+LL GL VEND+   EI E+SK+EGEA  NNRK K+I FYEW ++A+WKG    S +  ++KG  ++PNLS+E D  ++ ++V++    +    L D ++ E +  ++  L  Y+  LKTE+++ +ILPT            +V  D    G ++    ++  V    CK S        L + F  +P DL++VF+N + V AF+ + + V    GG+F + G  V G F+EL     I +KWR+ +W   H++TV + F      T L +  + +P+++   T+EGWQR  F
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDATNWSSEKLKELLVGLSVENDDGKCEITEVSKLEGEASINNRKGKLIFFYEWNLKAKWKGI---STSGIKYKGNIEVPNLSDENDMDDLDISVSL-CKDEPDTPLFDLMKKEGADKVRLALDSYVGLLKTEFTQGMILPTANGLSKQPTSQAKVKMDKTQIGSSSTAAPISTGVKIPTCKFS--------LRDTFLTSPEDLYRVFLNQEMVQAFTHTAAVVEPEKGGKFRLLGGNVFGEFQELVSEEKIVMKWRYNTWPSEHYATVTLTFTDKGNETELKIECRAVPESEEERTREGWQRFGF 323          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Sea Lamprey
Match: AHSA1 (activator of HSP90 ATPase activity 1 [Source:HGNC Symbol;Acc:HGNC:1189])

HSP 1 Score: 214.157 bits (544), Expect = 4.937e-66
Identity = 122/340 (35.88%), Postives = 186/340 (54.71%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKT--EYSKDLILPTKRVNT--DTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXX--CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAG-TVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGY 1070
            MAKWGEGDPRWIVEER DA NVNNWHW E++ T+WS+D++++LL  +   + +   E+ E+++++GEA  NNRK K+I FYEW +E  W+ +   S   T++ G   IPNLSEE D  EI V V ++ +  E   L + +RT     IK  L  Y+  LK+  E+++ +ILP K   T     AT  + + +   +    +  ++  V+     +           +L++ F + + V+ F+ +P+ V    GG   M    VSG F EL     I +KWR K+W   H++ V +  +  D G T L L   ++P     +T+  WQRHYF  I+  FG+
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDVTKWSEDLLRQLLMDVRATSVDGTCEVTEVTRVQGEASCNNRKGKLIFFYEWDLELAWQAT--GSAMGTKYSGIVKIPNLSEENDIDEIEVAVNLKKDEAETP-LLEVMRTAGVDGIKHALVTYVRTLKSGKEFTQGMILPAKNGITCQTPDATLPSGHDEQQKDACARRPSQEVGVRIPTCSVVLMETFPTCAEELYRTFTSQELVSLFTNAPALVEPEKGGRIRMLNGNVSGEFCELIENEQIVMKWRCKTWPEEHYADVTLRLRKADGGNTELRLECLHVPLRHEEATRHDWQRHYFQRIRQAFGW 337          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Sea Lamprey
Match: AHSA1 (activator of HSP90 ATPase activity 1 [Source:HGNC Symbol;Acc:HGNC:1189])

HSP 1 Score: 142.51 bits (358), Expect = 8.154e-40
Identity = 76/253 (30.04%), Postives = 132/253 (52.17%), Query Frame = 3
Query:  357 SDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXC----------TPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            S    ++ G  +IPNLSEE D  +I V+V+++S   + + L+  +RT     I++ L  Y++ +K+E+++ +ILP K         GV   K  ++ +         S+        +   C          +P DLFQVF+  + V AF+R+P++V+   GG+F +    VSG + +L     I +KWR+++W   H + V +        T L L  + +P N+   T++GW+R+YF  IK+TFGYG +++
Sbjct:    6 SKTGVKYNGIVNIPNLSEENDVDDIDVSVSLKSGEPDTDLLQ-LMRTAGEAGIRKALAAYMSKVKSEFTQGMILPAKDGAPAEKDNGVQAPKLKLDPVKKQGAYGGGSIPKGPGNGGKFETCRVNLSETFTTSPMDLFQVFVRQELVQAFTRAPAEVDPKPGGKFSLLNGNVSGYYVQLVPNERIVMKWRYRTWPAEHHADVTLVLTDKGVETELALCCEGVPTNEEELTRDGWRRYYFEGIKLTFGYGARLY 257          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Yeast
Match: AHA1 (Co-chaperone that binds Hsp82p and activates its ATPase activity; plays a role in determining prion variants; similar to Hch1p; expression is regulated by stresses such as heat shock; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002622])

HSP 1 Score: 95.5153 bits (236), Expect = 3.279e-22
Identity = 87/351 (24.79%), Postives = 154/351 (43.87%), Query Frame = 3
Query:  132 NVNNWHWAEKNATQWSKDMIKKLLNGLIVEN--DEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKT-EFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVS-----KNCKDSSVKXXXXXXXXXXX------------------CTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGE----FIMFGETVSGIFEELECPNFIKL--KWRHKSWAVNHFSTVEMHFKATDA--GTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKM 1082
            N NNWHW +KN   W+K+  K+ L G+   +  D+ + +I  +S IEG+   N RK KVI  ++  I    +G +   D     F+G  ++P ++ + +AS    ++++   + E +  K  +R+E    +++   ++  DL   +  D+ +P  +V ++ +  G    K +  EI  S     KN   SS    A                              +L++ F++   + A++RS    N     E    F +FG  V  I E + C    KL   W+ K W+    ST+EM F  +     T L +    IP  +    +  ++ +Y  +IK+TFG+G  +
Sbjct:    5 NPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSN-YTRG--NQKSSFTEIKDSASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAWTRSAQFFNSGPKLETKEKFELFGGNV--ISELVSCEKDKKLVFHWKLKDWSAPFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL 350          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Yeast
Match: HCH1 (Heat shock protein regulator; binds to Hsp90p and may stimulate ATPase activity; originally identified as a high-copy number suppressor of a HSP90 loss-of-function mutation; role in regulating Hsp90 inhibitor drug sensitivity; GFP-fusion protein localizes to the cytoplasm and nucleus; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005225])

HSP 1 Score: 56.9954 bits (136), Expect = 2.624e-10
Identity = 45/155 (29.03%), Postives = 72/155 (46.45%), Query Frame = 3
Query:  132 NVNNWHWAEKNATQWSKDMIKKLLNGL--IVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFK------GKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDL 572
            N NNWHW +KN   WSKD +   L  L  +  + +   E+ ++S I G++  + RK K I +++  +    K +   ++   E        GK +IP     +D S+I +       S   +     VR+E    + E L KY  DL  E+SKD+
Sbjct:    5 NPNNWHWVDKNTLPWSKDYLNGKLTSLSTVSSDGKSKIELTQVSSITGDSNVSQRKGKPICYFDLQLSMNVKVTNLDTNKDDEDDDGILADGKLEIPEFM--HDESDIPI------LSQGFDAFDGLVRSEFVPKVVETLLKYQDDLIKEHSKDI 151          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Nematostella
Match: EDO36786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHS1])

HSP 1 Score: 259.996 bits (663), Expect = 1.220e-83
Identity = 148/348 (42.53%), Postives = 203/348 (58.33%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNE--IVVSKNCKDSSV--------KXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DAKNVNNWHW EKNA+ WSKD  ++LL GL +EN++   +I  +SK+EGEA ANNRKAK+I  YEWVI+ EW G    S      K   +IPNLSEE +  E+ VNV+   ++ E ++LK  +RT   K+I+++L  Y+  LKTE+ + +ILP+K   T         Y+  + E    V   C  S+V            L ++EEF  +  DL+        V+AF+R+  KV+   GG F++    VSG F EL     I ++WR KSW   H ST  +     D  T L L Q  +P+  + +TK+GW+++Y+ AIK TF  G + F
Sbjct:    1 MAKWGEGDPRWIVEERADAKNVNNWHWTEKNASPWSKDKFEELLKGLEIENEQGKCKITNISKVEGEAFANNRKAKLIFLYEWVIQLEWSGMYIVS---VMPKLHLEIPNLSEENEIHEVDVNVSTNKDTKEGDKLKAIMRTVGVKLIRQRLADYVHQLKTEFIQGMILPSKDATT-------KPYELLLCECTFTVCVLCDSSAVTKPLGVPISTKKLIMKEEFLMSAEDLYSTLTEEQRVSAFTRASCKVDATRGGSFVLLDGQVSGKFTELIRDEKIVMEWRQKSWPAGHHSTATITLSQKDDRTELKLVQAGVPEASYENTKQGWKQYYWAAIKQTFMCGERYF 338          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Medaka
Match: ahsa1b (activator of 90 kDa heat shock protein ATPase homolog 1 [Source:NCBI gene;Acc:101155314])

HSP 1 Score: 262.307 bits (669), Expect = 5.702e-84
Identity = 139/349 (39.83%), Postives = 208/349 (59.60%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANR-LKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXC----------TPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEER DA NVNNWHW E++AT WS D +K LL GL VEN+E   E+ E+SK+EGEA  NNRK K+I FYEW ++A W G   +S    ++KG  ++PNLS+E D  +++++V +  N DE +  L   ++T+ ++ +++ LG Y+  LKTE+++ +ILPT   N        +  K  +++  +      SS    A    +   C          +P DL++VF+N + V AF+ S + V    GG F +    V G F EL     I +KWR+ +W   H++T+ + F    + T L +  + +P+++   TKEGW+R+YF AIK TFG+G ++F
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDATNWSTDKLKALLLGLSVENEEGTCEVTEVSKLEGEASINNRKGKLIFFYEWNVKAAWTG---KSKTGVKYKGTIEVPNLSDENDMEDLAISVMM--NKDEPDTPLLSLMKTKGAEKVRQALGSYVDFLKTEFTQGMILPT--ANGVAKVPSASQSKAKLDKTQICSGGSSSSAAAPANAGVKIPTCKFSIRDTFLTSPADLYRVFVNQEMVRAFTHSAAAVEAERGGRFRLLDGNVCGEFTELVPDEKIVMKWRYNTWPCEHYATITLTFVDRSSETELKVECRGVPNSEEEQTKEGWRRYYFEAIKQTFGFGARLF 342          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042168.1 (activator of HSP90 ATPase activity 1 [Source:NCBI gene;Acc:101174068])

HSP 1 Score: 233.417 bits (594), Expect = 7.213e-73
Identity = 129/343 (37.61%), Postives = 194/343 (56.56%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANR-LKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTK-RVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXX--------XXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGY 1070
            MAKWGEGDPRWIVEER DA NVNNWHW E++ + WS D +++LL  + VE  E    + E+SK++GEA  NNRK K+  FYEW ++A W G+   S    +++G  ++ NLS+E D  ++ +NV++    D+ N  L D ++    K ++  L KY+ DLK+E+S+ +ILPT    +    A     + +T  +I  S+    S  +             L+E F  +  +L++ F+N +FV  F+R P+ V+   GG+F     +V G F EL     I +KWR ++W   HF+ V +  +     T L +  + +P     ST+EGW+R YFNAIK  FGY
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDVSAWSSDRLRQLLLSIRVEGPEGVCLMTEVSKLDGEASINNRKGKLFFFYEWQLKASWLGT---SVGGVKYRGTVEVSNLSDENDEDDLDINVSL--CKDQPNTPLLDLMKRTGVKEVRRVLTKYVQDLKSEFSQGMILPTADGKDPSVPAKAKRNFVKTRTQITPSQKSLSSPTQTSTGVLIPTCGFNLQESFRTSAEELYETFINQEFVQVFTRLPAAVDSRKGGKFWHLDGSVHGEFTELVPHQRIHMKWRFRTWPSEHFAAVSLELEDHGDETELRMECRGVPAGQEGSTEEGWKRFYFNAIKQAFGY 338          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Medaka
Match: ENSORLT00000022752.2 (activator of HSP90 ATPase activity 1 [Source:NCBI gene;Acc:101174068])

HSP 1 Score: 207.994 bits (528), Expect = 6.267e-63
Identity = 118/328 (35.98%), Postives = 182/328 (55.49%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANR-LKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTK-RVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXX--------XXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEG 1025
            MAKWGEGDPRWIVEER DA NVNNWHW E++ + WS D +++LL  + VE  E    + E+SK++GEA  NNRK K+  FYEW ++A W G+   S    +++G  ++ NLS+E D  ++ +NV++    D+ N  L D ++    K ++  L KY+ DLK+E+S+ +ILPT    +    A     + +T  +I  S+    S  +             L+E F  +  +L++ F+N +FV  F+R P+ V+   GG+F     +V G F EL     I +KWR ++W   HF+ V +  +     T L +  + +P     ST+EG
Sbjct:    1 MAKWGEGDPRWIVEERADATNVNNWHWTERDVSAWSSDRLRQLLLSIRVEGPEGVCLMTEVSKLDGEASINNRKGKLFFFYEWQLKASWLGT---SVGGVKYRGTVEVSNLSDENDEDDLDINVSL--CKDQPNTPLLDLMKRTGVKEVRRVLTKYVQDLKSEFSQGMILPTADGKDPSVPAKAKRNFVKTRTQITPSQKSLSSPTQTSTGVLIPTCGFNLQESFRTSAEELYETFINQEFVQVFTRLPAAVDSRKGGKFWHLDGSVHGEFTELVPHQRIHMKWRFRTWPSEHFAAVSLELEDHGDETELRMECRGVPAGQEGSTEEG 323          
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Planmine SMEST
Match: SMESG000066442.1 (SMESG000066442.1)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 338/338 (100.00%), Postives = 338/338 (100.00%), Query Frame = 3
Query:   72 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKXXXXXXXXXXXCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 1085
            MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKFLALELEEEFFCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF
Sbjct:    1 MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVENDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKTEFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKEKLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCKDSSVKFLALELEEEFFCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEFIMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVLNLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF 338          
The following BLAST results are available for this feature:
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AHSA13.747e-8138.30activator of HSP90 ATPase activity 1 [Source:HGNC ... [more]
AHSA11.600e-6138.03activator of HSP90 ATPase activity 1 [Source:HGNC ... [more]
AHSA13.034e-3258.51activator of HSP90 ATPase activity 1 [Source:HGNC ... [more]
AHSA16.004e-3131.53activator of HSP90 ATPase activity 1 [Source:HGNC ... [more]
AHSA13.678e-2831.13activator of HSP90 ATPase activity 1 [Source:HGNC ... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ahsa-11.196e-8140.99Activator of HSp90 (HSP90) Atpase (ATPase) activit... [more]
ahsa-11.196e-8140.99Activator of HSp90 (HSP90) Atpase (ATPase) activit... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG14163.744e-8339.66gene:FBgn0032961 transcript:FBtr0085904[more]
CG14163.744e-8339.66gene:FBgn0032961 transcript:FBtr0085905[more]
CG14163.744e-8339.66gene:FBgn0032961 transcript:FBtr0085903[more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ahsa1a4.592e-8241.11AHA1, activator of heat shock protein ATPase homol... [more]
ahsa1b6.208e-8240.47AHA1, activator of heat shock protein ATPase homol... [more]
ahsa1a1.202e-5936.83AHA1, activator of heat shock protein ATPase homol... [more]
ahsa1a3.905e-4252.38AHA1, activator of heat shock protein ATPase homol... [more]
ahsa1a7.940e-2744.12AHA1, activator of heat shock protein ATPase homol... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem14c8.234e-8540.18transmembrane protein 14C [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ahsa14.000e-8038.22AHA1, activator of heat shock protein ATPase 1 [So... [more]
Ahsa26.910e-7542.12AHA1, activator of heat shock protein ATPase 2 [So... [more]
Ahsa21.441e-5238.08AHA1, activator of heat shock protein ATPase 2 [So... [more]
Ahsa25.437e-4851.55AHA1, activator of heat shock protein ATPase 2 [So... [more]
Ahsa24.354e-4637.59AHA1, activator of heat shock protein ATPase 2 [So... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95433|AHSA1_HUMAN1.800e-8038.30Activator of 90 kDa heat shock protein ATPase homo... [more]
sp|Q8BK64|AHSA1_MOUSE2.798e-7938.22Activator of 90 kDa heat shock protein ATPase homo... [more]
sp|Q8N9S3|AHSA2_MOUSE4.833e-7442.12Activator of 90 kDa heat shock protein ATPase homo... [more]
sp|A6QQC0|AHSA2_BOVIN2.499e-5641.02Activator of 90 kDa heat shock protein ATPase homo... [more]
sp|Q719I0|AHSA2_HUMAN6.941e-4733.93Putative activator of 90 kDa heat shock protein AT... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P9181.893e-11348.99Activator of heat shock protein ATPase homolog 1 O... [more]
A0A3P7E2U42.107e-11348.99Aha1_N domain-containing protein OS=Schistocephalu... [more]
A0A183SSE82.177e-11348.99Activator of heat shock protein ATPase homolog 1 O... [more]
A0A1S8X8P41.393e-11050.73Activator of Hsp90 ATPase OS=Opisthorchis viverrin... [more]
A0A4S2LZF64.501e-10950.73Aha1_N domain-containing protein OS=Opisthorchis f... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ahsa1b2.703e-8240.23activator of HSP90 ATPase activity 1 [Source:NCBI ... [more]
ahsa1a3.586e-8140.88activator of 90 kDa heat shock protein ATPase homo... [more]
ahsa1b3.624e-7439.40activator of HSP90 ATPase activity 1 [Source:NCBI ... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AHSA14.937e-6635.88activator of HSP90 ATPase activity 1 [Source:HGNC ... [more]
AHSA18.154e-4030.04activator of HSP90 ATPase activity 1 [Source:HGNC ... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
AHA13.279e-2224.79Co-chaperone that binds Hsp82p and activates its A... [more]
HCH12.624e-1029.03Heat shock protein regulator; binds to Hsp90p and ... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO367861.220e-8342.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ahsa1b5.702e-8439.83activator of 90 kDa heat shock protein ATPase homo... [more]
ENSORLT00000042168.17.213e-7337.61activator of HSP90 ATPase activity 1 [Source:NCBI ... [more]
ENSORLT00000022752.26.267e-6335.98activator of HSP90 ATPase activity 1 [Source:NCBI ... [more]
back to top
BLAST of Activator of 90 kDa heat shock protein ATPase-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000066442.10.000e+0100.00SMESG000066442.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017896 ID=SMED30017896|Name=Activator of 90 kDa heat shock protein ATPase-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1348bp
ATTAAATCCAATCAATCTTTGTTCTAATTATTTCGATCAGCTTCTCGTAT
TTTCTATACGGTAATCAAATCATGGCTAAATGGGGTGAAGGTGATCCAAG
ATGGATTGTTGAAGAACGTGAAGACGCTAAGAATGTCAATAATTGGCACT
GGGCTGAAAAGAATGCAACCCAATGGTCCAAAGATATGATAAAAAAGCTA
TTAAATGGACTTATTGTTGAAAATGATGAATATTTCTTTGAGATCATTGA
ATTATCAAAAATAGAGGGTGAAGCTATTGCCAATAATCGAAAAGCTAAAG
TTATTGTGTTTTATGAATGGGTTATTGAAGCAGAATGGAAAGGGAGTTTA
AAACAAAGTGATAATAAAACAGAGTTCAAAGGCAAATTTGACATACCTAA
TTTAAGTGAGGAATATGATGCTTCTGAAATCAGTGTAAATGTTACTGTTG
AAAGCAATTCTGATGAAGCAAATAGGTTAAAAGATTATGTAAGAACAGAA
TGTAGTAAAGTCATAAAGGAAAAGTTAGGAAAGTATATCACTGATTTGAA
AACGGAATATTCAAAGGATCTCATTTTACCAACCAAAAGAGTTAACACTG
ACACCCACGCAACTGGTGTAAATACTTATAAACAAACAATGAATGAAATC
GTTGTCAGCAAGAATTGCAAAGATTCGTCGGTTAAATTTCTAGCATTAGA
GTTGGAAGAAGAATTTTTTTGCACCCCTTATGATCTGTTTCAAGTATTTA
TGAATACTGATTTTGTGAATGCATTTAGTAGGTCGCCGTCAAAAGTAAAT
GGCTTTGTTGGTGGAGAATTCATAATGTTTGGAGAAACTGTTTCTGGAAT
ATTTGAAGAATTGGAATGCCCTAACTTTATTAAACTGAAGTGGAGACATA
AATCATGGGCTGTAAACCACTTCAGTACTGTTGAAATGCACTTTAAGGCC
ACTGATGCTGGAACAGTTTTAAATTTAAGTCAAAAGAATATTCCCGATAA
TGATTTTACAAGCACAAAAGAAGGCTGGCAACGTCATTATTTCAATGCTA
TAAAAATGACATTTGGCTATGGCGGGAAAATGTTTTGAAATTTATTTAAT
ATAAAGTTATAAATATTGTTTTATTGGTTCGCCGAAATTTTGAATCAATT
TGAACAATTTGTGTATCATTTCGCATTGTGTAATAGATTGATGAGGTAAT
CAAATTTTTGCTATTATGCAAGCGAATTTCAGTTGTATCAGAAATATTTA
TTTGCTTTGTCTTAGGATTTTTTGCAAGATATTAATTCAGGTGCTACCGG
AAAGGTCAGCGTTTGTAAGCATTTATAAGTAAATCTGATGTTTAATTT
back to top

protein sequence of SMED30017896-orf-1

>SMED30017896-orf-1 ID=SMED30017896-orf-1|Name=SMED30017896-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MAKWGEGDPRWIVEEREDAKNVNNWHWAEKNATQWSKDMIKKLLNGLIVE
NDEYFFEIIELSKIEGEAIANNRKAKVIVFYEWVIEAEWKGSLKQSDNKT
EFKGKFDIPNLSEEYDASEISVNVTVESNSDEANRLKDYVRTECSKVIKE
KLGKYITDLKTEYSKDLILPTKRVNTDTHATGVNTYKQTMNEIVVSKNCK
DSSVKFLALELEEEFFCTPYDLFQVFMNTDFVNAFSRSPSKVNGFVGGEF
IMFGETVSGIFEELECPNFIKLKWRHKSWAVNHFSTVEMHFKATDAGTVL
NLSQKNIPDNDFTSTKEGWQRHYFNAIKMTFGYGGKMF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051879Hsp90 protein binding
GO:0001671ATPase activator activity
GO:0051087chaperone binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036338Aha1
IPR039981AHSA-like
IPR015310AHSA1_N
IPR013538Activator_of_Hsp90_ATPase
IPR023393START-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006950response to stress
GO:0032781positive regulation of ATPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015310Activator of Hsp90 ATPase, N-terminalSMARTSM01000Aha1_N_2coord: 29..165
e-value: 1.0E-42
score: 157.9
IPR015310Activator of Hsp90 ATPase, N-terminalPFAMPF09229Aha1_Ncoord: 29..162
e-value: 2.2E-33
score: 115.4
IPR013538Activator of Hsp90 ATPase homologue 1-likePFAMPF08327AHSA1coord: 218..328
e-value: 5.6E-13
score: 49.2
IPR036338Activator of Hsp90 ATPase, Aha1GENE3DG3DSA:3.15.10.20coord: 14..171
e-value: 2.0E-41
score: 143.9
IPR036338Activator of Hsp90 ATPase, Aha1SUPERFAMILYSSF103111Activator of Hsp90 ATPase, Aha1coord: 21..166
IPR023393START-like domain superfamilyGENE3DG3DSA:3.30.530.20coord: 207..334
e-value: 1.5E-26
score: 94.6
IPR039981Activator of 90kDa heat shock protein ATPase-likePANTHERPTHR13009HEAT SHOCK PROTEIN 90 HSP90 CO-CHAPERONE AHA-1coord: 1..334
NoneNo IPR availablePANTHERPTHR13009:SF8AHA1, ACTIVATOR OF HEAT SHOCK PROTEIN ATPASE HOMOLOG 1A-RELATEDcoord: 1..334
NoneNo IPR availableCDDcd08892SRPBCC_Aha1coord: 209..333
e-value: 1.29123E-45
score: 149.635
NoneNo IPR availableSUPERFAMILYSSF55961Bet v1-likecoord: 209..334