Semaphorin-5A-like

Overview
NameSemaphorin-5A-like
Smed IDSMED30017892
Length (bp)2910
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Semaphorin-5A-like (SMED30017892) t-SNE clustered cells

Violin plots show distribution of expression levels for Semaphorin-5A-like (SMED30017892) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Semaphorin-5A-like (SMED30017892) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Semaphorin-5A-like (SMED30017892) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017892

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017892SMESG000045754.1 SMESG000037895.1 dd_Smed_v4_5479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30017892SMESG000045754.1 SMESG000037895.1 dd_Smed_v4_5479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017892SMESG000045754.1 SMESG000037895.1 dd_Smed_v4_5479_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30017892SMESG000045754.1 SMESG000037895.1 dd_Smed_v4_5479_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Semaphorin-5A-like vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 181.03 bits (458), Expect = 6.474e-46
Identity = 203/849 (23.91%), Postives = 350/849 (41.22%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNG---LASYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYK------GLLSEIESEFCSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKL-EVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N    + +  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C   S+  E     N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + + DGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG G+++RRR C+        G       E C ++  N                   + F   C++  A  P G                G+ S D D L EV +     +  T+S   W+ W  W+ C   C     E+    RKR C           C G   E + CN   C
Sbjct:   47 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSGNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVAGRKVFMCGTNAFSPMCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNC---SRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVL--PPGRREPLRSLRILHSARA----LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLA-DPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGG-WAAWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQAC 848          
BLAST of Semaphorin-5A-like vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 179.489 bits (454), Expect = 1.902e-45
Identity = 202/849 (23.79%), Postives = 351/849 (41.34%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNG---LASYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYK----GLLSEIES---EFCSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKL-EVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N    + +  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C    +       N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + + DGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG G+++RRR C+      G   E ++   E C ++  N                   + F   C++  A  P G                G+ S D D L EV +     +  T+S   W+ W  W+ C   C     E+    RKR C           C G   E + CN   C
Sbjct:   47 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSGNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVAGRKVFMCGTNAFSPMCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVL--PPGRREPLRSLRILHSARA----LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLA-DPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGG-WAAWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQAC 849          
BLAST of Semaphorin-5A-like vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 179.874 bits (455), Expect = 2.154e-45
Identity = 204/850 (24.00%), Postives = 353/850 (41.53%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNG---LASYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYK----GLLSEIES---EFCSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKL-EVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N    + +  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C   S+  E     N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + + DGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG G+++RRR C+      G   E ++   E C ++  N                   + F   C++  A  P G                G+ S D D L EV +     +  T+S   W+ W  W+ C   C     E+    RKR C           C G   E + CN   C
Sbjct:  159 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSGNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVAGRKVFMCGTNAFSPMCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNC---SRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVL--PPGRREPLRSLRILHSARA----LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLA-DPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGG-WAAWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQAC 961          
BLAST of Semaphorin-5A-like vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 179.489 bits (454), Expect = 2.360e-45
Identity = 204/850 (24.00%), Postives = 353/850 (41.53%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNG---LASYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYK----GLLSEIES---EFCSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKL-EVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N    + +  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C   S+  E     N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + + DGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG G+++RRR C+      G   E ++   E C ++  N                   + F   C++  A  P G                G+ S D D L EV +     +  T+S   W+ W  W+ C   C     E+    RKR C           C G   E + CN   C
Sbjct:  105 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSGNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVAGRKVFMCGTNAFSPMCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNC---SRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVL--PPGRREPLRSLRILHSARA----LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLA-DPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGG-WAAWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQAC 907          
BLAST of Semaphorin-5A-like vs. Ensembl Human
Match: SEMA5B (semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737])

HSP 1 Score: 179.489 bits (454), Expect = 2.360e-45
Identity = 204/850 (24.00%), Postives = 353/850 (41.53%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNG---LASYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYK----GLLSEIES---EFCSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKL-EVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N    + +  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C   S+  E     N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + + DGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG G+++RRR C+      G   E ++   E C ++  N                   + F   C++  A  P G                G+ S D D L EV +     +  T+S   W+ W  W+ C   C     E+    RKR C           C G   E + CN   C
Sbjct:  105 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSGNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVAGRKVFMCGTNAFSPMCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNC---SRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVL--PPGRREPLRSLRILHSARA----LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLA-DPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGG-WAAWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQAC 907          
BLAST of Semaphorin-5A-like vs. Ensembl Celegans
Match: smp-1 (Semaphorin-1A [Source:UniProtKB/Swiss-Prot;Acc:Q17330])

HSP 1 Score: 77.411 bits (189), Expect = 3.350e-14
Identity = 82/352 (23.30%), Postives = 147/352 (41.76%), Query Frame = 3
Query:  765 FVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIIC--PDKSKSLEDTSLNYIESGF-FDKDRQILFSTFSS--GEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAF-----------------TTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEEI--WTQIQVISIERS--SRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQ---LPELKQCSDG---DKIFD 1715
            FV  F     VYF  +E+A E     ++  + +R+ R+ KND GG+     E + ++LKA + C  P  S       L  +        +  ++++ FS+   ++  +A+C++SM  I   FD       +   S  +AF                 T   EN    + +    H L   P+ P++   L+ +  +    TQI V+   R+     YDI+F+ TS G++ K      + T+  S T+     P         + L+ +K      ++I  +D +  + + +C   ++   CV   DP C W+ +  +CV     T  Q  Q     + +QC +G    ++FD
Sbjct:  224 FVATFAYKEHVYFWFREIASEAIDNNEEPQIYARVARVCKNDKGGA-RPANERWTSYLKARLNCSLPSGSSPFYFNELKAVSDPIDAGNNNHVVYTVFSTPDSDVRMSAVCKFSMKKIREEFDNGTFKHQNNAQSMWMAFNRNEVPKPRPGSCSPDSTKLPENTVSFILH----HPLLHRPI-PSVAAPLLVEGADRADLTQITVLPRVRAVGGHNYDILFIGTSDGKVLKVVEVDGNATVIQSATVFQRGVPI--------VNLLTTKE----SVVIVSADEIASLPVHNCAQQTSCSKCVQLQDPHCAWDSSIARCVHGGSWTGDQFIQNMVFGQSEQCPEGIIVREVFD 557          
BLAST of Semaphorin-5A-like vs. Ensembl Celegans
Match: mab-20 (Semaphorin-2A [Source:UniProtKB/Swiss-Prot;Acc:Q95XP4])

HSP 1 Score: 58.5362 bits (140), Expect = 1.725e-8
Identity = 82/339 (24.19%), Postives = 147/339 (43.36%), Query Frame = 3
Query:  696 SENLKSLSTTIQSSWIQQNDYL---QFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIES-GFFDKDRQILF-STFSSGEIA--TTAICQYSMNDI----------ESAFDGPFVSTLDPRNSEPLAFTTCEENKF---DCLTYRASKHQL------KFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSC-VDPFCFWEQTTGKC 1631
            ++N K L  +I++ +   N +L   QFV  F+    V+F  +E+A  D+ F  ++ V SR+ R+ K D+GG    L++ + +F+KA + C   +        ++I+S    DK  +  F +TFS+ E A  ++AIC + ++ I          E   +G F  T D   +      TC +N     D   + A  H L         P+LP          + ++T I V  +   ++     F + ++   K  + K  ++   +   L    + +  A RI D+ L+ ++     F  +T   GV +  +  C    +   C +DP+C W     KC
Sbjct:   14 TKNGKQLHASIRTIY-SDNKWLNEPQFVGSFDVGQHVFFFFREIA-HDNSF-GERIVHSRVARVCKKDIGGRN-VLRQVWTSFVKARLNCSVSANF--PFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAICMFQLSSINHLLDTGLLMEETANGQFSVTADEIPAHRPG--TCSQNSHSISDTDLHFAKTHLLVSDSISGGTPILP--------LRDHVFTHIVVDQLP--NQNVIFAFDSANRRVWKISHWKEGNE---WKSNLIEEKSLKIAASRINDVALLPAE-----FFFVTSGAGVSQFSVARCSEQPSCALCSLDPYCSWNAVNSKC 326          
BLAST of Semaphorin-5A-like vs. Ensembl Celegans
Match: mab-20 (Semaphorin-2A [Source:UniProtKB/Swiss-Prot;Acc:Q95XP4])

HSP 1 Score: 58.5362 bits (140), Expect = 1.911e-8
Identity = 86/347 (24.78%), Postives = 149/347 (42.94%), Query Frame = 3
Query:  696 SENLKSLSTTIQSSWIQQNDYL---QFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY------IES-GFFDKDRQILF-STFSSGEIA--TTAICQYSMNDI----------ESAFDGPFVSTLDPRNSEPLAFTTCEENKF---DCLTYRASKHQL------KFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKF--YRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSC-VDPFCFWEQTTGKC 1631
            ++N K L  +I++ +   N +L   QFV  F+    V+F  +E+A  D+ F  ++ V SR+ R+ K D+GG    L++ + +F+KA + C          S N+      I+S    DK  +  F +TFS+ E A  ++AIC + ++ I          E   +G F  T D   +      TC +N     D   + A  H L         P+LP   ++ VF +         I +++   Q  I    ++  ++ K   +++  +      E  SL +     A RI D+ L+ ++     F  +T   GV +  +  C    +   C +DP+C W     KC
Sbjct:   71 TKNGKQLHASIRTIY-SDNKWLNEPQFVGSFDVGQHVFFFFREIA-HDNSF-GERIVHSRVARVCKKDIGGRN-VLRQVWTSFVKARLNC--------SVSANFPFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAICMFQLSSINHLLDTGLLMEETANGQFSVTADEIPAHRPG--TCSQNSHSISDTDLHFAKTHLLVSDSISGGTPILP--LRDHVFTH---------IVVDQLPNQNVIFAFDSANRRVWKISHWKEGNEWKSNLIEEKSLKI----AASRINDVALLPAE-----FFFVTSGAGVSQFSVARCSEQPSCALCSLDPYCSWNAVNSKC 383          
BLAST of Semaphorin-5A-like vs. Ensembl Celegans
Match: mab-20 (Semaphorin-2A [Source:UniProtKB/Swiss-Prot;Acc:Q95XP4])

HSP 1 Score: 58.151 bits (139), Expect = 2.716e-8
Identity = 82/339 (24.19%), Postives = 147/339 (43.36%), Query Frame = 3
Query:  696 SENLKSLSTTIQSSWIQQNDYL---QFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIES-GFFDKDRQILF-STFSSGEIA--TTAICQYSMNDI----------ESAFDGPFVSTLDPRNSEPLAFTTCEENKF---DCLTYRASKHQL------KFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSC-VDPFCFWEQTTGKC 1631
            ++N K L  +I++ +   N +L   QFV  F+    V+F  +E+A  D+ F  ++ V SR+ R+ K D+GG    L++ + +F+KA + C   +        ++I+S    DK  +  F +TFS+ E A  ++AIC + ++ I          E   +G F  T D   +      TC +N     D   + A  H L         P+LP          + ++T I V  +   ++     F + ++   K  + K  ++   +   L    + +  A RI D+ L+ ++     F  +T   GV +  +  C    +   C +DP+C W     KC
Sbjct:  191 TKNGKQLHASIRTIY-SDNKWLNEPQFVGSFDVGQHVFFFFREIA-HDNSF-GERIVHSRVARVCKKDIGGRN-VLRQVWTSFVKARLNCSVSANF--PFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAICMFQLSSINHLLDTGLLMEETANGQFSVTADEIPAHRPG--TCSQNSHSISDTDLHFAKTHLLVSDSISGGTPILP--------LRDHVFTHIVVDQLP--NQNVIFAFDSANRRVWKISHWKEGNE---WKSNLIEEKSLKIAASRINDVALLPAE-----FFFVTSGAGVSQFSVARCSEQPSCALCSLDPYCSWNAVNSKC 503          
BLAST of Semaphorin-5A-like vs. Ensembl Celegans
Match: adt-2 (A disintegrin and metalloproteinase with thrombospondin motifs adt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19204])

HSP 1 Score: 55.0694 bits (131), Expect = 3.126e-7
Identity = 79/309 (25.57%), Postives = 119/309 (38.51%), Query Frame = 3
Query: 1707 IFDSKWQQWSSWERCGKNENTC----QCRMRNCKF-GNCADSDNKEEV-EVKNCS----FHHQXXXXXXXXXXXXKCGKGNSTRQRFCFQNDY-----CPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFC--SQIELNKCFVNECKSIGAISPM----------GTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGF 2552
            ++  +W  WS W  C     TC    + R R C   G C  ++++ EV   ++C       ++WS+W  W+ CS  CG+G+  R R C          CP K++E++ C  DN      + +   W  WS C   CG G   R+R C           E C  S  E   C V  C++ G  S            G  +       + + C G  SE +   E +        A+ S + W  WS W++C   C    +      R R C+  N       C G   E   CN+  C   + +  G G+
Sbjct:  700 VYRGQWGTWSLWTSC---TATCGGGYRKRNRACSITGQCEGNEDETEVCSSESCPSVLRVGNEWSTWTEWNHCSVSCGRGSQARYRKCLSPHRTLAFDCPEKNIEVRSC--DNG-PCNAIGVWGTWGGWSTCSTSCGPGTLVRQRTCN---------REPCDGSAHERRSCNVATCQNDGIWSLWNEWSDCSRVCGKGLRSRSRSCFGSGCMGASSEQQFCNEQAC-------ASSSANDWGTWSGWSQCSVSCGAGVKR-----RTRTCRTGN-------CPGNYKESAICNDRDCENKNAAWGGWGY 974          

HSP 2 Score: 53.9138 bits (128), Expect = 5.665e-7
Identity = 55/209 (26.32%), Postives = 78/209 (37.32%), Query Frame = 3
Query: 1905 CGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLL-SEIESEFCSQIELNKCFVNECKSIGAIS----PMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            CG G   RQR C   + C G + E + C V       +  L   W+ WSDC   CG G+R+R R C   G + +  E +FC++        N+  +    S      G  V+         NC G   E      +  + D +N        W  W  W+ C   C D         RKRV +          C G   E++ CN  +C
Sbjct:  829 CGPGTLVRQRTC-NREPCDGSAHERRSCNVATCQNDGIWSL---WNEWSDCSRVCGKGLRSRSRSCFGSGCMGASSEQQFCNEQACASSSANDWGTWSGWSQCSVSCGAGVKRRTRTCRTGNCPGNYKES----AICNDRDCEN----KNAAWGGWGYWSSCSETCGDG-------VRKRVRKC----YGSGNCDGQQYEKQYCNLRVC 1014          

HSP 3 Score: 50.8322 bits (120), Expect = 6.265e-6
Identity = 49/145 (33.79%), Postives = 63/145 (43.45%), Query Frame = 3
Query: 1677 ELKQCSDGDKIFDSKWQQWSSWERCGKN-ENTCQCRMRNCKFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCK 2105
            E++ C +G       W  W  W  C  +       R R C    C  S + +    V  C     WS WN WS+CS  CGKG  +R R CF +  C G S E + C  +  C S+       WS WS C   CG GV+ R R C+
Sbjct:  801 EVRSCDNGPCNAIGVWGTWGGWSTCSTSCGPGTLVRQRTCNREPCDGSAHERRSCNVATCQNDGIWSLWNEWSDCSRVCGKGLRSRSRSCFGSG-CMGASSEQQFC-NEQACASSSANDWGTWSGWSQCSVSCGAGVKRRTRTCR 943          
BLAST of Semaphorin-5A-like vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0076052)

HSP 1 Score: 168.703 bits (426), Expect = 2.724e-42
Identity = 167/634 (26.34%), Postives = 270/634 (42.59%), Query Frame = 3
Query:  489 DHLLYICHSNGLASYYKIKTFEKTTISRSHC--------PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQSS--WIQQNDY-------LQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY---IESGFFDKDRQILFSTF--SSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTTCEENKFDCLT------YRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVY--------KVGIEHCVIHSTVDSC---VDPFCFWEQTTGKCVSIFQIT--VYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNE---NTCQCRMRNCKFGNCADSDNKEE---VEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSV------EIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLL-SEIESEFCSQIELNKCFVNECKSIGAIS 2204
            ++ LY C +N        +  E  T++            P+ +  S++ ++  ++VG                T F   ++  L T ++S+  +++   Y        QFV  FE  +FVYFLL+E A E       K + SR+ R+ KNDVGG G  L++N+ +FLKA + C     SL      Y   I+   + +   IL++TF  S   I  +A+C Y+++ I +AFDGPF    +  ++      T + ++F C T        +S++QL    V P   + L     E + ++ +  I   + Q  ++FVA+S   IKK   K   D +  C  E          +A       L+N          + VSD +Y        ++  +HC  H +  SC   +DP+C W +   +C+   Q +  +    Q P++  C   +   D  W  WS W  C ++E   + CQCR R+C            E    +V NC+ H  W+ W++WS CS  CG     R+R C      F    C G          + PC V      +V      W  WS+C  +CG G R RRR C     L   +E   C +++  +C +  C+ +  +S
Sbjct:  140 ENQLYACGTNAFQPSCSWRQMENLTVTGVDSGVVKCPFHPQANSTSLLQSNGQLFVGTA--------------TDFSGSDVAILRTGVESNKRFLRTKQYNNNWLSGAQFVGSFEAGHFVYFLLRESAAE--HMSCGKVIYSRVARVCKNDVGGGGQLLRDNWTSFLKARLNC-----SLPGEYPYYFDEIQGMTYAESESILYATFRTSGSSIFGSAVCAYNLSSINAAFDGPF-KQQEHSDAAWKTVNTNQRSQFQCGTSSIGHWLESSRYQLMDEAVQPIGAEPLYHSKLEQFGRLALDIINTKTEQVHVLFVASSGNHIKKLSVKYDGDGVQTCLVELW--------QADDTGTSSLLN-------MAYLKVSDSLYLGTDLALTRIPAQHCSRHVSQSSCLNSMDPYCGWNELVERCMPQPQDSSVLQHWHQAPQIT-CPVLNAPIDGGWSTWSPWAVCQQHEQPDSNCQCRQRSCNNPQPQHGGATCEGISTQVTNCTQHGGWTEWSAWSPCSQTCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAK--PQSVDGGWGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGC-RLDYEECNMQSCQEVRKLS 732          
BLAST of Semaphorin-5A-like vs. Ensembl Fly
Match: Sema5c (gene:FBgn0284221 transcript:FBtr0300339)

HSP 1 Score: 168.318 bits (425), Expect = 2.988e-42
Identity = 167/634 (26.34%), Postives = 270/634 (42.59%), Query Frame = 3
Query:  489 DHLLYICHSNGLASYYKIKTFEKTTISRSHC--------PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQSS--WIQQNDY-------LQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY---IESGFFDKDRQILFSTF--SSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTTCEENKFDCLT------YRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVY--------KVGIEHCVIHSTVDSC---VDPFCFWEQTTGKCVSIFQIT--VYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNE---NTCQCRMRNCKFGNCADSDNKEE---VEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSV------EIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLL-SEIESEFCSQIELNKCFVNECKSIGAIS 2204
            ++ LY C +N        +  E  T++            P+ +  S++ ++  ++VG                T F   ++  L T ++S+  +++   Y        QFV  FE  +FVYFLL+E A E       K + SR+ R+ KNDVGG G  L++N+ +FLKA + C     SL      Y   I+   + +   IL++TF  S   I  +A+C Y+++ I +AFDGPF    +  ++      T + ++F C T        +S++QL    V P   + L     E + ++ +  I   + Q  ++FVA+S   IKK   K   D +  C  E          +A       L+N          + VSD +Y        ++  +HC  H +  SC   +DP+C W +   +C+   Q +  +    Q P++  C   +   D  W  WS W  C ++E   + CQCR R+C            E    +V NC+ H  W+ W++WS CS  CG     R+R C      F    C G          + PC V      +V      W  WS+C  +CG G R RRR C     L   +E   C +++  +C +  C+ +  +S
Sbjct:  138 ENQLYACGTNAFQPSCSWRQMENLTVTGVDSGVVKCPFHPQANSTSLLQSNGQLFVGTA--------------TDFSGSDVAILRTGVESNKRFLRTKQYNNNWLSGAQFVGSFEAGHFVYFLLRESAAE--HMSCGKVIYSRVARVCKNDVGGGGQLLRDNWTSFLKARLNC-----SLPGEYPYYFDEIQGMTYAESESILYATFRTSGSSIFGSAVCAYNLSSINAAFDGPF-KQQEHSDAAWKTVNTNQRSQFQCGTSSIGHWLESSRYQLMDEAVQPIGAEPLYHSKLEQFGRLALDIINTKTEQVHVLFVASSGNHIKKLSVKYDGDGVQTCLVELW--------QADDTGTSSLLN-------MAYLKVSDSLYLGTDLALTRIPAQHCSRHVSQSSCLNSMDPYCGWNELVERCMPQPQDSSVLQHWHQAPQIT-CPVLNAPIDGGWSTWSPWAVCQQHEQPDSNCQCRQRSCNNPQPQHGGATCEGISTQVTNCTQHGGWTEWSAWSPCSQTCGIAVKIRRRTCGNPRPAFGGRTCVGSEQSEMYCRHLPPCPVAK--PQSVDGGWGPWGEWSECSAQCGGGFRMRRRECNDPAPLNGGMECPGC-RLDYEECNMQSCQEVRKLS 730          
BLAST of Semaphorin-5A-like vs. Ensembl Fly
Match: Sema2b (gene:FBgn0264273 transcript:FBtr0290009)

HSP 1 Score: 84.7297 bits (208), Expect = 2.615e-16
Identity = 93/341 (27.27%), Postives = 149/341 (43.70%), Query Frame = 3
Query:  753 DYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGF-FDKDRQILFSTFSSGE--IATTAICQYSMNDIESAFDGPF----------VSTLDPRNSEPLAFTTCEENKF---DCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQV--ISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPR---ITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV----DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDG 1700
            D   FV  FE   FVYF  +E A E       K V SR+ R+ KND GG  Y + +N+ T+LKA + C   S+       N I+S +    D    ++TF++    +  +A+C Y + DI +AFDG F          +  L+ +  EP    TC  +     D +     KH L    V       + F+ + I T++ V  I I++ ++++ + FVAT+ G I K  +      + Y +  S L++  + +P    I +M L +        L +     V ++ I  C      DSC     DP+C W++    C        YQL  L ++   + G
Sbjct:  306 DKPNFVGSFEIGEFVYFFFREHAVE--YINCGKAVYSRVARVCKNDRGGK-YMISQNWATYLKARMNCSISSEF--PFYFNEIQSVYKMPTDDTKFYATFTTNTNGLIGSAVCSYDIRDINAAFDGKFKEQATSNSAWLPVLNSKVPEPRP-GTCHNDTATLPDSVLNFIRKHPLMDKAVDHEFGNPVFFKRDVILTKLVVDKIRIDKLNQEFLVYFVATTSGHIYKIVQ-----FMHYGQRHSNLVDIFEASPHSEPIREMTLSHKTG----SLYVATDHQVKQIDIAMCA--RRYDSCFRCVSDPYCGWDKDVNACRP------YQLGLLQDVANETSG 623          
BLAST of Semaphorin-5A-like vs. Ensembl Fly
Match: Sema2b (gene:FBgn0264273 transcript:FBtr0329991)

HSP 1 Score: 84.7297 bits (208), Expect = 2.635e-16
Identity = 93/341 (27.27%), Postives = 149/341 (43.70%), Query Frame = 3
Query:  753 DYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGF-FDKDRQILFSTFSSGE--IATTAICQYSMNDIESAFDGPF----------VSTLDPRNSEPLAFTTCEENKF---DCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQV--ISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPR---ITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV----DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDG 1700
            D   FV  FE   FVYF  +E A E       K V SR+ R+ KND GG  Y + +N+ T+LKA + C   S+       N I+S +    D    ++TF++    +  +A+C Y + DI +AFDG F          +  L+ +  EP    TC  +     D +     KH L    V       + F+ + I T++ V  I I++ ++++ + FVAT+ G I K  +      + Y +  S L++  + +P    I +M L +        L +     V ++ I  C      DSC     DP+C W++    C        YQL  L ++   + G
Sbjct:  305 DKPNFVGSFEIGEFVYFFFREHAVE--YINCGKAVYSRVARVCKNDRGGK-YMISQNWATYLKARMNCSISSEF--PFYFNEIQSVYKMPTDDTKFYATFTTNTNGLIGSAVCSYDIRDINAAFDGKFKEQATSNSAWLPVLNSKVPEPRP-GTCHNDTATLPDSVLNFIRKHPLMDKAVDHEFGNPVFFKRDVILTKLVVDKIRIDKLNQEFLVYFVATTSGHIYKIVQ-----FMHYGQRHSNLVDIFEASPHSEPIREMTLSHKTG----SLYVATDHQVKQIDIAMCA--RRYDSCFRCVSDPYCGWDKDVNACRP------YQLGLLQDVANETSG 622          
BLAST of Semaphorin-5A-like vs. Ensembl Fly
Match: Sema2b (gene:FBgn0264273 transcript:FBtr0100001)

HSP 1 Score: 84.7297 bits (208), Expect = 2.635e-16
Identity = 93/341 (27.27%), Postives = 149/341 (43.70%), Query Frame = 3
Query:  753 DYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGF-FDKDRQILFSTFSSGE--IATTAICQYSMNDIESAFDGPF----------VSTLDPRNSEPLAFTTCEENKF---DCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQV--ISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPR---ITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV----DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDG 1700
            D   FV  FE   FVYF  +E A E       K V SR+ R+ KND GG  Y + +N+ T+LKA + C   S+       N I+S +    D    ++TF++    +  +A+C Y + DI +AFDG F          +  L+ +  EP    TC  +     D +     KH L    V       + F+ + I T++ V  I I++ ++++ + FVAT+ G I K  +      + Y +  S L++  + +P    I +M L +        L +     V ++ I  C      DSC     DP+C W++    C        YQL  L ++   + G
Sbjct:  305 DKPNFVGSFEIGEFVYFFFREHAVE--YINCGKAVYSRVARVCKNDRGGK-YMISQNWATYLKARMNCSISSEF--PFYFNEIQSVYKMPTDDTKFYATFTTNTNGLIGSAVCSYDIRDINAAFDGKFKEQATSNSAWLPVLNSKVPEPRP-GTCHNDTATLPDSVLNFIRKHPLMDKAVDHEFGNPVFFKRDVILTKLVVDKIRIDKLNQEFLVYFVATTSGHIYKIVQ-----FMHYGQRHSNLVDIFEASPHSEPIREMTLSHKTG----SLYVATDHQVKQIDIAMCA--RRYDSCFRCVSDPYCGWDKDVNACRP------YQLGLLQDVANETSG 622          
BLAST of Semaphorin-5A-like vs. Ensembl Zebrafish
Match: sema5bb (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Bb [Source:ZFIN;Acc:ZDB-GENE-130530-778])

HSP 1 Score: 166.777 bits (421), Expect = 1.224e-41
Identity = 185/718 (25.77%), Postives = 308/718 (42.90%), Query Frame = 3
Query:  582 PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY--IESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQIT-VYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC-----GKNENTCQCRMRNCKFGNCADSDNK---EEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTL----VEELGP-----VNYFANCQGTKSEDED------KLEVSVEYDVKNYATISED-------------------VWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            P+++  ++++    +Y      A  +  F    P  + S  N+  L T    S W+  ND   F+  +E + F Y  L+E A E D     KTV SR+ R+ +ND+GG  + L++ + TF+KA + C   S+S  D    Y  ++S F+  ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR S      P+    C    +      LT R    A +  L  + V P     LV Q+   ++++ V  ++     Y ++++ T  G I K      + +L  CY E +++L  P +K   I ++++++S       L + +   V K+ +E C  + T   C+   DP+C W++   +C +I   + + Q  Q  ++ +C + +   D  +  WS+W+ C     G+  +TCQCR R C          K     +EV NCS +  W+ W+SW+ECS+ CG G   RQR C           C G++ E + C   N C   V      WS WS C   CG GV++R R C+               +E   C ++ C  +   +P        V +LG      V Y   C+   ++  D      K+E  +       A    D                    W+ W  W+ C   CS         TRKR C   +       C G  +E + CN   C
Sbjct:  181 PRHNSTAMITESGEVY------AATVTDFSSRDPIIYRSLGNMPPLRTAQYNSKWL--ND-PHFISAYEVSRFTYVFLRENAVEQDC---GKTVFSRVARVCQNDIGGR-FLLEDTWTTFMKARLNC---SRS-GDVPFYYHELQSTFYLPEQDLIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRTSWLSTPNPVPNFQCGTVNDSGPGANLTERSLQDAQRLFLMSDVVQPISTDPLVMQDNIRFSKLAVDIVQGRDTLYHVMYIGTEYGTIIKAL-STNNKSLRGCYLEEMNIL--PGNKQEPILNLQILHSDRS----LFVGLPSRVLKIPLERCSNYITEQDCLGARDPYCGWDRKEKRCTTIEDSSNMSQWSQ--DITKCPERNLTQDGGFSDWSTWQACNHDDGGEGISTCQCRTRACDHPRPQCGGLKCVGANIEVANCSRNGGWTPWSSWAECSTSCGIGFEVRQRSCNNPSPRHGGRVCVGQAREERLCNEKNPCP--VPMSWVSWSAWSKCSVACGGGVQSRVRTCENGNTCPGCP------LEYRACNLDSCAEVRRTTPWTPWYPVNVTQLGARQEQRVRY--TCRALLADPHDLQLGKRKIETRLCPTTDGAAACETDGLVEDLLRMGRPVTRVQGAAWALWETWSTCSKECSKGFR-----TRKRSCAAPDGKSTPFACSGAPVEYQDCNTQPC 857          
BLAST of Semaphorin-5A-like vs. Ensembl Zebrafish
Match: sema5bb (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Bb [Source:ZFIN;Acc:ZDB-GENE-130530-778])

HSP 1 Score: 166.777 bits (421), Expect = 1.256e-41
Identity = 185/718 (25.77%), Postives = 308/718 (42.90%), Query Frame = 3
Query:  582 PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY--IESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQIT-VYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC-----GKNENTCQCRMRNCKFGNCADSDNK---EEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTL----VEELGP-----VNYFANCQGTKSEDED------KLEVSVEYDVKNYATISED-------------------VWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            P+++  ++++    +Y      A  +  F    P  + S  N+  L T    S W+  ND   F+  +E + F Y  L+E A E D     KTV SR+ R+ +ND+GG  + L++ + TF+KA + C   S+S  D    Y  ++S F+  ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR S      P+    C    +      LT R    A +  L  + V P     LV Q+   ++++ V  ++     Y ++++ T  G I K      + +L  CY E +++L  P +K   I ++++++S       L + +   V K+ +E C  + T   C+   DP+C W++   +C +I   + + Q  Q  ++ +C + +   D  +  WS+W+ C     G+  +TCQCR R C          K     +EV NCS +  W+ W+SW+ECS+ CG G   RQR C           C G++ E + C   N C   V      WS WS C   CG GV++R R C+               +E   C ++ C  +   +P        V +LG      V Y   C+   ++  D      K+E  +       A    D                    W+ W  W+ C   CS         TRKR C   +       C G  +E + CN   C
Sbjct:  181 PRHNSTAMITESGEVY------AATVTDFSSRDPIIYRSLGNMPPLRTAQYNSKWL--ND-PHFISAYEVSRFTYVFLRENAVEQDC---GKTVFSRVARVCQNDIGGR-FLLEDTWTTFMKARLNC---SRS-GDVPFYYHELQSTFYLPEQDLIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRTSWLSTPNPVPNFQCGTVNDSGPGANLTERSLQDAQRLFLMSDVVQPISTDPLVMQDNIRFSKLAVDIVQGRDTLYHVMYIGTEYGTIIKAL-STNNKSLRGCYLEEMNIL--PGNKQEPILNLQILHSDRS----LFVGLPSRVLKIPLERCSNYITEQDCLGARDPYCGWDRKEKRCTTIEDSSNMSQWSQ--DITKCPERNLTQDGGFSDWSTWQACNHDDGGEGISTCQCRTRACDHPRPQCGGLKCVGANIEVANCSRNGGWTPWSSWAECSTSCGIGFEVRQRSCNNPSPRHGGRVCVGQAREERLCNEKNPCP--VPMSWVSWSAWSKCSVACGGGVQSRVRTCENGNTCPGCP------LEYRACNLDSCAEVRRTTPWTPWYPVNVTQLGARQEQRVRY--TCRALLADPHDLQLGKRKIETRLCPTTDGAAACETDGLVEDLLRMGRPVTRVQGAAWALWETWSTCSKECSKGFR-----TRKRSCAAPDGKSTPFACSGAPVEYQDCNTQPC 857          
BLAST of Semaphorin-5A-like vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 159.458 bits (402), Expect = 2.494e-39
Identity = 180/710 (25.35%), Postives = 303/710 (42.68%), Query Frame = 3
Query:  582 PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKF--GNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISP----MGTLVEELGP-----VNYFANCQGTKSED----EDKLE---------VSVEYDV-------KNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            P+++  +VV+    +Y      A  ++ F    P  + S        T Q  S W+ +     F+  ++   F +F L+E A E D     KTV SR+ R+ KND+GG  + L++ + TF KA + C   S+S E     N ++S F+  ++ +++  F++    IA +A+C Y+++ I  AF+GPF S  +PR++      P+    C    EE   + LT R    A +  L  + V P     LV+Q++  ++++ V  ++     + ++++ T  G I K     T+ +L  CY E + L   P      I  +++++        L + ++D V K+ +  C  + T   C+   DP+C W++   +C +I + +    +    +  C   ++  D  +  W+ W+ C    G+  +TC CR R C      C   +     +EV NCS +  W+ W+SW +CS+ C  G   RQR C           C G+S E + C     C   +    + WS WS C   CG GV +R R C+            C+ +E   C +  C  +   +P    M   + + G      V Y    Q     +    + K+E         V+ E D             +S   WS W  W+ C   C+         TRKR C   +       CRG  +E + CN   C
Sbjct:  187 PRHNSTAVVTESGELY------AATVIDFSGRDPVIYRSLGGMPPLRTAQYNSKWLNEP---HFISAYDVGLFTFFFLRENAVEHDC---GKTVYSRVARVCKNDIGGR-FLLEDTWTTFTKARLNC---SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITQAFNGPFRSQENPRSTWLPTPNPIPNFQCGTIDEEGPNERLTERSLQDAQRLFLMNDVVQPVSVDPLVWQDDVRFSKLVVDIVQGQDSLHHVMYIGTEYGTILKAL-ATTNKSLQGCYLEEMQLF--PPGLQQPILSLQILHGDR----TLFVGLNDKVLKIPLARCSSYKTELMCLDARDPYCGWDRKQRRCTTI-EDSSNMSQWFQNITACPLRNQTTDGAYGPWAPWQPCSHDDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCSRNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPI--FWSSWSPWSKCSADCGGGVHSRSRNCENGN-----SCPGCA-LEYQACNLESCPEVRRNTPWTPWMPVNITQGGARQEQRVRYICRAQLADPHELQLGKRKVETRFCPNDGMVTCETDSLVEELLRMPGVRLSGTGWSSWEMWSACTQECAKGYR-----TRKRSCTNTDGKNIPTACRGSPVEYQDCNPQPC 859          
BLAST of Semaphorin-5A-like vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 159.458 bits (402), Expect = 2.494e-39
Identity = 180/710 (25.35%), Postives = 303/710 (42.68%), Query Frame = 3
Query:  582 PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKF--GNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISP----MGTLVEELGP-----VNYFANCQGTKSED----EDKLE---------VSVEYDV-------KNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            P+++  +VV+    +Y      A  ++ F    P  + S        T Q  S W+ +     F+  ++   F +F L+E A E D     KTV SR+ R+ KND+GG  + L++ + TF KA + C   S+S E     N ++S F+  ++ +++  F++    IA +A+C Y+++ I  AF+GPF S  +PR++      P+    C    EE   + LT R    A +  L  + V P     LV+Q++  ++++ V  ++     + ++++ T  G I K     T+ +L  CY E + L   P      I  +++++        L + ++D V K+ +  C  + T   C+   DP+C W++   +C +I + +    +    +  C   ++  D  +  W+ W+ C    G+  +TC CR R C      C   +     +EV NCS +  W+ W+SW +CS+ C  G   RQR C           C G+S E + C     C   +    + WS WS C   CG GV +R R C+            C+ +E   C +  C  +   +P    M   + + G      V Y    Q     +    + K+E         V+ E D             +S   WS W  W+ C   C+         TRKR C   +       CRG  +E + CN   C
Sbjct:  187 PRHNSTAVVTESGELY------AATVIDFSGRDPVIYRSLGGMPPLRTAQYNSKWLNEP---HFISAYDVGLFTFFFLRENAVEHDC---GKTVYSRVARVCKNDIGGR-FLLEDTWTTFTKARLNC---SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITQAFNGPFRSQENPRSTWLPTPNPIPNFQCGTIDEEGPNERLTERSLQDAQRLFLMNDVVQPVSVDPLVWQDDVRFSKLVVDIVQGQDSLHHVMYIGTEYGTILKAL-ATTNKSLQGCYLEEMQLF--PPGLQQPILSLQILHGDR----TLFVGLNDKVLKIPLARCSSYKTELMCLDARDPYCGWDRKQRRCTTI-EDSSNMSQWFQNITACPLRNQTTDGAYGPWAPWQPCSHDDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCSRNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPI--FWSSWSPWSKCSADCGGGVHSRSRNCENGN-----SCPGCA-LEYQACNLESCPEVRRNTPWTPWMPVNITQGGARQEQRVRYICRAQLADPHELQLGKRKVETRFCPNDGMVTCETDSLVEELLRMPGVRLSGTGWSSWEMWSACTQECAKGYR-----TRKRSCTNTDGKNIPTACRGSPVEYQDCNPQPC 859          
BLAST of Semaphorin-5A-like vs. Ensembl Zebrafish
Match: sema5ba (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Ba [Source:ZFIN;Acc:ZDB-GENE-070912-187])

HSP 1 Score: 159.458 bits (402), Expect = 2.494e-39
Identity = 180/710 (25.35%), Postives = 303/710 (42.68%), Query Frame = 3
Query:  582 PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKF--GNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISP----MGTLVEELGP-----VNYFANCQGTKSED----EDKLE---------VSVEYDV-------KNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            P+++  +VV+    +Y      A  ++ F    P  + S        T Q  S W+ +     F+  ++   F +F L+E A E D     KTV SR+ R+ KND+GG  + L++ + TF KA + C   S+S E     N ++S F+  ++ +++  F++    IA +A+C Y+++ I  AF+GPF S  +PR++      P+    C    EE   + LT R    A +  L  + V P     LV+Q++  ++++ V  ++     + ++++ T  G I K     T+ +L  CY E + L   P      I  +++++        L + ++D V K+ +  C  + T   C+   DP+C W++   +C +I + +    +    +  C   ++  D  +  W+ W+ C    G+  +TC CR R C      C   +     +EV NCS +  W+ W+SW +CS+ C  G   RQR C           C G+S E + C     C   +    + WS WS C   CG GV +R R C+            C+ +E   C +  C  +   +P    M   + + G      V Y    Q     +    + K+E         V+ E D             +S   WS W  W+ C   C+         TRKR C   +       CRG  +E + CN   C
Sbjct:  187 PRHNSTAVVTESGELY------AATVIDFSGRDPVIYRSLGGMPPLRTAQYNSKWLNEP---HFISAYDVGLFTFFFLRENAVEHDC---GKTVYSRVARVCKNDIGGR-FLLEDTWTTFTKARLNC---SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAYNLSAITQAFNGPFRSQENPRSTWLPTPNPIPNFQCGTIDEEGPNERLTERSLQDAQRLFLMNDVVQPVSVDPLVWQDDVRFSKLVVDIVQGQDSLHHVMYIGTEYGTILKAL-ATTNKSLQGCYLEEMQLF--PPGLQQPILSLQILHGDR----TLFVGLNDKVLKIPLARCSSYKTELMCLDARDPYCGWDRKQRRCTTI-EDSSNMSQWFQNITACPLRNQTTDGAYGPWAPWQPCSHDDGEGTSTCLCRSRVCNSPPPRCGGKNCQGPTIEVSNCSRNGGWTPWSSWGQCSTSCEIGFEVRQRSCNNPSPRHGGRVCVGQSREQRFCNEKVSCPQPI--FWSSWSPWSKCSADCGGGVHSRSRNCENGN-----SCPGCA-LEYQACNLESCPEVRRNTPWTPWMPVNITQGGARQEQRVRYICRAQLADPHELQLGKRKVETRFCPNDGMVTCETDSLVEELLRMPGVRLSGTGWSSWEMWSACTQECAKGYR-----TRKRSCTNTDGKNIPTACRGSPVEYQDCNPQPC 859          
BLAST of Semaphorin-5A-like vs. Ensembl Xenopus
Match: micall2 (MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747])

HSP 1 Score: 94.7449 bits (234), Expect = 2.983e-19
Identity = 89/320 (27.81%), Postives = 143/320 (44.69%), Query Frame = 3
Query:  783 NNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF---DKDRQILFS---TFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFT---------TCEENKF------------DCLTYRASKHQLKFNPVLPNLKKNLVFQ--NEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHST--VDSCV--DPFCFWEQTTGKCVSIF 1643
            N+  VYF LKE     D     K + S I R+  ND+GG   +L   + TFLKA ++C        +T  + +E  F    D  R  L     T SS     +A+C Y M+DI++ F+GPF     P N + + +          TC    F            D +T+    H L FN + P LK+ L+ +   +  +T+I V  +  +  +Y ++F+ T KG ++K      + +      L  +   +  AP IT MK+ + K      L ++  +G+ ++ +  C I+ T   D C+  DP+C W+   GK  S F
Sbjct:  231 NDAKVYFFLKERLT--DNSGSTKQIHSMIARVCPNDIGGQ-RSLVNKWTTFLKARLVCSVMDDDGTETYFDELEDVFLMETDNPRTTLVYGIFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKEGP-NHQLIPYQGRIPYPRPGTCPGGAFTPNMKSTKEFPDDVVTF-IRNHPLMFNSIYPTLKRPLLIRTGTDYKFTKIVVDRVNAADGKYHVLFLGTDKGTVQKVVVVPANGSASGELILEEMEVFKSHAP-ITSMKISSKKQ----QLYVSSEEGITQLSLHRCHIYGTACADCCLARDPYCAWD---GKFCSRF 537          
BLAST of Semaphorin-5A-like vs. Ensembl Xenopus
Match: micall2 (MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747])

HSP 1 Score: 94.3597 bits (233), Expect = 3.855e-19
Identity = 89/320 (27.81%), Postives = 143/320 (44.69%), Query Frame = 3
Query:  783 NNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF---DKDRQILFS---TFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFT---------TCEENKF------------DCLTYRASKHQLKFNPVLPNLKKNLVFQ--NEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHST--VDSCV--DPFCFWEQTTGKCVSIF 1643
            N+  VYF LKE     D     K + S I R+  ND+GG   +L   + TFLKA ++C        +T  + +E  F    D  R  L     T SS     +A+C Y M+DI++ F+GPF     P N + + +          TC    F            D +T+    H L FN + P LK+ L+ +   +  +T+I V  +  +  +Y ++F+ T KG ++K      + +      L  +   +  AP IT MK+ + K      L ++  +G+ ++ +  C I+ T   D C+  DP+C W+   GK  S F
Sbjct:  219 NDAKVYFFLKERLT--DNSGSTKQIHSMIARVCPNDIGGQ-RSLVNKWTTFLKARLVCSVMDDDGTETYFDELEDVFLMETDNPRTTLVYGIFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKEGP-NHQLIPYQGRIPYPRPGTCPGGAFTPNMKSTKEFPDDVVTF-IRNHPLMFNSIYPTLKRPLLIRTGTDYKFTKIVVDRVNAADGKYHVLFLGTDKGTVQKVVVVPANGSASGELILEEMEVFKSHAP-ITSMKISSKKQ----QLYVSSEEGITQLSLHRCHIYGTACADCCLARDPYCAWD---GKFCSRF 525          
BLAST of Semaphorin-5A-like vs. Ensembl Xenopus
Match: micall2 (MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747])

HSP 1 Score: 94.3597 bits (233), Expect = 4.327e-19
Identity = 85/310 (27.42%), Postives = 139/310 (44.84%), Query Frame = 3
Query:  783 NNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF---DKDRQIL---FSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFT---------TCEENKF------------DCLTYRASKHQLKFNPVLPNLKKNLVFQ--NEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHST--VDSCV--DPFCFWE 1613
            N+  VYF LKE     D     K + S I R+  ND+GG   +L   + TFLKA ++C        +T  + +E  F    D  R  L     T SS     +A+C Y M+DI++ F+GPF     P N + + +          TC    F            D +T+    H L FN + P LK+ L+ +   +  +T+I V  +  +  +Y ++F+ T KG ++K      + +      L  +   +  AP IT MK+ + K      L ++  +G+ ++ +  C I+ T   D C+  DP+C W+
Sbjct:  232 NDAKVYFFLKERLT--DNSGSTKQIHSMIARVCPNDIGGQ-RSLVNKWTTFLKARLVCSVMDDDGTETYFDELEDVFLMETDNPRTTLVYGIFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKEGP-NHQLIPYQGRIPYPRPGTCPGGAFTPNMKSTKEFPDDVVTF-IRNHPLMFNSIYPTLKRPLLIRTGTDYKFTKIVVDRVNAADGKYHVLFLGTDKGTVQKVVVVPANGSASGELILEEMEVFKSHAP-ITSMKISSKKQ----QLYVSSEEGITQLSLHRCHIYGTACADCCLARDPYCAWD 531          
BLAST of Semaphorin-5A-like vs. Ensembl Xenopus
Match: micall2 (MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747])

HSP 1 Score: 94.3597 bits (233), Expect = 4.730e-19
Identity = 85/310 (27.42%), Postives = 139/310 (44.84%), Query Frame = 3
Query:  783 NNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF---DKDRQILFS---TFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAF---------TTCEENKF------------DCLTYRASKHQLKFNPVLPNLKKNLVFQ--NEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHST--VDSCV--DPFCFWE 1613
            N+  VYF LKE     D     K + S I R+  ND+GG   +L   + TFLKA ++C        +T  + +E  F    D  R  L     T SS     +A+C Y M+DI++ F+GPF     P N + + +          TC    F            D +T+    H L FN + P LK+ L+ +   +  +T+I V  +  +  +Y ++F+ T KG ++K      + +      L  +   +  AP IT MK+ + K      L ++  +G+ ++ +  C I+ T   D C+  DP+C W+
Sbjct:  234 NDAKVYFFLKERLT--DNSGSTKQIHSMIARVCPNDIGGQ-RSLVNKWTTFLKARLVCSVMDDDGTETYFDELEDVFLMETDNPRTTLVYGIFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKEGP-NHQLIPYQGRIPYPRPGTCPGGAFTPNMKSTKEFPDDVVTF-IRNHPLMFNSIYPTLKRPLLIRTGTDYKFTKIVVDRVNAADGKYHVLFLGTDKGTVQKVVVVPANGSASGELILEEMEVFKSHAP-ITSMKISSKKQ----QLYVSSEEGITQLSLHRCHIYGTACADCCLARDPYCAWD 533          
BLAST of Semaphorin-5A-like vs. Ensembl Xenopus
Match: micall2 (MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747])

HSP 1 Score: 94.3597 bits (233), Expect = 4.843e-19
Identity = 89/320 (27.81%), Postives = 143/320 (44.69%), Query Frame = 3
Query:  783 NNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF---DKDRQIL---FSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFT---------TCEENKF------------DCLTYRASKHQLKFNPVLPNLKKNLVFQ--NEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHST--VDSCV--DPFCFWEQTTGKCVSIF 1643
            N+  VYF LKE     D     K + S I R+  ND+GG   +L   + TFLKA ++C        +T  + +E  F    D  R  L     T SS     +A+C Y M+DI++ F+GPF     P N + + +          TC    F            D +T+    H L FN + P LK+ L+ +   +  +T+I V  +  +  +Y ++F+ T KG ++K      + +      L  +   +  AP IT MK+ + K      L ++  +G+ ++ +  C I+ T   D C+  DP+C W+   GK  S F
Sbjct:  227 NDAKVYFFLKERLT--DNSGSTKQIHSMIARVCPNDIGGQ-RSLVNKWTTFLKARLVCSVMDDDGTETYFDELEDVFLMETDNPRTTLVYGIFTTSSSVFKGSAVCVYHMSDIQTVFNGPFAHKEGP-NHQLIPYQGRIPYPRPGTCPGGAFTPNMKSTKEFPDDVVTF-IRNHPLMFNSIYPTLKRPLLIRTGTDYKFTKIVVDRVNAADGKYHVLFLGTDKGTVQKVVVVPANGSASGELILEEMEVFKSHAP-ITSMKISSKKQ----QLYVSSEEGITQLSLHRCHIYGTACADCCLARDPYCAWD---GKFCSRF 533          
BLAST of Semaphorin-5A-like vs. Ensembl Mouse
Match: Sema5b (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B [Source:MGI Symbol;Acc:MGI:107555])

HSP 1 Score: 172.94 bits (437), Expect = 1.492e-43
Identity = 201/851 (23.62%), Postives = 351/851 (41.25%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLA---SYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL-CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEF-------CSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDV---WSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            ++ F DL    P+V N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N  +   S  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  F+   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C    +       N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + +SD V +V +E C  + +  +C+   DP+C W+     C ++   +   L  +  +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   +     + + NCS +  W++W+SW++CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG GV++RRR C+          EF       C ++  N                   + F   C++     P G    +           GT + D D L   VE  +++ +T    +   W+ W  W+ C   C     E+    RKR C           C G   E + CN   C
Sbjct:   47 IVAFEDL---KPWVFN-----FTYPGVRDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVSGRKVFMCGTNAFSPVCSSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAFDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVL--PPGRLEPLRSLRILHSARA----LFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSL-WIQNITTCPVRNVTRDGGFGPWSPWKPCEHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCSRNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSNNCGGGVQSRRRSCENGNSCPGCGVEFKTCNPEACPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAP-LPDPHGLQFGKRRTETRTCPADGTGACDTDAL---VEDLLRSGSTSPHTLNGGWATWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQAC 849          
BLAST of Semaphorin-5A-like vs. Ensembl Mouse
Match: Sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:MGI Symbol;Acc:MGI:107556])

HSP 1 Score: 166.007 bits (419), Expect = 2.664e-41
Identity = 193/833 (23.17%), Postives = 330/833 (39.62%), Query Frame = 3
Query:  240 YRPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT--------ISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQ-ITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNY-----------------------------------FANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCN 2504
            +R  + V F   + + P   +L++   N + +  + +++ +  +E    +A       K   +  C  +    ++L     V    L+ C +N       I++    T        ++R  + P+++  ++++A   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     KTV SR  R+ KND+GG  + L++ + TF+KA + C    +       N ++  FF  +  +++  F++    IA +A+C ++++ I  AF+GPF    + R       N  P     T ++  +  LT R    A K  L    V P        ++   ++ + V  ++       I+++AT  G IKK    ++  +  C  E + L   P  ++  I  +++++S    Q  L + + + V K+ ++ C  H T  +C+   DP+C W+    KC S+ + +++ Q  Q   +  C   +   D  +  WS W  C    G    +C CR R+C      C         +E+ NCS +  W+ W SWS CS+ CG G   RQR C           C G++ E + C     C   V      W  W  C  +CG G++ RRR C+     +  +   C+ +E   C  N C  +   +P         PVN                                    + +  GT     D L        +  A      WS W+ W++C   CS          RKRVC           C G  LE + CN
Sbjct:   50 FRAENAVDF-SRLTFDPGQKELVVGARNYLFRLELEDLSLIQAVEWECDEATKKACYSKGKSKEECQNY---IRVL----LVGGDRLFTCGTNAFTPVCTIRSLSNLTEIHDQISGMARCPYSPQHNSTALLTASGELY------AATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPN---FVSSYDIGNFTYFFFRENAVEHDC---GKTVFSRAARVCKNDIGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQGTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHLAVDVVQGRETLVHIIYLATDYGTIKKVRAPLSQSSGSCLLEEIELF--PERRSEPIRSLQILHS----QSVLFVGLQEHVAKIPLKRCHFHQTRSACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQ--SIPTCPTRNLTVDGSFGPWSPWTPCTHTDGTAVGSCLCRSRSCDSPAPQCGGWQCEGPRMEITNCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVF--WTGWGPWERCTAQCGGGIQARRRTCE-----NGPDCAGCN-VEYQPCNTNACPELKKTTPWTPWT----PVNISDNGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIR-----NRKRVCNNPEPKFGGMPCLGPSLEFQECN 834          
BLAST of Semaphorin-5A-like vs. Ensembl Mouse
Match: Sema5b (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5B [Source:MGI Symbol;Acc:MGI:107555])

HSP 1 Score: 165.622 bits (418), Expect = 3.505e-41
Identity = 169/685 (24.67%), Postives = 303/685 (44.23%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLA---SYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL-CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCK 2105
            ++ F DL    P+V N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N  +   S  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  F+   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C    +       N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + +SD V +V +E C  + +  +C+   DP+C W+     C ++   +   L  +  +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   +     + + NCS +  W++W+SW++CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG GV++RRR C+
Sbjct:   47 IVAFEDL---KPWVFN-----FTYPGVRDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVSGRKVFMCGTNAFSPVCSSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAFDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVL--PPGRLEPLRSLRILHSARA----LFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSL-WIQNITTCPVRNVTRDGGFGPWSPWKPCEHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCSRNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSNNCGGGVQSRRRSCE 692          
BLAST of Semaphorin-5A-like vs. Ensembl Mouse
Match: Sema3b (sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B [Source:MGI Symbol;Acc:MGI:107561])

HSP 1 Score: 97.8265 bits (242), Expect = 2.463e-20
Identity = 92/344 (26.74%), Postives = 153/344 (44.48%), Query Frame = 3
Query:  732 SSWIQQNDYLQFVYVFENNN----FVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF--DKDRQ--ILFSTFS--SGEIATTAICQYSMNDIESAFDGPFVSTLDP---------RNSEPL----------AFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEE--IWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSL-LLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVI--HSTVDSCV--DPFCFWEQTTGKCVSIFQITV 1655
            S W+ +  +++  ++ E+ N     +YF  +E A E        +V SR+ +I +ND+GG   +L   + TFLKA ++C        DT  + ++  F    +DRQ  +L++ FS  SG    +A+C YSMND+  AF GPF     P         R   P            F++ ++   D + + A  H L +NPVLP   + L  Q      +TQI    +  +   YD++F+ T  G + K    +   +   SE L L  L   + +  IT M++ + +      L I     V ++ +  C     +  + C+  DP+C W+   G   + FQ T 
Sbjct:  217 SRWLNEPKFVKVFWIPESENPDDDKIYFFFRESAVEAAPAMGRMSV-SRVGQICRNDLGGQ-RSLVNKWTTFLKARLVCSVPGVE-GDTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVCVYSMNDVRRAFLGPFAHKEGPTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQF-ARNHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVI-SVPKGSRPNSEGLLLEELQVFEDSAAITSMQISSKRQ----QLYIASRSAVAQIALHRCTALGRACAECCLARDPYCAWD---GSACTRFQPTA 548          
BLAST of Semaphorin-5A-like vs. Ensembl Mouse
Match: Sema3b (sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B [Source:MGI Symbol;Acc:MGI:107561])

HSP 1 Score: 97.8265 bits (242), Expect = 2.463e-20
Identity = 92/344 (26.74%), Postives = 153/344 (44.48%), Query Frame = 3
Query:  732 SSWIQQNDYLQFVYVFENNN----FVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF--DKDRQ--ILFSTFS--SGEIATTAICQYSMNDIESAFDGPFVSTLDP---------RNSEPL----------AFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEE--IWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSL-LLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVI--HSTVDSCV--DPFCFWEQTTGKCVSIFQITV 1655
            S W+ +  +++  ++ E+ N     +YF  +E A E        +V SR+ +I +ND+GG   +L   + TFLKA ++C        DT  + ++  F    +DRQ  +L++ FS  SG    +A+C YSMND+  AF GPF     P         R   P            F++ ++   D + + A  H L +NPVLP   + L  Q      +TQI    +  +   YD++F+ T  G + K    +   +   SE L L  L   + +  IT M++ + +      L I     V ++ +  C     +  + C+  DP+C W+   G   + FQ T 
Sbjct:  217 SRWLNEPKFVKVFWIPESENPDDDKIYFFFRESAVEAAPAMGRMSV-SRVGQICRNDLGGQ-RSLVNKWTTFLKARLVCSVPGVE-GDTHFDQLQDVFLLSSRDRQTPLLYAVFSTSSGVFQGSAVCVYSMNDVRRAFLGPFAHKEGPTHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQF-ARNHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVI-SVPKGSRPNSEGLLLEELQVFEDSAAITSMQISSKRQ----QLYIASRSAVAQIALHRCTALGRACAECCLARDPYCAWD---GSACTRFQPTA 548          
BLAST of Semaphorin-5A-like vs. UniProt/SwissProt
Match: sp|Q9P283|SEM5B_HUMAN (Semaphorin-5B OS=Homo sapiens OX=9606 GN=SEMA5B PE=2 SV=4)

HSP 1 Score: 179.489 bits (454), Expect = 1.133e-44
Identity = 204/850 (24.00%), Postives = 353/850 (41.53%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNG---LASYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYK----GLLSEIES---EFCSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKL-EVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N    + +  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C   S+  E     N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + + DGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG G+++RRR C+      G   E ++   E C ++  N                   + F   C++  A  P G                G+ S D D L EV +     +  T+S   W+ W  W+ C   C     E+    RKR C           C G   E + CN   C
Sbjct:  105 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSGNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVAGRKVFMCGTNAFSPMCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNC---SRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLHGCYLEELHVL--PPGRREPLRSLRILHSARA----LFVGLRDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGMQSRRRACENGNSCLGCGVEFKTCNPEGCPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAPLA-DPHGLQFGRRRTETRTCPADGSGSCDTDALVEVLLRSGSTSPHTVSGG-WAAWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQAC 907          
BLAST of Semaphorin-5A-like vs. UniProt/SwissProt
Match: sp|Q60519|SEM5B_MOUSE (Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b PE=2 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 1.044e-42
Identity = 201/851 (23.62%), Postives = 351/851 (41.25%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLA---SYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL-CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEF-------CSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDV---WSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            ++ F DL    P+V N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N  +   S  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  F+   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C    +       N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + +SD V +V +E C  + +  +C+   DP+C W+     C ++   +   L  +  +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   +     + + NCS +  W++W+SW++CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG GV++RRR C+          EF       C ++  N                   + F   C++     P G    +           GT + D D L   VE  +++ +T    +   W+ W  W+ C   C     E+    RKR C           C G   E + CN   C
Sbjct:   47 IVAFEDL---KPWVFN-----FTYPGVRDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVSGRKVFMCGTNAFSPVCSSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAFDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISKAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVL--PPGRLEPLRSLRILHSARA----LFVGLSDRVLRVPLERCSAYHSQGACLGARDPYCGWDGKRQLCSTLEDSSNMSL-WIQNITTCPVRNVTRDGGFGPWSPWKPCEHLDGDNSGSCLCRARSCDSPRPRCGGLECLGPSIHIANCSRNGAWTAWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSNNCGGGVQSRRRSCENGNSCPGCGVEFKTCNPEACPEVRRNTPWTPWLPVNVTQGGARQEQRFRFTCRAP-LPDPHGLQFGKRRTETRTCPADGTGACDTDAL---VEDLLRSGSTSPHTLNGGWATWGPWSSCSRDC-----ELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQAC 849          
BLAST of Semaphorin-5A-like vs. UniProt/SwissProt
Match: sp|D3ZTD8|SEM5A_RAT (Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sema5a PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.405e-41
Identity = 195/833 (23.41%), Postives = 331/833 (39.74%), Query Frame = 3
Query:  240 YRPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT--------ISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQ-ITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENT----CQCRMRNC--KFGNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNY-----------------------------------FANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCN 2504
            +R  + V F   + + P   +L++   N + +  + +++ +  ++    +A       K   +  C  +    ++L     V    L+ C +N       I++    T        ++R  + P+++  ++++A   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     KTV SR  R+ KND+GG  + L++ + TF+KA + C    +       N ++S FF  +  +++  F++    IA +A+C ++++ I  AF+GPF    + R       N  P     T ++  +  LT R    A K  L    V P        ++   ++ + V  ++       I+++AT  G IKK    ++  +  C  E + L   P  K+  I  +K+++S    Q  L + + + V K+ ++ C  H T  +C+   DP+C W+    KC S+ + +++ Q  Q   +  C   +   D  +  WS W  C   + T    C CR R+C      C         +E+ NCS +  W+ W SWS CS+ CG G   RQR C           C G++ E + C     C   V      W  W  C  +CG G++ RRR C+     +  +   C+ +E   C  N C  +   +P         PVN                                    + +  GT     D L        +  A      WS W+ W++C   CS          RKRVC           C G  LE + CN
Sbjct:   50 FRAENAVDF-SRLTFDPGQKELVVGARNYLFRLQLEDLSLIQAVQWECDEATKKACYSKGKSKEECQNY---IRVL----LVGGDRLFTCGTNAFTPVCTIRSLSNLTEIHDQISGMARCPYSPQHNSTALLTASGELY------AATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPN---FVSSYDIGNFTYFFFRENAVEHDC---GKTVFSRAARVCKNDIGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGRDTLVHIIYLATDYGTIKKVRAPLSQSSGSCLLEEIELF--PERKSEPIRSLKILHS----QSVLFVGLQEHVVKIPLKRCHFHQTRGACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQ--SVPTCPTRNLTVDGSFGPWSPWTPCTHTDGTAVGSCLCRSRSCDSPAPQCGGWQCEGPRMEITNCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVF--WTGWGPWERCTAQCGGGIQARRRTCE-----NGPDCAGCN-VEYQPCNTNACPELKKTTPWTPWT----PVNISDNGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIRN-----RKRVCNNPEPKYGGMPCLGPSLEFQECN 834          
BLAST of Semaphorin-5A-like vs. UniProt/SwissProt
Match: sp|Q62217|SEM5A_MOUSE (Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.732e-40
Identity = 192/833 (23.05%), Postives = 329/833 (39.50%), Query Frame = 3
Query:  240 YRPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT--------ISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQ-ITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNY-----------------------------------FANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCN 2504
            +R  + V F   + + P   +L++   N + +  + +++ +  +E    +A       K   +  C  +    ++L     V    L+ C +N       I++    T        ++R  + P+++  ++++A   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     KTV SR  R+ KND+GG  + L++ + TF+KA + C    +       N ++  FF  +  +++  F++    IA++A+C ++++ I  AF+GPF    + R       N  P     T ++  +  LT R    A K  L    V P        ++   ++ + V  ++       I+++ T  G IKK    ++  +  C  E + L   P  ++  I  +++++S    Q  L + + + V K+ ++ C  H T  +C+   DP+C W+    KC S+ + +++ Q  Q   +  C   +   D  +  WS W  C    G    +C CR R+C      C         +E+ NCS +  W+ W SWS CS+ CG G   RQR C           C G++ E + C     C   V      W  W  C  +CG G++ RRR C+     +       S +E + C  N C  +   +P         PVN                                    + +  GT     D L        +  A      WS W+ W++C   CS          RKRVC           C G  LE + CN
Sbjct:   50 FRAENAVDF-SRLTFDPGQKELVVGARNYLFRLELEDLSLIQAVEWECDEATKKACYSKGKSKEECQNY---IRVL----LVGGDRLFTCGTNAFTPVCTIRSLSNLTEIHDQISGMARCPYSPQHNSTALLTASGELY------AATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPN---FVSSYDIGNFTYFFFRENAVEHDC---GKTVFSRPARVCKNDIGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQGTFFLPELDLIYGIFTTNVNSIASSAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHLAVDVVQGRETLVHIIYLGTDYGTIKKVRAPLSQSSGSCLLEEIELF--PERRSEPIRSLQILHS----QSVLFVGLQEHVAKIPLKRCHFHQTRSACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQ--SIPTCPTRNLTVDGSFGPWSPWTPCTHTDGTAVGSCLCRSRSCDRPAPQCGGWQCEGPRMEITNCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVF--WTGWGPWERCTAQCGGGIQARRRTCENGPDCAG------SNVEYHPCNTNACPELKKTTPWTPWT----PVNISDNGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIR-----NRKRVCNNPEPKFGGMPCLGPSLEFQECN 834          
BLAST of Semaphorin-5A-like vs. UniProt/SwissProt
Match: sp|Q13591|SEM5A_HUMAN (Semaphorin-5A OS=Homo sapiens OX=9606 GN=SEMA5A PE=1 SV=3)

HSP 1 Score: 160.614 bits (405), Expect = 9.680e-39
Identity = 190/833 (22.81%), Postives = 328/833 (39.38%), Query Frame = 3
Query:  240 YRPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT--------ISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITD-DTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQ-ITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNY-----------------------------------FANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCN 2504
            +R  + V F   + + P   +L++   N + +  + +++ +  +E    +A       K   +  C  +    ++L     V    L+ C +N        ++    T        ++R  + P+++  ++++A   +Y      A   + F    P  + S  +     T Q  S W+ + +   FV  ++  NF YF  +E A E D     KTV SR  R+ KND+GG  + L++ + TF+KA + C    +       N ++S FF  +  +++  F++    IA +A+C ++++ I  AF GPF    + R       N  P     T ++  +  LT R    A K  L    V P        ++   ++ + V  ++       I+++AT  G IKK    +    + C  E + L   P  +   I  +++++S    Q  L + + + V K+ ++ C  + T  +C+   DP+C W+    KC S+ + +++ Q  Q   +  C   +   D  +  WS W  C    G    +C CR R+C      C         +E+ NCS +  W+ W SWS CS+ CG G   RQR C           C G++ E + C     C   +      W  W  C  +CG G++ RRR+C+     +  +   C+ +E   C  N C  +   +P         PVN                                    + +  GT     D L        +  A      WS W+ W++C   CS          RKRVC           C G  LE + CN
Sbjct:   50 FRAKNAVDF-SQLTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATKKACYSKGKSKEECQNY---IRVL----LVGGDRLFTCGTNAFTPVCTNRSLSNLTEIHDQISGMARCPYSPQHNSTALLTAGGELY------AATAMDFPGRDPAIYRSLGILPPLRTAQYNSKWLNEPN---FVSSYDIGNFTYFFFRENAVEHDC---GKTVFSRAARVCKNDIGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSTFFLPELDLIYGIFTTNVNSIAASAVCVFNLSAIAQAFSGPFKYQENSRSAWLPYPNPNPHFQCGTVDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHVAVDVVQGREALVHIIYLATDYGTIKKVRVPLNQTSSSCLLEEIELF--PERRREPIRSLQILHS----QSVLFVGLREHVVKIPLKRCQFYRTRSTCIGAQDPYCGWDVVMKKCTSLEESLSMTQWEQ--SISACPTRNLTVDGHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEIANCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMF--WTGWGPWERCTAQCGGGIQARRRICE-----NGPDCAGCN-VEYQSCNTNPCPELKKTTPWTPWT----PVNISDNGGHYEQRFRYTCKARLADPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSAHTVNGAWSAWTSWSQCSRDCSRGIR-----NRKRVCNNPEPKYGGMPCLGPSLEYQECN 834          
BLAST of Semaphorin-5A-like vs. TrEMBL
Match: G7NYD0 (Sema domain-containing protein OS=Macaca fascicularis OX=9541 GN=EGM_10415 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.095e-48
Identity = 203/830 (24.46%), Postives = 342/830 (41.20%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIK-------TFEK-TTISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEG 2543
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N  +     +       T EK   ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C    +       N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G IK           CY E L +L  P  +   +  +++++S       L + +SDGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG GV++RRR C++     + E  F  ++    C   E                  P N    C G  +E +         D    A      WSCW+ W+ C   C           R R C        +D+C GL  EE  C    C      PEG
Sbjct:   47 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVTGRKVFMCGTNAFSPVCTSRQVGNVSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAHRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTIKALSTASRSVRGCYLEELHVL--PPGRHEPLRSLRILHSARA----LFVGLSDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGVQSRRRACEWSSCSRDCELGF--RVRKRTCTNPE------------------PRNGGLPCVGDAAEYQ---------DCNPQACPVRGAWSCWTSWSPCSASCGG-----GHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQAC------PEG 797          
BLAST of Semaphorin-5A-like vs. TrEMBL
Match: A0A5F7ZQD7 (Semaphorin 5B OS=Macaca mulatta OX=9544 GN=SEMA5B PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.507e-45
Identity = 204/852 (23.94%), Postives = 349/852 (40.96%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIK-------TFEK-TTISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL-CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEV--------SVEYDVKNYATIS-------------EDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEG 2543
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N  +     +       T EK   ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C    +       N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + +SDGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG GV++RRR C+         S     +E   C  + C  +   +P    +    PVN      G + E   +            +++  +   T S                WSCW+ W+ C   C           R R C        +D+C GL  EE  C    C      PEG
Sbjct:   47 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVTGRKVFMCGTNAFSPVCTSRQVGNVSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFTYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSVRGCYLEELHVL--PPGRHEPLRSLRILHSARA----LFVGLSDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSL-WTQNITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGVQSRRRACENG------NSCLGCGVEFKTCNPDGCPEVRRNTPWTPWL----PVNVTQG--GARQEQRFRFTCRAPLADPHGLQFGRRRTETRSCPANGSGACDTDVRGAWSCWTSWSPCSASCGG-----GHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQAC------PEG 836          
BLAST of Semaphorin-5A-like vs. TrEMBL
Match: G7MKK3 (Sema domain-containing protein OS=Macaca mulatta OX=9544 GN=EGK_11363 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 4.425e-45
Identity = 208/857 (24.27%), Postives = 348/857 (40.61%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRD--SILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIK-------TFEK-TTISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL-CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMG--------------TLVEELG------------PVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEG 2543
             + F DL    P+V+N       Y   RD   +   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N  +     +       T EK   ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C    +       N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + +SDGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG GV++RRR C+             S +      V +    G+ SP                +L  ELG            P N    C G  +E +         D    A      WSCW+ W+ C   C           R R C        +D+C GL  EE  C    C      PEG
Sbjct:   47 TVAFEDL---QPWVSN-----FTYPGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVTGRKVFMCGTNAFSPVCTSRQVGNVSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSVRGCYLEELHVL--PPGRHEPLRSLRILHSARA----LFVGLSDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPVPIF--WASWGSWSKCSSNCGGGVQSRRRACENGN----------SCLGCGVALVEDLLRSGSTSPHTVSGGWAAWGPWLSCSLDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQ---------DCNPQACPVRGAWSCWTSWSPCSASCGG-----GHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQAC------PEG 834          
BLAST of Semaphorin-5A-like vs. TrEMBL
Match: A0A3Q7RKN8 (semaphorin-5B OS=Vulpes vulpes OX=9627 GN=SEMA5B PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.498e-45
Identity = 212/843 (25.15%), Postives = 344/843 (40.81%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFYRPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLE-IPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLA---SYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELG------------PVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEG 2543
             + F DL    P+V N  Y       F    L PP  + L++   N + + S+ N++ +   E     D   SC + K   +  C  +    ++L     V    +++C +N  +   S  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C    +       N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +      P+    C    E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     T  +L  CY E L +L  P  +   +  +++++S       L + +SDGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L     +  C   +   D  + QWS W+ C    G N  +C CR R C      C   D     + + NCS +  W+ W  W+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG GV++RRR C+                  N C    C   GA S       ELG            P      C G  +E +         D    A      WSCW+ W+ C   C           R R C        +D+C GL  EE  C    C      PEG
Sbjct:   47 TVAFADL---KPWVFNFTYP--GARDFSQLALDPPR-NQLIVGARNYLFRLSLANISLLQATEWASNEDTRRSC-QSKGKTEEECQNY---VRVL----IVTGRKVFLCGTNAFSPVCSSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNCSRPGEV--PFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPEVGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKAL-STTSRSLRGCYLEELHVL--PPGRREPLRSLRILHSARA----LFVGLSDGVLRVPLERCGAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQ-NITACPVRNVTRDGGFGQWSPWQPCEHLDGDNSGSCLCRARACDSPRPRCGGRDCLGPAIHIANCSRNGAWTPWAPWAPCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENAPCPVPIF--WASWGSWSKCSSNCGGGVQSRRRACENG----------------NSC--PGCGVWGAWSSCSRAC-ELGFRVRKRTCTNPEPRGGGLPCSGDAAEYQ---------DCNPQACPVRGAWSCWTPWSPCSASCGG-----GHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQAC------PEG 811          
BLAST of Semaphorin-5A-like vs. TrEMBL
Match: A0A2K5ENW6 (Semaphorin 5B OS=Aotus nancymaae OX=37293 GN=SEMA5B PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 6.412e-45
Identity = 207/856 (24.18%), Postives = 358/856 (41.82%), Query Frame = 3
Query:  186 VLFFHDLYSKSPYVANHFY-RPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLA---SYYKIKTFEKT-----TISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNSE-PLA--------FTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL-CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNC--KFGNCADSDN-KEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCK-------YKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANC-----------QGTKSEDEDK------LEVSVEY-DVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEG 2543
             + F DL    P+V+N  Y    D+      I   P+ + L++   N + + S+ N++ +   E    +      + K   +  C  +    ++L     V    +++C +N  +   +  ++    +T      ++R  + P+++  +V+S+   +Y      A  ++ F    P  + S        T Q  S W+ + +   FV  ++   F YF L+E A E D     +TV SR+ R+ KNDVGG  + L++ + TF+KA + C   S+  E     N ++S F   ++ +++  F++    IA +A+C ++++ I  AF+GPF    +PR +  P+A         T  E    + LT R    A +  L    V P   +  V Q+   ++ + V  ++     Y ++++ T  G I K     +     CY E L +L  P  +   +  +++++S       L + +SDGV +V +E C  + +  +C+   DP+C W+    +C ++   +   L  +  +  C   +   D  +  WS W+ C    G N  +C CR R+C      C   D     + + NCS +  W+ W+SW+ CS+ CG G   RQR C           C GKS E + C  +  C   +    A W +WS C   CG GV++RRR C+       + G  S        +   +   V +    G  SP  T+         +++C           + T +  E +      +  + EY D    A      WSCW+ W+ C   C           R R C        +D+C GL  EE  C    C      PEG
Sbjct:   89 TVAFEDL---QPWVSNFTYPGAWDF----SQIALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASSEDTRRSCQSKGKTEEECQNY---VRVL----IVAGRKVFMCGTNAFSPVCTSRQVGNLSRTIEKINGVARCPYDPRHNSTAVISSQGELY------AATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPN---FVAAYDIGLFAYFFLRENAVEHDC---GRTVYSRVARVCKNDVGGR-FLLEDTWTTFMKARLNC---SRPGEVPFYYNELQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIANPIPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQPVTPEPCVTQDSVRFSHLVVDLVQAKDTLYHVLYIGTESGTILKALSTASRSLRGCYLEELHVL--PPGRREPLRSLRILHSARA----LFVGLSDGVLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSL-WIQNITACPVRNVTRDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPRPRCGGLDCLGPAIHIANCSRNGAWTPWSSWALCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNENTPCPLPIF--WASWGSWSKCSSNCGGGVQSRRRACENGNACLGWPGPGSGCPGAPSLRPRPSAALVGDLLRSGNTSPH-TVSGGWAAWGPWSSCSRDCELGFRVRKRTCTNPEPRNGGLPCVGDAAEYQDCNPQACPVRGAWSCWTSWSPCSASCGG-----GHYQRTRSCTSPAPSPGEDICLGLHTEEALCATQAC------PEG 893          
BLAST of Semaphorin-5A-like vs. Ensembl Cavefish
Match: sema5bb (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Bb [Source:ZFIN;Acc:ZDB-GENE-130530-778])

HSP 1 Score: 172.17 bits (435), Expect = 1.607e-43
Identity = 184/719 (25.59%), Postives = 308/719 (42.84%), Query Frame = 3
Query:  582 PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY--IESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTCEENKFDCLTYRASKHQLK-------FNPVLPNLKKN-LVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVD---PFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC-----GKNENTCQCRMRNC--KFGNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFAN-----------CQGTKSEDED------KLEV----------SVEYD--VKNYATISEDV-------WSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            PK++  ++++    +Y      A  ++ F    P  + S   L  L T    S W+ +     FV  +E   F YF L+E A E D     K V SR+ R+ +NDVGG  + L++ + TF+KA + C   S+S  D    Y  ++S F+  ++ I++  F++    IA +A+C ++++ I  AF+GPF    +PR S      P+    C            ++  L+        N V+  +  N L+ Q+   ++++ V  ++   R Y ++++ T  G + K     ++++L  CY E + LL  P D+   I +++++ S       L + ++  V K+ +E C  + T   C+D   P+C W++   +C +I + +    + +  +  C + +   D  +  WS W+ C     G+N + CQCR R+C      C   +    ++EV NCS +  W+ W+SWS CS+ CG G   RQR C           C G++ E + C  +  C   V      WS+WS C   CG G+++R R C+     S         +E   C +  C  +   +P         PVN   +           C+   +   D      KLE             E D  V +   +S  V       WS W  W+ C   CS         TRKR C   +       C G  +E + CN   C
Sbjct:  107 PKHNSTAMLTDSGELY------AATVIDFSGRDPVIYRSLGTLPPLRTAQYNSKWLNEP---HFVSAYEVGRFTYFFLRETAVEQDC---GKAVYSRVARVCQNDVGGR-FLLEDTWTTFMKARLNC---SRS-GDVPFYYHELQSTFYLPEQDIIYGVFTTNVNSIAASAVCAFNLSAITQAFNGPFRYQENPRTSWLSTPNPIPNFQCGTVGDGGPGGNLTERSLQDAQRLFLMNDVVQPISVNPLISQDNIRFSKVAVDIVQGRDRLYHVIYIGTEYGTVIKAL-STSNNSLRGCYLEEMKLL--PEDEWEPILNLQILQSDRS----LFVGLNSKVLKIPLERCSNYQTQSDCLDARDPYCGWDRKQKRCSTIEESSNMS-QWIQNITHCPERNLTQDGAFGSWSPWQSCNHNDGGENTSACQCRSRSCDSPAPQCGGLECVGAKIEVANCSRNGGWTPWSSWSPCSTSCGVGFEVRQRSCNNPAPRHGGRVCVGQAREERLCNENTPCPLPVS--WVPWSSWSKCSAPCGGGIQSRVRTCENGNTCSGCP------LEYKACNLEACAEVRRNTPWSPWY----PVNVTVSGARQEQRVRFTCRALLANPHDLQLGKRKLETRTCPPGDGTPGCETDGLVDDLVRVSRPVNHVQGASWSPWETWSSCSKECSKGFR-----TRKRSCLSPDGKSSPFSCSGTPVEYQDCNTQPC 783          
BLAST of Semaphorin-5A-like vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 169.088 bits (427), Expect = 1.917e-42
Identity = 203/826 (24.58%), Postives = 340/826 (41.16%), Query Frame = 3
Query:  276 ILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYS--SCF-RDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT------ISRSHCPK---YSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIF-QITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKFGN--CADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFAN-----------CQGTKSE------DEDKLEV-----------SVEYDVKNYATIS----EDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            + + P  ++L++   N + +  + ++  + + E    D ++  +CF R K  ++  C  +    ++L  N D     L+ C +N        +T    T         + CP    ++  +++++   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     +TV SR  R+ KND+GG  + L++ + TF+KA + C   S+  E   S N ++  FF  + ++L+  F++    IA +A+C ++++ I   F GPF    + R       N  P     T +   +  LT R    A K  L    + P +      ++   ++ + V  ++     Y I+++AT  G IKK    +   T  C  + + L   PR + P I  + +++S++     L + V D V K+ +  C  H + ++CV   DP+C W+    KCV +   +++ Q  Q   + +C   +   D  +  WSSW  C    G +   CQCR R C   +  C         VEV NCS +  W+ W +W+ CS+ CG G   RQR C           C G++ E + C     C   +    + WS W  C   CG G+++RRR C+        E   CS +E   C    C  +   +P         PVN   N           C+   +E         ++E+           S + D+     I+       WS WS W++C   CS         +RKR C           C G   E + CN   C
Sbjct:   63 LTFDPGQNELIVGARNHLFRLHLEDLALIQEAEW-HCDEFTKGACFSRGKSEEE--CQNY---IRVLLVNGD----RLFTCGTNAFTPICTNRTLTNLTEIHDQISGMARCPYNPLHNSTALITSSGELY------AATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEPN---FVSSYDIGNFTYFFFRENAVEHDC---GRTVFSRAARVCKNDIGGR-FLLEDTWTTFMKARLNC---SRPGEIPFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQENSRSAWLPYPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELF-PPRRRQP-ILSLLILHSRSE----LFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQ--SITKCPVRNVTVDGHFGLWSSWRPCSHSDGGSVGLCQCRTRACNSPSPQCGGQQCQGTSVEVANCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHIY--WSAWSPWERCTVPCGGGIQSRRRTCENGN-----ECPGCS-VEYQSCNTLPCPDLKKTTPWTPWT----PVNISDNGGHYEQRFRYTCKARVAEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSAWSSWSQCSRDCSSGIR-----SRKRTCTNPKPKYGGTSCLGPAQEYQECNTTPC 837          
BLAST of Semaphorin-5A-like vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 169.088 bits (427), Expect = 2.328e-42
Identity = 203/826 (24.58%), Postives = 342/826 (41.40%), Query Frame = 3
Query:  276 ILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYS--SCF-RDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT--------ISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIF-QITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKFGN--CADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFAN-----------CQGTKSE------DEDKLEV-----------SVEYDVKNYATIS----EDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            + + P  ++L++   N + +  + ++  + + E    D ++  +CF R K  ++  C  +    ++L  N D     L+ C +N        +T    T        ++R  + P ++  +++++   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     +TV SR  R+ KND+GG  + L++ + TF+KA + C   S+  E   S N ++  FF  + ++L+  F++    IA +A+C ++++ I   F GPF    + R       N  P     T +   +  LT R    A K  L    + P +      ++   ++ + V  ++     Y I+++AT  G IKK    +   T  C  + + L   PR + P I  + +++S++     L + V D V K+ +  C  H + ++CV   DP+C W+    KCV +   +++ Q  Q   + +C   +   D  +  WSSW  C    G +   CQCR R C   +  C         VEV NCS +  W+ W +W+ CS+ CG G   RQR C           C G++ E + C     C   +    + WS W  C   CG G+++RRR C+        E   CS +E   C    C  +   +P         PVN   N           C+   +E         ++E+           S + D+     I+       WS WS W++C   CS         +RKR C           C G   E + CN   C
Sbjct:   63 LTFDPGQNELIVGARNHLFRLHLEDLALIQEAEW-HCDEFTKGACFSRGKSEEE--CQNY---IRVLLVNGD----RLFTCGTNAFTPICTNRTLTNLTEIHDQISGMARCPYNPLHNSTALITSSGELY------AATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEPN---FVSSYDIGNFTYFFFRENAVEHDC---GRTVFSRAARVCKNDIGGR-FLLEDTWTTFMKARLNC---SRPGEIPFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQENSRSAWLPYPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELF-PPRRRQP-ILSLLILHSRSE----LFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQ--SITKCPVRNVTVDGHFGLWSSWRPCSHSDGGSVGLCQCRTRACNSPSPQCGGQQCQGTSVEVANCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHIY--WSAWSPWERCTVPCGGGIQSRRRTCENGN-----ECPGCS-VEYQSCNTLPCPDLKKTTPWTPWT----PVNISDNGGHYEQRFRYTCKARVAEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSAWSSWSQCSRDCSSGIR-----SRKRTCTNPKPKYGGTSCLGPAQEYQECNTTPC 837          
BLAST of Semaphorin-5A-like vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 168.703 bits (426), Expect = 2.807e-42
Identity = 203/826 (24.58%), Postives = 342/826 (41.40%), Query Frame = 3
Query:  276 ILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYS--SCF-RDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT--------ISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIF-QITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKFGN--CADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFAN-----------CQGTKSE------DEDKLEV-----------SVEYDVKNYATIS----EDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            + + P  ++L++   N + +  + ++  + + E    D ++  +CF R K  ++  C  +    ++L  N D     L+ C +N        +T    T        ++R  + P ++  +++++   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     +TV SR  R+ KND+GG  + L++ + TF+KA + C   S+  E   S N ++  FF  + ++L+  F++    IA +A+C ++++ I   F GPF    + R       N  P     T +   +  LT R    A K  L    + P +      ++   ++ + V  ++     Y I+++AT  G IKK    +   T  C  + + L   PR + P I  + +++S++     L + V D V K+ +  C  H + ++CV   DP+C W+    KCV +   +++ Q  Q   + +C   +   D  +  WSSW  C    G +   CQCR R C   +  C         VEV NCS +  W+ W +W+ CS+ CG G   RQR C           C G++ E + C     C   +    + WS W  C   CG G+++RRR C+        E   CS +E   C    C  +   +P         PVN   N           C+   +E         ++E+           S + D+     I+       WS WS W++C   CS         +RKR C           C G   E + CN   C
Sbjct:   63 LTFDPGQNELIVGARNHLFRLHLEDLALIQEAEW-HCDEFTKGACFSRGKSEEE--CQNY---IRVLLVNGD----RLFTCGTNAFTPICTNRTLTNLTEIHDQISGMARCPYNPLHNSTALITSSGELY------AATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEPN---FVSSYDIGNFTYFFFRENAVEHDC---GRTVFSRAARVCKNDIGGR-FLLEDTWTTFMKARLNC---SRPGEIPFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQENSRSAWLPYPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELF-PPRRRQP-ILSLLILHSRSE----LFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQ--SITKCPVRNVTVDGHFGLWSSWRPCSHSDGGSVGLCQCRTRACNSPSPQCGGQQCQGTSVEVANCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHIY--WSAWSPWERCTVPCGGGIQSRRRTCENGN-----ECPGCS-VEYQSCNTLPCPDLKKTTPWTPWT----PVNISDNGGHYEQRFRYTCKARVAEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSAWSSWSQCSRDCSSGIR-----SRKRTCTNPKPKYGGTSCLGPAQEYQECNTTPC 837          
BLAST of Semaphorin-5A-like vs. Ensembl Cavefish
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:103027847])

HSP 1 Score: 166.777 bits (421), Expect = 1.198e-41
Identity = 173/659 (26.25%), Postives = 275/659 (41.73%), Query Frame = 3
Query:  732 SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIF-QITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKFGN--CADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFAN-----------CQGTKSE------DEDKLEV-----------SVEYDVKNYATIS----EDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            S W+ + +   FV  ++  NF YF  +E A E D     +TV SR  R+ KND+GG  + L++ + TF+KA + C    +     S N ++  FF  + ++L+  F++    IA +A+C ++++ I   F GPF    + R       N  P     T +   +  LT R    A K  L    + P +      ++   ++ + V  ++     Y I+++AT  G IKK    +   T  C  + + L   PR + P I  + +++S++     L + V D V K+ +  C  H + ++CV   DP+C W+    KCV +   +++ Q  Q   + +C   +   D  +  WSSW  C    G +   CQCR R C   +  C         VEV NCS +  W+ W +W+ CS+ CG G   RQR C           C G++ E + C     C   +    + WS W  C   CG G+++RRR C+        E   CS +E   C    C  +   +P         PVN   N           C+   +E         ++E+           S + D+     I+       WS WS W++C   CS         +RKR C           C G   E + CN   C
Sbjct:  205 SKWLNEPN---FVSSYDIGNFTYFFFRENAVEHDC---GRTVFSRAARVCKNDIGGR-FLLEDTWTTFMKARLNCSRPGEI--PFSYNELQGTFFLPELELLYGIFTTNVNSIAASAVCAFNLSAITQVFSGPFKYQENSRSAWLPYPNPNPDFQCGTIDYGSYVNLTERNLQDAQKFILMHEVIQPIVPVPYFMEDNVRFSHVAVDVVQGKDMLYHIIYLATDYGTIKKVLSPLNQTTGSCLLDEIELF-PPRRRQP-ILSLLILHSRSE----LFVGVRDQVIKIPLIRCNFHKSREACVGARDPYCGWDLVLKKCVMLEDSVSMSQWEQ--SITKCPVRNVTVDGHFGLWSSWRPCSHSDGGSVGLCQCRTRACNSPSPQCGGQQCQGTSVEVANCSRNGAWTPWTAWAPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLPCPPHIY--WSAWSPWERCTVPCGGGIQSRRRTCENGN-----ECPGCS-VEYQSCNTLPCPDLKKTTPWTPWT----PVNISDNGGHYEQRFRYTCKARVAEPGLLEVGRQRIEMRYCSSDGSTGCSTDGDLLRSGRITGLTVNGGWSAWSSWSQCSRDCSSGIR-----SRKRTCTNPKPKYGGTSCLGPAQEYQECNTTPC 829          
BLAST of Semaphorin-5A-like vs. Ensembl Sea Lamprey
Match: sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8969])

HSP 1 Score: 124.02 bits (310), Expect = 2.521e-29
Identity = 144/568 (25.35%), Postives = 230/568 (40.49%), Query Frame = 3
Query:  582 PKYSIVSVVSADLHIYVGDL----ERAPKILRFKPEYPTGFPSENLKSLSTTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDK------------SKSLEDTSLNYIESGFFDKDRQIL---FSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQ--YDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQIT----------VYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNEN------TCQCRMRNC--KFGNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVC 2102
            P++S  ++++A   +Y         R P I R     PT      L++      S W+ +     FV  +E   FVY   +EVA E +  C  + V         ND+GG  + L++ + T++KA + C               + + +      ++S  F  +  +L   F+T  SG +A+ A+C Y+M+D+   F+GPF     PR       N  P     T  +     LT R    A +  L   PV P   + L+ ++   +T++ + S  R      + ++F AT +G ++K    +   + C  + + L       A R     L  S       L +     V K+ +E C    T  +CV   DPFC W+ T  +C ++ + +           + +R L             D     WS WE C  ++       +C CR R C      CA    +   V+V NCS +  W+ W++WS C++ C  G   RQR C           C G++ E + C    +C   V    + W  W  C   CG GVRTRRR C
Sbjct:  122 PQHSAATLLTARGELYAATAVDFAGRDPAIYRSLGGLPT------LRTAQ--YNSRWLNEPS---FVLAWEAGGFVYVAFREVAVEQE--CGRRVVSRVARVCA-NDLGGR-FLLEDTWTTYMKARLECSGTLGSASPGSAAGAAPAQDVVDFPELQSAVFVPEAGLLYGVFTTAGSGPVAS-AVCVYNMSDVRETFNGPFKVQESPRTAWLPHPNPNPNFQCDTVPDGSTANLTVRSLVDAQRLLLMAEPVTPGGGRALLARHGSRFTRLAIDSSARGRGGVVHRMLFEATDEGTVQK----VAAASGCVIDEMELPW----PAARQRVRALHASPGDGA--LYVGTDGAVLKLPLERCSAFRTESTCVGSRDPFCGWDLTLRRCTTLRESSGSGTSDSGGTAWNVRNL-----------TVDGALGPWSVWETCQHSDGGETGSSSCLCRRRACDTPLPQCAGRPCDGATVQVANCSRNGGWTPWSAWSVCTTTCSMGFQVRQRSCSNPSPRHGGRVCVGQNREERFCNEHTRCP--VPATWSPWGPWERCSAPCGGGVRTRRRTC 650          
BLAST of Semaphorin-5A-like vs. Ensembl Sea Lamprey
Match: sema5a (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8969])

HSP 1 Score: 97.8265 bits (242), Expect = 5.927e-21
Identity = 112/467 (23.98%), Postives = 192/467 (41.11%), Query Frame = 3
Query:  582 PKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLED-----TSLNYIESGFFDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIE--------RSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNEN----------TCQCRMRNC--KFGNCADSD-NKEEVEVKNCS 1853
            P+ S  ++++A   +Y      A   + F    P  + S   +    T Q  S W+ + +   FV  +E   FVY   +E+A E +  C  + V         ND+GG  + L++ + T++KA + C  +  +  +     +++   E+G        LFST  SG  A+ A+C Y+++ I  AF+G F     PR       N  P        E     LT R    A +  L    V P   + ++ Q E   + + V S+         R++ Q+ I+++AT +G ++K    +   T C  + + LL  P  +   I  +++    +     L + V  GV ++ +E C  H T  +C+   DP+C W+     C+ + +    +     +L  C   +   D     WS+WE C   +           +CQCR R C      C         V+V NCS
Sbjct:   80 PRQSSATLLTARGELY------AATAVDFAGRDPALYRSLGGQPTLRTAQYNSRWLNEPN---FVLAWEAGGFVYVAFRELAVEQE--CGRRVVSRVARVCA-NDLGGR-FLLEDTWTTYMKARLDCSRRGNAAPEYPELRSAVYLPEAGLLYG----LFSTSGSGPQAS-AVCAYNISSIAGAFNGAFKYQEGPRAAWMVHPNPNPNFQCGRVSEGPNVNLTERSLADAQRLLLMSEAVAPLGGRPVIAQPEVRLSHVAVHSMAAAAASSSGRTAVQH-ILYLATERGTVQK----VAAATGCVIDEMELL--PAVQQQPIRALRV----DPGGEALFVGVDGGVLRLPLERCSTHGTESACLRARDPYCGWDGILRSCIRLRENWDARRSWRQDLTSCPVRNLTVDGGPGPWSAWEPCQHWDGDVGGSSAGGSSCQCRRRACDSPVPGCGGRPCPGPSVQVANCS 517          
BLAST of Semaphorin-5A-like vs. Ensembl Sea Lamprey
Match: sema3ab (sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Ab [Source:NCBI gene;Acc:30267])

HSP 1 Score: 95.1301 bits (235), Expect = 2.336e-20
Identity = 88/344 (25.58%), Postives = 150/344 (43.60%), Query Frame = 3
Query:  732 SSWIQQNDYLQFVYVFENNNF----VYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIIC--PDKSKSLEDTSLNYIESGFF----DKDRQILFSTF--SSGEIATTAICQYSMNDIESAFDGPFVSTLDP-------RNSEPL------------AFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIW--TQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVS-------------DGVYKVGIEHCVIHST--VDSCV--DPFCFWE 1613
            S W+ +  ++   +V E++N     VYF L+E A E +     K   SRI ++ +ND+GG   +L   + TFLKA I+C  P   + + DT  N ++  F     D    I +  F  SS     +AICQY+M DI  +F GPF     P       +   P              F +  E   + L++  S H L F+PV P+  + +V +    +  T+I V  +E     YD++F+ T  G +                 L ++L P+     + ++ L   + F +P  I++++              GV ++ ++ C I+     + C+  DP+C W+
Sbjct:   68 SRWLNEPKFVSAFWVPESDNADDDKVYFFLRETALEGE--FAGKATYSRIAQLCRNDMGGQ-RSLVNKWTTFLKARIVCSVPGGGEGV-DTQFNELQDIFMMPTRDPKNPIFYGVFTTSSPIFQGSAICQYTMADIRRSFLGPFAHKEGPNYQWVQYQGKVPYPRPGTCPSKTFGGFASTHEYPDEVLSFVRS-HPLMFSPVHPSSGQPIVVRTNVPYRLTRIAVDHVEADDGAYDVMFIGTDVGTV-----------------LKVVLVPKQTWQDLEEVTLEEVQVFKEPMPILSMAISPKRQQLYVGSETGVTQLALQRCGIYGKACAECCLSRDPYCAWD 389          
BLAST of Semaphorin-5A-like vs. Ensembl Sea Lamprey
Match: sema3d (sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D [Source:NCBI gene;Acc:30250])

HSP 1 Score: 87.8113 bits (216), Expect = 5.212e-18
Identity = 83/331 (25.08%), Postives = 143/331 (43.20%), Query Frame = 3
Query:  738 WIQQNDYLQFVYVFENNN----FVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF----DKDRQILFSTF--SSGEIATTAICQYSMNDIESAFDGPFVSTLDP-------RNSEP-------------LAFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQ--NEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHST--VDSCV--DPFCFWEQTT 1622
            W+ + +++    + E+ N     VY    E   E      DK + SR+ R+ K  VGG   +L   + TFLKA ++C     +  DT  + +   F     D    I+++ F  SS     +A+C YSM+DI +AF GPF     P       +N  P              A+ +  E   D L +   +HQL +  V P   + L+ +    +  T+I V  +E +  QYD++F+ T  G + K      ++       L  +   ++ +P I  MK+    + AQ  L +    G+ ++ +  C ++     + C+  DP+C W+  T
Sbjct:  226 WLNEPNFVGSFVIPESQNPDDDKVYVFFWEYGIEAG--ASDKVLYSRVARVCKVFVGGQ-RSLVNKWTTFLKARLVCSIPGPNDIDTHFDELRDVFLLPNKDDRNPIIYAVFTTSSSVFRGSAVCMYSMSDIRAAFHGPFAHKEGPDHQWVDFKNRIPYPRPGTCPSRTYDAAYASTRELPDDVLEF-VRRHQLVWEAVAPLGGRPLLVRAGTGDTLTRIAVDRVEATDGQYDVLFLGTDSGLVLKAITINKENRFTEEVVLEEIRVFKEPSP-IISMKI----SVAQHQLYVGSRTGLAQLSLHRCEVYGKACAECCLARDPYCAWDGAT 547          
BLAST of Semaphorin-5A-like vs. Ensembl Sea Lamprey
Match: SEMA3F (semaphorin 3F [Source:HGNC Symbol;Acc:HGNC:10728])

HSP 1 Score: 85.5001 bits (210), Expect = 3.337e-17
Identity = 86/331 (25.98%), Postives = 142/331 (42.90%), Query Frame = 3
Query:  732 SSWIQQNDYLQFVYVFE----NNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFF----DKDRQILFSTFSSGE--IATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAF---------TTCEENKF-----------DCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIW--TQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPR-ITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIH--STVDSCV--DPFCFWE 1613
            S W+ +  +L    + E    N++ +YF  +E +         KT  SRI RI  ND GG   +L   + TF+KA ++C     +  +T  + ++  F     D  + I++  FS+       +AIC YSM +    F+GPF     P   + L +          TC    F           + +      H L +NP+ P  KK L+ +    +  T+I V  +      YD++F+ T  G ++K       D L  SE L L      K P  I  MK+ + K      L I+ + G+ ++ + HC I+  +  + C+  DP+C W+
Sbjct:  219 SKWLNEPVFLAIQRIPESSDRNDDKLYFFFREKSANGGT---GKTSVSRIGRICLNDAGGQ-RSLVNKWSTFVKARLVCSVTDNTGIETHFDELQDVFILNTEDMRQPIIYGLFSTAGSVFKGSAICIYSMAEARQVFNGPFAQVEGP-GYQQLPYQGKIPYPRPGTCPGGTFTPYMKSTKDFPEEVANFIRNHPLMYNPIYPIAKKTLIMRVNTDYKITKISVDRVVAGDGTYDVLFLGTDIGTVQKITVLPKHDGL--SEELFLEEVDAFKVPTPILSMKISSKKQ----QLFISSAKGITQLALHHCGIYGKACAECCLARDPYCAWD 538          
BLAST of Semaphorin-5A-like vs. Ensembl Nematostella
Match: EDO48914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHU3])

HSP 1 Score: 118.242 bits (295), Expect = 5.157e-27
Identity = 113/471 (23.99%), Postives = 195/471 (41.40%), Query Frame = 3
Query:  576 HCPKYSIVSVVSADLHIYVGDL----ERAPKI--LRFKPEYPTGFPSENLKSLSTTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSS--GEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLV---FQNEEIWT----------QIQVISIERSSRQYD--------------------IVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGK-NENTCQCRMRNCKFGNCADSDNKEEVEVKNCS 1853
            + P+Y    ++S     Y G +     R P I  L FK  Y        L++L       W+      +FV  F+   +VYF  +E A E+ K    KT  SR+ RI K D GGS Y +K  F+TF KA + C    +       + I+  F D +R + ++ F++    +A +AIC YS+++I   F+G +    D +  E    T   E+ F   T + + H     P+ P  K+ LV     +  ++T          Q+   +++ +++                       + +V T  G + K +     ++ C  E + L        P +T ++L    + A   + +     + K+ +  C  H+   SC+   DP+C W++    C      +     Q  EL +C     +  +KW  WS+W  C + + N CQCR R C+          E+ ++K C+
Sbjct:  166 YSPRYKSTGIMSDQGRYYAGTMMDGSAREPIIFSLDFKRRY------RMLRTLRG--DDKWLSD---AEFVTSFDVGLYVYFFFREAAVENMKC--GKTRYSRVARICKGDYGGSEYVMKNTFVTFNKARLNCSTTGEY--PAYYDLIQDVFLDSNRGVFYAVFTTQPNGVAGSAICAYSLDEINRVFNGDY-KYGDDKTGEWSVQTN--EHHFANCTVKNTSHV----PISPEWKRKLVPEGMMSTPLFTKPAFDDSKRYQLMAEAVQPATQAAHYIIHGTRFSSVAVHVINNALVTYVGTESGSVLKLFTPEGHESACVIEEIRLSTQKGSSEP-VTSLRL----DVAMNAVYVATQSKLVKLRLARCSQHTDRRSCMDAHDPYCGWKKEASACTPWDSSSKGSWEQ--ELNRC----PVAKAKWSSWSAWGVCTQPDNNVCQCRTRVCRHACDPSECRGEQAQLKECT 603          
BLAST of Semaphorin-5A-like vs. Ensembl Nematostella
Match: EDO29458 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3K8])

HSP 1 Score: 57.3806 bits (137), Expect = 5.511e-9
Identity = 62/249 (24.90%), Postives = 89/249 (35.74%), Query Frame = 3
Query: 1905 CGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQ---------CKSTVLEL---LAEWSNWSDCFPKCGHGVRTRRRVC-----KYKGLLSEIESEFCSQIELNKCFVN--------------------ECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLE-------VSVEY-DVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            C  G  +R RFC      P + ++   C  DNQ         CK+T  +L    + WSNW+ C   CG GV++R R C     +Y G   + E +        KC V                     + +S   + P G L              G+    +DK+E          EY +++         WS WS WT C   CS  +      TR R C        +  C+G + E + CN   C
Sbjct:   14 CSGGVQSRTRFCLN----PFRGLDRPACRGDNQEERICNNHPCKTTATKLNGGWSSWSNWTACNETCGGGVKSRNRTCTRPSPRYGGADCQGEGDEIKSCRTFKCQVQSKWTTWSPWYPCNVTCPGRIQSRSKKCLDPEGRL-------------DGSVCRGDDKMERVCNTNPCPGEYNNMERVCNTMSGAWSPWSSWTFCSASCSGGTR-----TRLRSCSNPAPQHGRAACQGKVGETQDCNTHPC 240          
BLAST of Semaphorin-5A-like vs. Ensembl Nematostella
Match: EDO39576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9H7])

HSP 1 Score: 51.6026 bits (122), Expect = 9.740e-7
Identity = 74/290 (25.52%), Postives = 101/290 (34.83%), Query Frame = 3
Query: 1731 WSSWERCGKN-ENTCQCRMRNC-----KFG--NCADSDNKEEV---EVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDK-LEVSVEYDVKNYATISEDV---------------WSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESC 2501
            WSSW  C ++       R R C     +FG  NC+   +  EV     +NC  H  W +W  WS CSSKCG G   R R C      +    CPG   +I PC + +     V     +WS ++ C   CG   R+R R C         +S    ++E   C +N C   G  +  G   +          C G K +        + E+   N   +  DV               W  W  W+ C   C         + R RVC           C G   E   C
Sbjct:   71 WSSWTECSRSCGKGIMSRYRECSNPTPRFGGKNCSHIGSAREVVHCNPQNCPIHGNWGAWKMWSFCSSKCGPGKRERIRKCDNPAPRYGGAGCPGSDRQIMPCSLSD---CPVDGNWGQWSEFTHCSATCGAAKRSRTRNCDNPPPAHGGKSCEGDEMEEVYCDLNPCMVHGGYTEWGGWTQ------CAVTCGGGKRQRSRACTSPTPEFGGLNCTHLGPDVQEDDCNTRPCAPDGNWGTWGTWSNCTASCGR-----GFVKRSRVCNSPLPSNGGKPCAGFAHETAEC 346          
BLAST of Semaphorin-5A-like vs. Ensembl Nematostella
Match: EDO41370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4R9])

HSP 1 Score: 46.595 bits (109), Expect = 2.283e-6
Identity = 25/66 (37.88%), Postives = 30/66 (45.45%), Query Frame = 3
Query: 1905 CGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVC 2102
            CG G   R R C     C G S +++ C     C ST+    + W  WS C   CG GVR R R C
Sbjct:   14 CGTGTQLRTRICHSRKSCVGPSTQVRHC-NPQPCPSTLNGGYSPWGAWSGCDADCGGGVRERTRFC 78          
BLAST of Semaphorin-5A-like vs. Ensembl Medaka
Match: sema5bb (semaphorin-5B [Source:NCBI gene;Acc:101155173])

HSP 1 Score: 161.384 bits (407), Expect = 5.759e-40
Identity = 188/809 (23.24%), Postives = 334/809 (41.29%), Query Frame = 3
Query:  303 LLITTNNSIVKFSVNNMNTVYKLE-IPKVDAYSSCFRDKYADQYPCHLF-------GYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTTISRSHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL--CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVD---PFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNEN-----TCQCRMRNC--KFGNCADSDNK-EEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEF-------CSQIELN-------------------KCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            L++   N++ + ++NN++ +   E  P  D   SC + K   Q  C  +       G W     +N         +C +  +++  K+           + P+++  ++V+    +Y      A  ++ F    P  + S  N+  L T    S W+ +     FV  +    F YF L+E A E+D     K V SR+ R+ KND+GG  + L++ + TF+KA + C   S+S E     N ++S F   ++ +++  F++    ++ +A+C ++++ I  AF+G F    +PR +      P+    C    E+     LT R    A +  L  + V P     L+ Q+   ++++ V  ++     Y ++++AT  G I K     T+  L  CY E L +   P+     I  + L++S       L + + D + K+ +E C  + T   C+D   P+C W+    +C + F+ +    +    + +C   +   D  +  W+ W+ C ++E      +C CR R+C      C   + K   ++V NCS +  W+ W+SW  CSS CG G   RQR C           C G+  E + C     C   V      WS+W+ C  +CG GV +R R C+   +     +EF       C  +  N                   + F   C+++ A      L ++     +  N      + E  +E  ++   +  +      W  W  W+ C + CS         TRKR C           C G  ++ + CN   C
Sbjct:   74 LIVGARNALFRLTLNNVSLIQASEWAPDEDTRRSC-QSKGKSQDECQNYIRVLLVSGAWLLTCGTNA-----FTPVCMTRQMSNISKVLETVNGVARCPYDPRHNSTAMVTERGELY------AATVIDFSGRDPVIYRSLGNMPPLRTAQYNSKWLNEP---HFVSSYGIGPFAYFFLRESAVENDC---GKMVFSRVARVCKNDMGGR-FLLEDTWTTFMKARLNC---SRSGEIPFYYNELQSTFHLPEQDLIYGVFTTNVNSLSASAVCAFNLSAITLAFNGAFRYQENPRTAWLSTPNPIPNFQCGTLEEDGPGGNLTERSLQDAQRLFLMNDVVQPATINPLLTQDNVRFSRLVVDIVQGKDALYHVMYIATEYGTILKAL-ATTNKRLHGCYLEELRI--QPQGHTGPIKSLHLLHSDRS----LFVGLDDRLLKIPLERCSSYLTERHCLDTRDPYCGWDHKQKRCCT-FEESSNMNQWTQNITECPVRNLTQDGGFGPWAPWQPCNQDEGDGFFSSCWCRSRSCDEPVAKCGGLECKGPTIQVANCSRNGGWTPWSSWGHCSSSCGIGFEVRQRSCNNPAPRHGGRICVGQGREERLCNEKTPCPLPVS--WTSWSSWTHCSAECGGGVHSRTRTCENGAVCPGCATEFKVCNLEACPDVRRNTPWTPWMPVNVSHDGSRQEQRFRYTCRALLADPQQLQLGKKKLETRFCPNDGSGACQSEPLVEDLLKSSGRTLSHPQNAKWGSWEMWSGCSHPCSGGFR-----TRKRSCSTAEGRTNPAACVGSPVDYQDCNTQPC 845          
BLAST of Semaphorin-5A-like vs. Ensembl Medaka
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:101171867])

HSP 1 Score: 160.999 bits (406), Expect = 6.446e-40
Identity = 201/829 (24.25%), Postives = 338/829 (40.77%), Query Frame = 3
Query:  276 ILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYS--SCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT--------ISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY--IESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQ-ITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKFGNCADSDNKE-----EVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFAN-----------CQGTKSEDEDKLEV------------------SVEYDVKNYATISEDV----WSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            + + P  ++L++   N + + ++ ++  + + E    D ++  +CF    +++       Y   +L     V+ + L+ C +N        +T    T        ++R  + P ++  +++++   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     +TV SR+ R+ KND+GG  + L++ + TF+KA + C        +   NY  ++  F+  + ++L+  F++    IA +A+C ++++ I   F+GPF    + R       N  P     T     +  LT R    A K  L  + V P +      ++   +T + V  ++       I+++AT  G I+K    +   T  C  E + L   PR + P I  + +++S++     L + V D V K+ ++ C  H T ++CV   DP+C W+    KC ++ + + + Q  Q   + +C   +   D  +  WS W  C    G +  +C CR R C   N A     +       EV NCS +  W+ W SWS CS+ CG G   RQR C           C G++ E + C     C   V    + WS W  C   CG G+++RRR C+        +   C Q E   C    C  +   +P         PVN   N           C+  +  D   LEV                  S + +V     IS       WS WS W++C   CS         +RKR C           C G   E + CN   C
Sbjct:   69 LTFDPGQNELIVGARNHLFRLNLEDLTLIQEAEW-HCDEFTKGACFSRGKSEE---ECQNYIRVLL-----VNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQISGMARCPYNPLHNSTALITSSGELY------AATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEPN---FVSSYDIANFTYFFFRENAVEHDC---GRTVFSRVGRVCKNDIGGR-FLLEDTWTTFMKARMNCSRPG----EIPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGPFKYQENSRSAWLPYPNPNPDFKCGTINSGTYVNLTQRNLQDAQKFLLMHDVVQPVVPVPYFMEDNVRFTHVAVDVVQGKDMLLHIIYLATDYGTIRKVLSPLNQSTGSCLLEEIELF-PPRKRQP-IRSLLILHSRSE----LYVGVRDQVIKIPLKRCSYHKTREACVGARDPYCGWDLLLKKCTTLEESVRMSQWEQ--SITKCPVRNVTVDGGFGAWSGWSTCSHNDGGSAGSCLCRTRACD--NPAPQCGGQTCFGISAEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVGQNREERYCNEHLPCPPHVY--WSAWSAWDRCNVPCGGGIQSRRRTCENGN-----DCPGCGQ-EYQSCNTLPCPDVKKTTPWTPWT----PVNISDNGGHYEQRFRYTCK-ARIPDPSMLEVGRQRIEMRYCSSDGSTGCSTDGEVLRLGRISGHTVNGGWSAWSSWSQCSRDCSRGIR-----SRKRTCTNPEPRYGGQTCLGPAQEYQECNITPC 843          
BLAST of Semaphorin-5A-like vs. Ensembl Medaka
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:101171867])

HSP 1 Score: 160.614 bits (405), Expect = 7.934e-40
Identity = 201/829 (24.25%), Postives = 338/829 (40.77%), Query Frame = 3
Query:  276 ILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYS--SCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT--------ISR-SHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY--IESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQ-ITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKFGNCADSDNKE-----EVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFAN-----------CQGTKSEDEDKLEV------------------SVEYDVKNYATISEDV----WSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            + + P  ++L++   N + + ++ ++  + + E    D ++  +CF    +++       Y   +L     V+ + L+ C +N        +T    T        ++R  + P ++  +++++   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     +TV SR+ R+ KND+GG  + L++ + TF+KA + C        +   NY  ++  F+  + ++L+  F++    IA +A+C ++++ I   F+GPF    + R       N  P     T     +  LT R    A K  L  + V P +      ++   +T + V  ++       I+++AT  G I+K    +   T  C  E + L   PR + P I  + +++S++     L + V D V K+ ++ C  H T ++CV   DP+C W+    KC ++ + + + Q  Q   + +C   +   D  +  WS W  C    G +  +C CR R C   N A     +       EV NCS +  W+ W SWS CS+ CG G   RQR C           C G++ E + C     C   V    + WS W  C   CG G+++RRR C+        +   C Q E   C    C  +   +P         PVN   N           C+  +  D   LEV                  S + +V     IS       WS WS W++C   CS         +RKR C           C G   E + CN   C
Sbjct:   69 LTFDPGQNELIVGARNHLFRLNLEDLTLIQEAEW-HCDEFTKGACFSRGKSEE---ECQNYIRVLL-----VNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQISGMARCPYNPLHNSTALITSSGELY------AATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEPN---FVSSYDIANFTYFFFRENAVEHDC---GRTVFSRVGRVCKNDIGGR-FLLEDTWTTFMKARMNCSRPG----EIPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGPFKYQENSRSAWLPYPNPNPDFKCGTINSGTYVNLTQRNLQDAQKFLLMHDVVQPVVPVPYFMEDNVRFTHVAVDVVQGKDMLLHIIYLATDYGTIRKVLSPLNQSTGSCLLEEIELF-PPRKRQP-IRSLLILHSRSE----LYVGVRDQVIKIPLKRCSYHKTREACVGARDPYCGWDLLLKKCTTLEESVRMSQWEQ--SITKCPVRNVTVDGGFGAWSGWSTCSHNDGGSAGSCLCRTRACD--NPAPQCGGQTCFGISAEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVGQNREERYCNEHLPCPPHVY--WSAWSAWDRCNVPCGGGIQSRRRTCENGN-----DCPGCGQ-EYQSCNTLPCPDVKKTTPWTPWT----PVNISDNGGHYEQRFRYTCK-ARIPDPSMLEVGRQRIEMRYCSSDGSTGCSTDGEVLRLGRISGHTVNGGWSAWSSWSQCSRDCSRGIR-----SRKRTCTNPEPRYGGQTCLGPAQEYQECNITPC 843          
BLAST of Semaphorin-5A-like vs. Ensembl Medaka
Match: sema5a (semaphorin 5A [Source:NCBI gene;Acc:101171867])

HSP 1 Score: 160.614 bits (405), Expect = 8.821e-40
Identity = 201/829 (24.25%), Postives = 336/829 (40.53%), Query Frame = 3
Query:  276 ILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYS--SCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTT------ISRSHCPK---YSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPS-ENLKSLSTT-IQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNY--IESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPR-------NSEP-LAFTTCEENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDT-LCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQ-ITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERC----GKNENTCQCRMRNCKFGNCADSDNKE-----EVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC------FQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFAN-----------CQGTKSEDEDKLEV------------------SVEYDVKNYATISEDV----WSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            + + P  ++L++   N + + ++ ++  + + E    D ++  +CF    +++       Y   +L     V+ + L+ C +N        +T    T         + CP    ++  +++++   +Y      A   + F    P  + S   L  L T    S W+ + +   FV  ++  NF YF  +E A E D     +TV SR+ R+ KND+GG  + L++ + TF+KA + C        +   NY  ++  F+  + ++L+  F++    IA +A+C ++++ I   F+GPF    + R       N  P     T     +  LT R    A K  L  + V P +      ++   +T + V  ++       I+++AT  G I+K    +   T  C  E + L   PR + P I  + +++S++     L + V D V K+ ++ C  H T ++CV   DP+C W+    KC ++ + + + Q  Q   + +C   +   D  +  WS W  C    G +  +C CR R C   N A     +       EV NCS +  W+ W SWS CS+ CG G   RQR C           C G++ E + C     C   V    + WS W  C   CG G+++RRR C+        +   C Q E   C    C  +   +P         PVN   N           C+  +  D   LEV                  S + +V     IS       WS WS W++C   CS         +RKR C           C G   E + CN   C
Sbjct:   69 LTFDPGQNELIVGARNHLFRLNLEDLTLIQEAEW-HCDEFTKGACFSRGKSEE---ECQNYIRVLL-----VNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQISGMARCPYNPLHNSTALITSSGELY------AATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEPN---FVSSYDIANFTYFFFRENAVEHDC---GRTVFSRVGRVCKNDIGGR-FLLEDTWTTFMKARMNCSRPG----EIPFNYNELQGTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGPFKYQENSRSAWLPYPNPNPDFKCGTINSGTYVNLTQRNLQDAQKFLLMHDVVQPVVPVPYFMEDNVRFTHVAVDVVQGKDMLLHIIYLATDYGTIRKVLSPLNQSTGSCLLEEIELF-PPRKRQP-IRSLLILHSRSE----LYVGVRDQVIKIPLKRCSYHKTREACVGARDPYCGWDLLLKKCTTLEESVRMSQWEQ--SITKCPVRNVTVDGGFGAWSGWSTCSHNDGGSAGSCLCRTRACD--NPAPQCGGQTCFGISAEVANCSRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVGQNREERYCNEHLPCPPHVY--WSAWSAWDRCNVPCGGGIQSRRRTCENGN-----DCPGCGQ-EYQSCNTLPCPDVKKTTPWTPWT----PVNISDNGGHYEQRFRYTCK-ARIPDPSMLEVGRQRIEMRYCSSDGSTGCSTDGEVLRLGRISGHTVNGGWSAWSSWSQCSRDCSRGIR-----SRKRTCTNPEPRYGGQTCLGPAQEYQECNITPC 843          
BLAST of Semaphorin-5A-like vs. Ensembl Medaka
Match: sema5ba (semaphorin 5B [Source:NCBI gene;Acc:101159709])

HSP 1 Score: 159.844 bits (403), Expect = 1.582e-39
Identity = 194/812 (23.89%), Postives = 338/812 (41.63%), Query Frame = 3
Query:  297 DDLLITTNNSIVKFSVNNMNTVYKLE-IPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDV----DDHLLYICHSNGLASYYKIKTFEKTTISRSHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQ--SSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLE-DTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNS-----EPLAFTTC----EENKFDCLTYR----ASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTL-CYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCV---DPFCFWEQTTGKCVSIFQIT-VYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNE-----NTCQCRMRNC--KFGNCADSD-NKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTV----LELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISP----MGTLVEELGP-----VNYFANCQ----------------------GTKSEDEDKL-EVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLC 2516
            ++L++   N + +  +NNM+     E  P  +   SC + K   +  C    Y   +L +  +V     +    +C +  + +  ++           + P+++  SVV+    +Y      A  ++ F    P  + S        T Q  S W+ +     F+  +E   F +F L+E A E D     KTV SR+ R+ KND+GG  + L++ + TF+KA + C   S+S E     N ++S F+  ++ +++  F++    IA +A+C ++++ I  AF+GPF S  +PR++      P+    C    +    + LT R    A +  L  + V P     LV Q++  ++ + V  ++     Y +++++T  G I K       +   CY E + LL  P      I  +++++S       L + +SD V K+ +E C  + T   C+   DP+C W+    +C ++   + + Q +Q   +  C   ++  +  +  W+ W+ C  ++     ++C CR R+C      C   +     +EV NCS +  W+ W+SW +CS+ CG G   RQR C       G  V + P   +  C   V          WS+W+ C   CG GV +R R C+            C+ +E   C +  C  +   +P    M   V + G        Y                           GT + + D L E  ++  V   A +    WS W  W+ C   CS         TR+R C           CRG  +E + CN   C
Sbjct:   87 NELIVGARNYLFRLDLNNMSLAQATEWAPDEETRRSC-QSKGKTEIECQ--NYIRVLLLNKTEVMTCGTNAFQPLCITREVGNMSRVLERVNGVARCPYDPRHNSTSVVTESGELY------AATVIDFSGRDPVIYRSLGGMPPLRTAQYNSKWLNEP---HFISAYEIGLFTFFFLRENAVEHDC---GKTVYSRVARVCKNDIGGR-FLLEDTWTTFMKARLNC---SRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLSAITQAFNGPFRSQENPRSTWLPTPNPIRDFQCGTISDHGPNEGLTERSLQDAQRLYLMNDVVQPESVDPLVMQDDVRFSNLVVDIVQGMDTLYHVMYISTEYGTILKALATPNKNLQGCYLEEMELL--PPGVQEPILSLQILHSDR----SLFVGLSDRVMKIPLERCGTYKTESMCLEARDPYCGWDFRKRRCTTLEDSSNMSQWKQ--NITICPLRNQTTNGGFGPWAQWQPCNNDDPVDGVSSCLCRSRSCDSPLPRCGGKNCVGTTIEVSNCSRNGGWTPWSSWGQCSTTCGTGFELRQRSCNNPSPRHGGRVCVGPSRDERFCNEGVPCPQPIFWTPWSSWTKCSTACGGGVHSRVRTCENGN-----SCPGCA-LEYKACNLEACPEVKRNTPWTPWMPFNVTQSGARHEQRTRYMCRAHLSDPHELQIGRRKTETRICKHDGTAACETDSLVEELLKIPVVRVAGLG---WSSWETWSSCSQSCSKGYR-----TRRRTCTGPEGKSAPVACRGSPVEYQDCNVQAC 857          
BLAST of Semaphorin-5A-like vs. Planmine SMEST
Match: SMESG000037895.1 (SMESG000037895.1)

HSP 1 Score: 1733 bits (4487), Expect = 0.000e+0
Identity = 885/910 (97.25%), Postives = 889/910 (97.69%), Query Frame = 3
Query:  120 MNAGICXXXXXXXXXXXXAHSNVLFFHDLYSKSPYVANHFYRPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKYADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTTISRSHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIHVILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGXXXXXXXXXXXXXXTHFGWTSIESNTASLRFTKKPFLQPTHILTP 2849
            MNAGICLPILILVMLLLPAHSNVLFFHDLYSKSPYVANHFYRPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMN VYKLEIPKVDAYSSCFRDKYA+QYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTTISRSHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQD+TVKSRIVRIKKNDVGGSGYTLKENFITFLKATII                   FFDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFT CEENKFDCL++RASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQWSSWNSWSECSSKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIHVILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGQSYSPSQQSPPHSPTHFGWTSIESNTASLRFTKKPFLQPTHILTP
Sbjct:    1 MNAGICLPILILVMLLLPAHSNVLFFHDLYSKSPYVANHFYRPLDYVSFRDSILYPPNTDDLLITTNNSIVKFSVNNMNIVYKLEIPKVDAYSSCFRDKYAEQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTTISRSHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLSTTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDRTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIILV-----------------FFDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTKCEENKFDCLSHRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQWSSWNSWSECSSKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIHVILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGQSYSPSQQSPPHSPTHFGWTSIESNTASLRFTKKPFLQPTHILTP 893          
BLAST of Semaphorin-5A-like vs. Planmine SMEST
Match: SMESG000045754.1 (SMESG000045754.1)

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 650/655 (99.24%), Postives = 653/655 (99.69%), Query Frame = 3
Query:  885 NDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIHVILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGXXXXXXXXXXXXXXTHFGWTSIESNTASLRFTKKPFLQPTHILTP 2849
            NDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESG+FDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFT CEENKFDCLT+RASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQWSSWNSWSECSSKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELG VNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIH+ILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGQSYSPSQQSPPHSPTHFGWTSIESNTASLRFTKKPFLQPTHILTP
Sbjct:  100 NDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGYFDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTKCEENKFDCLTHRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQWSSWNSWSECSSKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGAVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIHIILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGQSYSPSQQSPPHSPTHFGWTSIESNTASLRFTKKPFLQPTHILTP 754          
BLAST of Semaphorin-5A-like vs. Planmine SMEST
Match: SMESG000045754.1 (SMESG000045754.1)

HSP 1 Score: 1275.38 bits (3299), Expect = 0.000e+0
Identity = 648/655 (98.93%), Postives = 651/655 (99.39%), Query Frame = 3
Query:  885 NDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIHVILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGXXXXXXXXXXXXXXTHFGWTSIESNTASLRFTKKPFLQPTHILTP 2849
            NDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESG+FDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFT CEENKFDCLT+RASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQWSSWNSWSECSSKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQC  TVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELG VNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIH+ILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGQSYSPSQQSPPHSPTHFGWTSIESNTASLRFTKKPFLQPTHILTP
Sbjct:  100 NDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGYFDKDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTKCEENKFDCLTHRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQWSSWNSWSECSSKCGKGNSTRQRFCFQNDYCPGKSVEIKPCLVDNQC--TVLELLAEWSNWSDCFPKCGHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTLVEELGAVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWTECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCFKASKSPEGKGFQIIHIILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQNTWQTQSLPRNSFIGQSYSPSQQSPPHSPTHFGWTSIESNTASLRFTKKPFLQPTHILTP 752          
BLAST of Semaphorin-5A-like vs. Planmine SMEST
Match: SMESG000033853.1 (SMESG000033853.1)

HSP 1 Score: 101.679 bits (252), Expect = 1.387e-21
Identity = 161/671 (23.99%), Postives = 281/671 (41.88%), Query Frame = 3
Query:  234 HFYRPLDYVSFRDSILYPPNTDDLLITTN-NSIVKFSVNNMNTVYKLEIPKVDAYSSC---------FRDKYADQYPCHLFGYWTKILPSNMD-VDDHLLYICHSNGLASYYKIKTFEKTTISRSHCPKYSIVSVVSADLHIYVGDLERAPK-ILRFKPEYPTGFPSENLKSLS-TTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICP--DKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPR-------ITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC----FQND--YCPGKSVEIKPCLVDNQCKSTVLE----LLAEWSNWSDCFPKCGHGVRTRRRVC---KYKGLLSEIES 2135
            H Y   DY +F+  + Y PN+D + + +N N IV+  +NN+N   K  + K      C         F       + C  F Y   +L SN + ++D + Y      LAS +  +   KT IS     ++  V   ++D + Y G   ++ K ++ FK   P  F  +NL +++   +  S I+       +  F++N  VYFL  E   +    C++  + +R++R+ +ND G +     E F  F K  + C   + ++++         +G +    + L  TF+S   E  ++AIC Y++  IE AF+         ++SE  ++    E K  C  +        F   L  L K      + + +Q   I  E  ++ ++I    +S     +    ++  T   +  L + L P+    R       IT +K +N  +  + +L +  S  + K+ ++ C + +T   C  PFC+W+  T KC  +     + L    +    S   +  ++   QW          +  Q  M  C      D +  +      C     W+ ++SWS+CS+ CG G   R RFC     QN    C G + E + C V+ +C     E      ++W+ WS C   CG   ++R R C   K    L+EI+S
Sbjct:   11 HQYAMADYGNFKH-LSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWIC--FNY---MLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSD--LEHRTVHSATSD-YTYAGLYMKSYKELMIFKN--PLVFTHDNLSNVNKINLPRSVIKAPG--DIITSFQHNKSVYFLYTET--DFLCGCKENVLVTRLIRLCENDKGLTS----EQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSEL-----KKSSEKTSYKF-NEYKNICQLFTTGNQDSNFLTNLQTLCKTYPLHRDIVTSQ--AILYETRTKFFEIASEESSWSNNLRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETD--KIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKS 651          
BLAST of Semaphorin-5A-like vs. Planmine SMEST
Match: SMESG000033853.1 (SMESG000033853.1)

HSP 1 Score: 101.679 bits (252), Expect = 1.432e-21
Identity = 161/671 (23.99%), Postives = 281/671 (41.88%), Query Frame = 3
Query:  234 HFYRPLDYVSFRDSILYPPNTDDLLITTN-NSIVKFSVNNMNTVYKLEIPKVDAYSSC---------FRDKYADQYPCHLFGYWTKILPSNMD-VDDHLLYICHSNGLASYYKIKTFEKTTISRSHCPKYSIVSVVSADLHIYVGDLERAPK-ILRFKPEYPTGFPSENLKSLS-TTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRIVRIKKNDVGGSGYTLKENFITFLKATIICP--DKSKSLEDTSLNYIESGFFDKDRQILFSTFSSG--EIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAFTTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIERSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPR-------ITDMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQTTGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENTCQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQXXXXXXXXXXXXKCGKGNSTRQRFC----FQND--YCPGKSVEIKPCLVDNQCKSTVLE----LLAEWSNWSDCFPKCGHGVRTRRRVC---KYKGLLSEIES 2135
            H Y   DY +F+  + Y PN+D + + +N N IV+  +NN+N   K  + K      C         F       + C  F Y   +L SN + ++D + Y      LAS +  +   KT IS     ++  V   ++D + Y G   ++ K ++ FK   P  F  +NL +++   +  S I+       +  F++N  VYFL  E   +    C++  + +R++R+ +ND G +     E F  F K  + C   + ++++         +G +    + L  TF+S   E  ++AIC Y++  IE AF+         ++SE  ++    E K  C  +        F   L  L K      + + +Q   I  E  ++ ++I    +S     +    ++  T   +  L + L P+    R       IT +K +N  +  + +L +  S  + K+ ++ C + +T   C  PFC+W+  T KC  +     + L    +    S   +  ++   QW          +  Q  M  C      D +  +      C     W+ ++SWS+CS+ CG G   R RFC     QN    C G + E + C V+ +C     E      ++W+ WS C   CG   ++R R C   K    L+EI+S
Sbjct:   44 HQYAMADYGNFKH-LSYIPNSDHIYVVSNENEIVRLKLNNLNFDSKYTLKKQCTSEQCEKIIIDVVQFAKDSKILWIC--FNY---MLYSNTNKLEDQMCYALKKENLASDHIAQWTGKTFISSDL--EHRTVHSATSD-YTYAGLYMKSYKELMIFKN--PLVFTHDNLSNVNKINLPRSVIKAPG--DIITSFQHNKSVYFLYTET--DFLCGCKENVLVTRLIRLCENDKGLTS----EQFSVFNKVNVECQQVNSNRAIPPFKYRIATNGHWLSLSKQLVVTFTSNYKEFESSAICVYTIKSIEDAFNSEL-----KKSSEKTSYKF-NEYKNICQLFTTGNQDSNFLTNLQTLCKTYPLHRDIVTSQ--AILYETRTKFFEIASEESSWSNNLRVVLFVSTQTKHVTSLLEISLQPKICILRKFLLSENITLLKTVNETD--KIYLFVGTSHRIVKIPLDMCYLQATDTQCSAPFCYWDNITKKCKYVSTKNQFLLISNSKTYCASSLKENQNAVLNQWVQCRLKSIVNDLSQIGMCKCNIERNTDLNEIKLTISPECKVDGDWTVYSSWSDCSATCGNGTRVRSRFCDNPKPQNGGKECTGNNTEYQIC-VNKKCDELNFENTRGRYSQWTTWSACSKTCGFSTKSRSRQCISEKCTESLNEIKS 684          
The following BLAST results are available for this feature:
BLAST of Semaphorin-5A-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEMA5B6.474e-4623.91semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B1.902e-4523.79semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B2.154e-4524.00semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B2.360e-4524.00semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
SEMA5B2.360e-4524.00semaphorin 5B [Source:HGNC Symbol;Acc:HGNC:10737][more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smp-13.350e-1423.30Semaphorin-1A [Source:UniProtKB/Swiss-Prot;Acc:Q1... [more]
mab-201.725e-824.19Semaphorin-2A [Source:UniProtKB/Swiss-Prot;Acc:Q9... [more]
mab-201.911e-824.78Semaphorin-2A [Source:UniProtKB/Swiss-Prot;Acc:Q9... [more]
mab-202.716e-824.19Semaphorin-2A [Source:UniProtKB/Swiss-Prot;Acc:Q9... [more]
adt-23.126e-725.57A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sema5c2.724e-4226.34gene:FBgn0284221 transcript:FBtr0076052[more]
Sema5c2.988e-4226.34gene:FBgn0284221 transcript:FBtr0300339[more]
Sema2b2.615e-1627.27gene:FBgn0264273 transcript:FBtr0290009[more]
Sema2b2.635e-1627.27gene:FBgn0264273 transcript:FBtr0329991[more]
Sema2b2.635e-1627.27gene:FBgn0264273 transcript:FBtr0100001[more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5bb1.224e-4125.77sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5bb1.256e-4125.77sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba2.494e-3925.35sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba2.494e-3925.35sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5ba2.494e-3925.35sema domain, seven thrombospondin repeats (type 1 ... [more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
micall22.983e-1927.81MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747][more]
micall23.855e-1927.81MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747][more]
micall24.327e-1927.42MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747][more]
micall24.730e-1927.42MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747][more]
micall24.843e-1927.81MICAL-like 2 [Source:Xenbase;Acc:XB-GENE-979747][more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sema5b1.492e-4323.62sema domain, seven thrombospondin repeats (type 1 ... [more]
Sema5a2.664e-4123.17sema domain, seven thrombospondin repeats (type 1 ... [more]
Sema5b3.505e-4124.67sema domain, seven thrombospondin repeats (type 1 ... [more]
Sema3b2.463e-2026.74sema domain, immunoglobulin domain (Ig), short bas... [more]
Sema3b2.463e-2026.74sema domain, immunoglobulin domain (Ig), short bas... [more]
back to top
BLAST of Semaphorin-5A-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P283|SEM5B_HUMAN1.133e-4424.00Semaphorin-5B OS=Homo sapiens OX=9606 GN=SEMA5B PE... [more]
sp|Q60519|SEM5B_MOUSE1.044e-4223.62Semaphorin-5B OS=Mus musculus OX=10090 GN=Sema5b P... [more]
sp|D3ZTD8|SEM5A_RAT5.405e-4123.41Semaphorin-5A OS=Rattus norvegicus OX=10116 GN=Sem... [more]
sp|Q62217|SEM5A_MOUSE1.732e-4023.05Semaphorin-5A OS=Mus musculus OX=10090 GN=Sema5a P... [more]
sp|Q13591|SEM5A_HUMAN9.680e-3922.81Semaphorin-5A OS=Homo sapiens OX=9606 GN=SEMA5A PE... [more]
back to top
BLAST of Semaphorin-5A-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7NYD02.095e-4824.46Sema domain-containing protein OS=Macaca fascicula... [more]
A0A5F7ZQD71.507e-4523.94Semaphorin 5B OS=Macaca mulatta OX=9544 GN=SEMA5B ... [more]
G7MKK34.425e-4524.27Sema domain-containing protein OS=Macaca mulatta O... [more]
A0A3Q7RKN85.498e-4525.15semaphorin-5B OS=Vulpes vulpes OX=9627 GN=SEMA5B P... [more]
A0A2K5ENW66.412e-4524.18Semaphorin 5B OS=Aotus nancymaae OX=37293 GN=SEMA5... [more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5bb1.607e-4325.59sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5a1.917e-4224.58semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
sema5a2.328e-4224.58semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
sema5a2.807e-4224.58semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
sema5a1.198e-4126.25semaphorin 5A [Source:NCBI gene;Acc:103027847][more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5a2.521e-2925.35sema domain, seven thrombospondin repeats (type 1 ... [more]
sema5a5.927e-2123.98sema domain, seven thrombospondin repeats (type 1 ... [more]
sema3ab2.336e-2025.58sema domain, immunoglobulin domain (Ig), short bas... [more]
sema3d5.212e-1825.08sema domain, immunoglobulin domain (Ig), short bas... [more]
SEMA3F3.337e-1725.98semaphorin 3F [Source:HGNC Symbol;Acc:HGNC:10728][more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO489145.157e-2723.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294585.511e-924.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395769.740e-725.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413702.283e-637.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Semaphorin-5A-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema5bb5.759e-4023.24semaphorin-5B [Source:NCBI gene;Acc:101155173][more]
sema5a6.446e-4024.25semaphorin 5A [Source:NCBI gene;Acc:101171867][more]
sema5a7.934e-4024.25semaphorin 5A [Source:NCBI gene;Acc:101171867][more]
sema5a8.821e-4024.25semaphorin 5A [Source:NCBI gene;Acc:101171867][more]
sema5ba1.582e-3923.89semaphorin 5B [Source:NCBI gene;Acc:101159709][more]
back to top
BLAST of Semaphorin-5A-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037895.10.000e+097.25SMESG000037895.1[more]
SMESG000045754.10.000e+099.24SMESG000045754.1[more]
SMESG000045754.10.000e+098.93SMESG000045754.1[more]
SMESG000033853.11.387e-2123.99SMESG000033853.1[more]
SMESG000033853.11.432e-2123.99SMESG000033853.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017892 ID=SMED30017892|Name=Semaphorin-5A-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2910bp
GATCTCAAACACGCAAAGGTGCACTCACACGCACGTGATTCACCAGCAGC
ACAAATTCACTGTGCTTATCAACTACTTGCACAGTGACAATTCAATAAAT
CAATACAGCACAATCAATAATGAATGCTGGAATTTGTCTGCCGATTCTCA
TTCTGGTGATGCTTCTTCTTCCTGCTCATTCAAATGTGCTTTTCTTTCAT
GATTTATATTCAAAATCGCCTTACGTTGCAAATCATTTCTACCGGCCACT
TGATTATGTTTCTTTTAGGGACTCCATTTTGTACCCTCCCAACACGGACG
ACTTGTTAATAACCACCAACAACTCCATTGTCAAATTCAGTGTCAATAAT
ATGAATACTGTTTACAAACTTGAAATCCCCAAAGTTGATGCCTATTCTTC
TTGTTTTAGGGATAAATATGCTGATCAGTATCCCTGTCACCTATTCGGCT
ACTGGACTAAAATCCTGCCTTCAAATATGGATGTTGATGACCACCTACTC
TACATCTGCCATAGTAACGGATTGGCAAGCTATTATAAAATTAAAACCTT
TGAGAAGACAACAATAAGTCGATCCCATTGTCCAAAATACAGCATCGTTA
GTGTTGTGTCGGCAGATTTGCATATCTATGTTGGAGATTTGGAAAGGGCG
CCAAAAATATTACGTTTCAAACCAGAATATCCAACTGGTTTTCCATCTGA
AAATTTAAAAAGCCTTTCTACCACGATACAGTCATCATGGATCCAACAAA
ACGATTATTTGCAATTTGTTTACGTTTTCGAGAATAACAATTTTGTTTAT
TTTCTGCTCAAAGAAGTTGCTGATGAAGACGACAAATTTTGTCAAGATAA
AACAGTCAAATCAAGAATTGTTAGAATCAAGAAGAATGACGTTGGAGGCT
CAGGCTACACGTTGAAAGAAAACTTTATAACATTTCTTAAAGCCACCATT
ATATGTCCTGATAAATCAAAAAGTCTCGAAGATACATCATTGAACTACAT
TGAAAGTGGTTTTTTTGACAAGGATAGGCAGATTTTATTCTCAACGTTTT
CATCTGGAGAAATAGCAACTACTGCAATATGCCAGTATTCTATGAATGAC
ATTGAATCGGCTTTCGATGGTCCTTTTGTCAGTACTCTAGATCCACGGAA
TTCCGAACCACTGGCATTTACAACGTGTGAAGAAAACAAGTTTGATTGTC
TTACTTACCGGGCCTCGAAACATCAACTGAAATTCAACCCAGTTTTACCG
AATCTAAAAAAGAATTTGGTGTTTCAAAACGAAGAAATATGGACACAGAT
CCAAGTGATCTCGATTGAGCGATCGTCTCGCCAATACGACATTGTTTTTG
TCGCTACTTCAAAGGGTCAAATCAAAAAGTTTTACCGTAAAATAACCGAT
GATACTCTTTGTTATTCGGAAACTTTGTCTCTCCTGCTCAACCCAAGAGA
CAAGGCCCCCCGAATTACTGATATGAAATTAATCAATTCAAAGAACTTTG
CTCAGCCCTTTTTGATAATCACAGTATCGGATGGAGTTTACAAAGTCGGC
ATAGAACATTGTGTCATCCATTCAACCGTAGACAGCTGTGTTGATCCCTT
CTGCTTCTGGGAGCAGACTACAGGGAAATGTGTTTCAATATTCCAGATAA
CTGTCTATCAATTGAGACAGCTTCCTGAATTAAAACAATGTTCGGATGGA
GATAAAATTTTCGATTCAAAATGGCAGCAGTGGTCATCATGGGAGAGATG
TGGAAAAAATGAAAATACTTGTCAGTGTAGAATGAGAAACTGCAAGTTTG
GTAATTGTGCAGACTCTGACAATAAGGAAGAAGTCGAAGTAAAAAATTGC
AGTTTCCATCACCAATGGTCGTCCTGGAATTCTTGGTCTGAATGCAGTTC
CAAATGTGGTAAGGGTAACTCCACTAGACAGAGATTTTGCTTTCAAAATG
ATTACTGCCCGGGTAAGTCTGTGGAAATCAAGCCTTGCCTCGTTGATAAC
CAATGTAAAAGTACTGTGTTAGAGTTGCTCGCTGAATGGAGCAATTGGTC
AGACTGTTTTCCAAAATGTGGTCATGGGGTGAGGACTAGAAGGAGGGTGT
GTAAATATAAAGGTCTTCTAAGTGAAATAGAATCGGAATTCTGCTCTCAA
ATAGAGTTGAATAAATGTTTTGTCAATGAATGCAAAAGTATTGGTGCGAT
ATCTCCCATGGGAACATTGGTTGAAGAATTAGGCCCAGTGAATTACTTTG
CAAATTGTCAAGGCACTAAGTCTGAGGATGAGGATAAATTAGAAGTCTCA
GTTGAATATGACGTAAAGAATTACGCAACAATATCAGAAGATGTATGGAG
TTGCTGGAGTAAATGGACCGAATGTCAGAATCACTGTTCAGATTTTTCTG
AAGAAATCAGTAAGATTACAAGAAAGCGGGTTTGTCAAATTGAAAATGAC
TATTTGAAAAAGGATTTGTGTAGAGGATTATTGCTAGAAGAGGAAAGTTG
TAATGAAGATTTATGTTTCAAAGCTTCAAAGTCTCCAGAAGGAAAAGGAT
TTCAAATAATTCACGTCATATTAGTTGGAGTGGCGTCATTTACTTTTAGT
TGTTTAACGGTAGTTGCAGGGGTCTGTATATATTTTGCAAAGAAAAAACC
TTTAACGAAGCATCTTCAAAATACATGGCAAACTCAATCTTTGCCAAGAA
ATTCATTTATTGGACAATCATATTCTCCTTCTCAACAAAGTCCTCCTCAT
TCACCAACTCATTTTGGATGGACTTCGATTGAAAGTAACACAGCAAGTTT
AAGATTCACCAAGAAACCGTTTCTACAACCTACTCACATTCTCACGCCAT
AGTAATATATTGAAATGTATTAATTGTTTTAATGAATTAAATAGACTATT
TTATTAATGT
back to top

protein sequence of SMED30017892-orf-1

>SMED30017892-orf-1 ID=SMED30017892-orf-1|Name=SMED30017892-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=911bp
MNAGICLPILILVMLLLPAHSNVLFFHDLYSKSPYVANHFYRPLDYVSFR
DSILYPPNTDDLLITTNNSIVKFSVNNMNTVYKLEIPKVDAYSSCFRDKY
ADQYPCHLFGYWTKILPSNMDVDDHLLYICHSNGLASYYKIKTFEKTTIS
RSHCPKYSIVSVVSADLHIYVGDLERAPKILRFKPEYPTGFPSENLKSLS
TTIQSSWIQQNDYLQFVYVFENNNFVYFLLKEVADEDDKFCQDKTVKSRI
VRIKKNDVGGSGYTLKENFITFLKATIICPDKSKSLEDTSLNYIESGFFD
KDRQILFSTFSSGEIATTAICQYSMNDIESAFDGPFVSTLDPRNSEPLAF
TTCEENKFDCLTYRASKHQLKFNPVLPNLKKNLVFQNEEIWTQIQVISIE
RSSRQYDIVFVATSKGQIKKFYRKITDDTLCYSETLSLLLNPRDKAPRIT
DMKLINSKNFAQPFLIITVSDGVYKVGIEHCVIHSTVDSCVDPFCFWEQT
TGKCVSIFQITVYQLRQLPELKQCSDGDKIFDSKWQQWSSWERCGKNENT
CQCRMRNCKFGNCADSDNKEEVEVKNCSFHHQWSSWNSWSECSSKCGKGN
STRQRFCFQNDYCPGKSVEIKPCLVDNQCKSTVLELLAEWSNWSDCFPKC
GHGVRTRRRVCKYKGLLSEIESEFCSQIELNKCFVNECKSIGAISPMGTL
VEELGPVNYFANCQGTKSEDEDKLEVSVEYDVKNYATISEDVWSCWSKWT
ECQNHCSDFSEEISKITRKRVCQIENDYLKKDLCRGLLLEEESCNEDLCF
KASKSPEGKGFQIIHVILVGVASFTFSCLTVVAGVCIYFAKKKPLTKHLQ
NTWQTQSLPRNSFIGQSYSPSQQSPPHSPTHFGWTSIESNTASLRFTKKP
FLQPTHILTP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0030215semaphorin receptor binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR036352Semap_dom_sf
IPR001627Semap_dom
IPR000884TSP1_rpt
IPR015943WD40/YVTN_repeat-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 211..254
e-value: 6.5
score: 2.1
coord: 419..476
e-value: 0.5
score: 11.9
coord: 313..365
e-value: 8.3E-5
score: 32.0
coord: 259..306
e-value: 2.0E-8
score: 44.0
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 260..305
e-value: 4.0E-8
score: 33.3
coord: 315..364
e-value: 3.6E-6
score: 27.1
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 257..306
score: 11.33
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 416..476
score: 8.871
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 310..365
score: 8.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..159
e-value: 4.6E-13
score: 50.4
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 255..305
e-value: 3.6E-9
score: 38.8
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 417..475
e-value: 3.9E-6
score: 29.0
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 310..364
e-value: 2.7E-8
score: 35.9
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 256..300
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 417..471
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 313..364
NoneNo IPR availablePANTHERPTHR22906:SF30COMPLEMENT FACTOR PROPERDINcoord: 191..360
coord: 313..476
NoneNo IPR availablePANTHERPTHR22906PROPERDINcoord: 313..476
NoneNo IPR availablePANTHERPTHR22906PROPERDINcoord: 191..360
NoneNo IPR availableTMHMMTMhelixcoord: 493..515
IPR001627Sema domainPROSITEPS51004SEMAcoord: 1..154
score: 10.225
IPR036352Sema domain superfamilySUPERFAMILYSSF101912Sema domaincoord: 1..159