TLC domain-containing protein

Overview
NameTLC domain-containing protein
Smed IDSMED30017888
Length (bp)987
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TLC domain-containing protein (SMED30017888) t-SNE clustered cells

Violin plots show distribution of expression levels for TLC domain-containing protein (SMED30017888) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TLC domain-containing protein (SMED30017888) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TLC domain-containing protein (SMED30017888) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017888

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017888h1SMcG0013377 dd_Smed_v4_9135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017888h1SMcG0013377 dd_Smed_v4_9135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017888h1SMcG0013377 dd_Smed_v4_9135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017888h1SMcG0013377 dd_Smed_v6_9135_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30017888h1SMcG0013377 dd_Smed_v4_9135_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TLC domain-containing protein vs. Ensembl Human
Match: TLCD1 (TLC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25177])

HSP 1 Score: 60.077 bits (144), Expect = 8.457e-10
Identity = 31/143 (21.68%), Postives = 76/143 (53.15%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECILS-FSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYC---INTAMLFI 541
            P++    HN L+S  H++++ I  LL ++ + ++  +++ + + +  +L  FS GYF++D+  ++  G     +  ++HH+  +    + +    F+   +  ++VE++NIF+ +R +M+  +  +   Y     +N  M F+
Sbjct:   39 PLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFL 181          
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Match: Y48G8AL.13 (pep chromosome:WBcel235:I:1223959:1227858:-1 gene:WBGene00021691.1 transcript:Y48G8AL.13a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G8AL.13)

HSP 1 Score: 48.1358 bits (113), Expect = 3.529e-6
Identity = 32/111 (28.83%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  155 LISLTHAVITSINCLL-LIFYSEEIRNDLKASNTYAECILSFSFGYFLYDSCSL-IKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMR 481
            ++S THA+++++ C+  L+     +R         AE +  FS GYF+YD   + I   L S + ++ IHH  V+   +  L +      ++  ++VEI  +F+HLR ++R
Sbjct:   44 VVSFTHALVSALGCIFSLLTDVNYVREPYDYHKANAEYVFLFSMGYFIYDLLDMHIHGELESSKEYL-IHHSLVITAFSIILLSGRLFGLAMIALLVEIQTVFLHLRTMVR 153          
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Match: Y48G8AL.13 (pep chromosome:WBcel235:I:1223959:1229282:-1 gene:WBGene00021691.1 transcript:Y48G8AL.13a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G8AL.13)

HSP 1 Score: 48.1358 bits (113), Expect = 3.529e-6
Identity = 32/111 (28.83%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  155 LISLTHAVITSINCLL-LIFYSEEIRNDLKASNTYAECILSFSFGYFLYDSCSL-IKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMR 481
            ++S THA+++++ C+  L+     +R         AE +  FS GYF+YD   + I   L S + ++ IHH  V+   +  L +      ++  ++VEI  +F+HLR ++R
Sbjct:   44 VVSFTHALVSALGCIFSLLTDVNYVREPYDYHKANAEYVFLFSMGYFIYDLLDMHIHGELESSKEYL-IHHSLVITAFSIILLSGRLFGLAMIALLVEIQTVFLHLRTMVR 153          
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Match: Y48G8AL.13 (pep chromosome:WBcel235:I:1223957:1226812:-1 gene:WBGene00021691.1 transcript:Y48G8AL.13a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G8AL.13)

HSP 1 Score: 48.1358 bits (113), Expect = 3.529e-6
Identity = 32/111 (28.83%), Postives = 59/111 (53.15%), Query Frame = 2
Query:  155 LISLTHAVITSINCLL-LIFYSEEIRNDLKASNTYAECILSFSFGYFLYDSCSL-IKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMR 481
            ++S THA+++++ C+  L+     +R         AE +  FS GYF+YD   + I   L S + ++ IHH  V+   +  L +      ++  ++VEI  +F+HLR ++R
Sbjct:   44 VVSFTHALVSALGCIFSLLTDVNYVREPYDYHKANAEYVFLFSMGYFIYDLLDMHIHGELESSKEYL-IHHSLVITAFSIILLSGRLFGLAMIALLVEIQTVFLHLRTMVR 153          
BLAST of TLC domain-containing protein vs. Ensembl Zebrafish
Match: tlcd1 (TLC domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041010-173])

HSP 1 Score: 58.5362 bits (140), Expect = 1.647e-9
Identity = 37/155 (23.87%), Postives = 78/155 (50.32%), Query Frame = 2
Query:  131 KLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNT-YAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYL 592
            K  +  N  +SL H+++T    +  + Y   + +++ ++ T  A  ++  S GYF+ D+  ++  G     +  ++HH+ VL     A+    ++A ++  + VE+N++F+H R L+    V      Y +N  +  +++V  R G    L++YL
Sbjct:   45 KTWKWRNLSVSLVHSLLTGTWAVACVIYYPAMVHEIHSTYTPSAYMLVVVSSGYFIEDAADIVFSGHAKASWEFLLHHVLVLWCFLYAVFTHQYVAGAVVALFVEVNSVFLHTRLLLNLAKVAHSSLIYTVNKVLNVVTYVTFRLGAQFYLTWYL 199          
BLAST of TLC domain-containing protein vs. Ensembl Zebrafish
Match: tlcd2 (TLC domain containing 2 [Source:NCBI gene;Acc:559420])

HSP 1 Score: 56.9954 bits (136), Expect = 5.111e-9
Identity = 42/188 (22.34%), Postives = 99/188 (52.66%), Query Frame = 2
Query:  140 ECHNYLISLTHAVITSINCLLLIFYSEEIRNDL-KASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQEHVIIIVAVYPAFIGFLILNVYMSCLLMFK 700
            + +N   S  H++IT +  +L      ++  DL +  + ++  ++S S GYF+YD   ++        + ++ HH+ V+     ++    ++ F++  ++VEIN++F+HLR+++R  ++ +  FY  +N+ +   ++V+ R   L  ++ +L   VL   +I + +     +G  I+   M+ +L ++
Sbjct:   39 KWNNISTSFVHSLITGVWSVLCFCMHPQMAEDLIETHSVFSHALVSVSIGYFIYDFLDMVINQKIIHSWELLFHHVVVITCFGISVLTCRYVGFAVVALLVEINSVFLHLRQVLRMANLAKSTFYR-VNSMINLGTYVVFRINTLAWMTRWL---VLNRDLIPLFSYTIGSVGLAIMTA-MNIVLFYR 221          
BLAST of TLC domain-containing protein vs. Ensembl Zebrafish
Match: tlcd4b (TLC domain containing 4b [Source:NCBI gene;Acc:449652])

HSP 1 Score: 48.1358 bits (113), Expect = 6.175e-6
Identity = 36/156 (23.08%), Postives = 71/156 (45.51%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRND-LKASNTYAECILSFSFGYFLYD----SCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTP 577
            P KL++ ++ L+S  HA+I  + CL +++Y + +  D +       +  ++ + GY  YD    +C+   +G   D FF V HH++ L      L+  +   F+   +I E++  F++ R        P        N   + + F ++R   + P
Sbjct:   40 PNKLNDWNSRLVSTVHALIVGLFCLYILWYDDAVNEDPVWGDPNLVKLNVAITCGYLFYDLLLLACNWSTMG---DVFF-VCHHLAALYAYGYVLTRGVLPYFANFRLISELSTPFVNQRWFFEALAYPRTHQLVVANGIAMAVVFFLVRIAVMPP 191          
BLAST of TLC domain-containing protein vs. Ensembl Zebrafish
Match: tlcd4b (TLC domain containing 4b [Source:NCBI gene;Acc:449652])

HSP 1 Score: 48.1358 bits (113), Expect = 6.175e-6
Identity = 36/156 (23.08%), Postives = 71/156 (45.51%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRND-LKASNTYAECILSFSFGYFLYD----SCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTP 577
            P KL++ ++ L+S  HA+I  + CL +++Y + +  D +       +  ++ + GY  YD    +C+   +G   D FF V HH++ L      L+  +   F+   +I E++  F++ R        P        N   + + F ++R   + P
Sbjct:   40 PNKLNDWNSRLVSTVHALIVGLFCLYILWYDDAVNEDPVWGDPNLVKLNVAITCGYLFYDLLLLACNWSTMG---DVFF-VCHHLAALYAYGYVLTRGVLPYFANFRLISELSTPFVNQRWFFEALAYPRTHQLVVANGIAMAVVFFLVRIAVMPP 191          
BLAST of TLC domain-containing protein vs. Ensembl Xenopus
Match: TLCD2 (TLC domain containing 2 [Source:NCBI gene;Acc:100497270])

HSP 1 Score: 56.6102 bits (135), Expect = 9.262e-9
Identity = 47/199 (23.62%), Postives = 102/199 (51.26%), Query Frame = 2
Query:  149 NYLISLTHAVITSINCLLLIFYSEEIRNDLKASNT-YAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQEHVIIIVAVYPAFIGFLI---LNVYMSCLLMFKNELWFSLNPKN 733
            N   S  H++IT    LL  +   E+  DL ++++ ++  +++ S GYF++D   +++       + ++ HH  V+     ++    ++ F++  ++VEIN+IF+HLR+++   ++ +  FY  +N+ +   ++VI R   L  ++ +L   VL    I +V      +G  I   +N+ + C L+  + L  +  P+ 
Sbjct:   39 NIWTSFVHSLITGSWALLGFYLHPEMAEDLISTHSLFSHSLVAVSIGYFIHDFLDMLQNQKLHQSWELLFHHTVVITCFGISVVLHHYVGFAVVALLVEINSIFLHLRQILLMANLLKTTFYR-LNSLLNLGTYVIFRISTLAWMTRWL---VLNRDNIPLVIYTIGSVGMAIMTVMNIILFCRLLRSDFLKSTREPQR 233          
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Match: Tlcd1 (TLC domain containing 1 [Source:MGI Symbol;Acc:MGI:1915572])

HSP 1 Score: 60.077 bits (144), Expect = 3.914e-10
Identity = 29/120 (24.17%), Postives = 69/120 (57.50%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECIL-SFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMR 481
            P++    HN L+S TH++++ I  LL ++ + E+  +++ + + +  +L  FS GYF++D+  ++        +  ++HH+  +    + +  + F+   +  ++VE++NIF+ LR +M+
Sbjct:   39 PLRTWRWHNLLVSFTHSIVSGIWALLCLWQTPEMLVEIETAWSASGYLLVCFSAGYFIHDTVDIVVSKQTRASWEYLVHHVMAMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMMMK 158          
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Match: Tlcd1 (TLC domain containing 1 [Source:MGI Symbol;Acc:MGI:1915572])

HSP 1 Score: 60.077 bits (144), Expect = 4.461e-10
Identity = 29/120 (24.17%), Postives = 69/120 (57.50%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECIL-SFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMR 481
            P++    HN L+S TH++++ I  LL ++ + E+  +++ + + +  +L  FS GYF++D+  ++        +  ++HH+  +    + +  + F+   +  ++VE++NIF+ LR +M+
Sbjct:   39 PLRTWRWHNLLVSFTHSIVSGIWALLCLWQTPEMLVEIETAWSASGYLLVCFSAGYFIHDTVDIVVSKQTRASWEYLVHHVMAMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMMMK 158          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99JT6|TLCD1_MOUSE (TLC domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tlcd1 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 3.120e-9
Identity = 29/120 (24.17%), Postives = 69/120 (57.50%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECIL-SFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMR 481
            P++    HN L+S TH++++ I  LL ++ + E+  +++ + + +  +L  FS GYF++D+  ++        +  ++HH+  +    + +  + F+   +  ++VE++NIF+ LR +M+
Sbjct:   39 PLRTWRWHNLLVSFTHSIVSGIWALLCLWQTPEMLVEIETAWSASGYLLVCFSAGYFIHDTVDIVVSKQTRASWEYLVHHVMAMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMMMK 158          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96CP7|TLCD1_HUMAN (TLC domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TLCD1 PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.061e-9
Identity = 31/143 (21.68%), Postives = 76/143 (53.15%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECILS-FSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYC---INTAMLFI 541
            P++    HN L+S  H++++ I  LL ++ + ++  +++ + + +  +L  FS GYF++D+  ++  G     +  ++HH+  +    + +    F+   +  ++VE++NIF+ +R +M+  +  +   Y     +N  M F+
Sbjct:   39 PLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFL 181          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5U2T1|TLCD1_RAT (TLC domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Tlcd1 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.420e-9
Identity = 30/122 (24.59%), Postives = 70/122 (57.38%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAEC---ILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMR 481
            P++    HN L+S TH++++ I  LL I+ + E+  +++ +  ++ C   ++ FS GYF++D+  ++        +  ++HH+  +    + +  + F+   +  ++VE++NIF+ LR +M+
Sbjct:   39 PLRTWRWHNLLVSFTHSIVSGIWALLCIWQTPEMLVEIETA--WSVCGYLLVCFSAGYFIHDTVDIVVSRQTRASWEYLVHHVMAMGAFFSGIFWKRFVGGGVLTLLVEVSNIFLTLRMMMK 158          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|A8WGS4|TLCD2_DANRE (TLC domain-containing protein 2 OS=Danio rerio OX=7955 GN=tlcd2 PE=2 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.858e-8
Identity = 42/188 (22.34%), Postives = 99/188 (52.66%), Query Frame = 2
Query:  140 ECHNYLISLTHAVITSINCLLLIFYSEEIRNDL-KASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQEHVIIIVAVYPAFIGFLILNVYMSCLLMFK 700
            + +N   S  H++IT +  +L      ++  DL +  + ++  ++S S GYF+YD   ++        + ++ HH+ V+     ++    ++ F++  ++VEIN++F+HLR+++R  ++ +  FY  +N+ +   ++V+ R   L  ++ +L   VL   +I + +     +G  I+   M+ +L ++
Sbjct:   39 KWNNISTSFVHSLITGVWSVLCFCMHPQMAEDLIETHSVFSHALVSVSIGYFIYDFLDMVINQKIIHSWELLFHHVVVITCFGISVLTCRYVGFAVVALLVEINSVFLHLRQVLRMANLAKSTFYR-VNSMINLGTYVVFRINTLAWMTRWL---VLNRDLIPLFSYTIGSVGLAIMTA-MNIVLFYR 221          
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Match: sp|F1NZP5|TLCD1_CHICK (TLC domain-containing protein 1 OS=Gallus gallus OX=9031 GN=TLCD1 PE=1 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 7.136e-7
Identity = 34/142 (23.94%), Postives = 71/142 (50.00%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKAS-NTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYC---INTAMLF 538
            P ++    N L+S  H+V+  +  L  ++ S E+ +D++   +     ++ FS GYF++DS  +I        +  ++HH   +    + +    F+  ++  ++VE++NIF+ +R L++  +VP    Y     +N  M F
Sbjct:   40 PGRVWRWRNLLVSFAHSVLAGLWALFSLWQSPELLSDIQDGYSVSGHLLVCFSSGYFIHDSLDIIFNQQSRSSWEYLVHHAMAISAFVSLIITGRFLVAAMLLLLVEVSNIFLTIRMLLKMSNVPSPALYEANKYVNLVMYF 181          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: A0A0A9WGL4 (TLC domain-containing protein 2 OS=Lygus hesperus OX=30085 GN=tlcd2_1 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.458e-15
Identity = 45/141 (31.91%), Postives = 80/141 (56.74%), Query Frame = 2
Query:  140 ECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKAS-NTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            +  N   SL H+ IT I   L  +Y+ E+R DL    N  ++ ++SFS GYF YD   +     +S  + +++HH  V+L  + A++ + +  +S+  ++VE+N+IF+H+R+LM   D  +    Y +N ++   +FVI R
Sbjct:   55 KWRNIANSLIHSFITGIGACLCFYYTPEMRKDLVGPINLASQHLISFSIGYFTYDMLDMAMNDRKSKTYELLLHHFMVILCFSTAVTGRTYQGYSLMALLVEVNSIFLHVRQLMILTDFSKNSVAYRVNNSLNMGTFVIFR 195          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: A0A146KZI6 (TLC domain-containing protein 2 OS=Lygus hesperus OX=30085 GN=tlcd2 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.852e-15
Identity = 45/141 (31.91%), Postives = 80/141 (56.74%), Query Frame = 2
Query:  140 ECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKAS-NTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            +  N   SL H+ IT I   L  +Y+ E+R DL    N  ++ ++SFS GYF YD   +     +S  + +++HH  V+L  + A++ + +  +S+  ++VE+N+IF+H+R+LM   D  +    Y +N ++   +FVI R
Sbjct:   55 KWRNIANSLIHSFITGIGACLCFYYTPEMRKDLVGPINLASQHLISFSIGYFTYDMLDMAMNDRKSKTYELLLHHFMVILCFSTAVTGRTYQGYSLMALLVEVNSIFLHVRQLMILTDFSKNSTAYRVNNSLNMGTFVIFR 195          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: A0A0A9VU59 (TLC domain-containing protein 2 OS=Lygus hesperus OX=30085 GN=tlcd2_0 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.881e-15
Identity = 44/141 (31.21%), Postives = 80/141 (56.74%), Query Frame = 2
Query:  140 ECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKAS-NTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            +  N   SL H+ IT I   L  +Y+ E+R DL    N  ++ ++SFS GYF YD   +     +S  + +++HH  V+L  + A++ + +  +S+  ++VE+N+IF+H+R+LM   D  +    Y +N ++   +FV+ R
Sbjct:   55 KWRNIANSLIHSFITGIGACLCFYYTPEMRKDLVGPINLASQHLISFSIGYFTYDMLDMAMNDRKSKTYELLLHHFMVILCFSTAVTGRTYQGYSLMALLVEVNSIFLHVRQLMILTDFSKNSVAYRVNNSLNMGTFVVCR 195          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: E4YBW1 (TLC domain-containing protein OS=Oikopleura dioica OX=34765 GN=GSOID_T00020918001 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.200e-12
Identity = 44/147 (29.93%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  131 KLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLK-ASNTYAECILSFSFGYFLYDSCSLI---KIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            K +E  N  +S+ H+  + I  L+ I    EI  D+  A +  + C+ SF+FGYF+YD   L+   +  +  + F I++HH+ V+    + +  Q ++  S+  +++E+N++F+HLRK+ R +D+  G  Y+ I  A+ F++ +  R
Sbjct:   14 KRTETINLAVSVFHSFFSGIGALIAITRMPEILEDMVYAHSNLSACVTSFTFGYFVYDFFDLLAASRWSISKNNFDIILHHVLVICCFGSCVVQQRYMGLSMLSILMEVNSVFLHLRKISRNFDIRSGIVYHAI-VALNFLTLIAFR 159          
BLAST of TLC domain-containing protein vs. TrEMBL
Match: E4WSD7 (TLC domain-containing protein OS=Oikopleura dioica OX=34765 GN=GSOID_T00000673001 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.468e-12
Identity = 44/147 (29.93%), Postives = 84/147 (57.14%), Query Frame = 2
Query:  131 KLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLK-ASNTYAECILSFSFGYFLYDSCSLI---KIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            K +E  N  +S+ H+  + I  L+ I    EI  D+  A +  + C+ SF+FGYF+YD   L+   +  +  + F I++HH+ V+    + +  Q ++  S+  +++E+N++F+HLRK+ R +D+  G  Y+ I  A+ F++ +  R
Sbjct:   35 KRTETINLAVSVFHSFFSGIGALIAITRMPEILEDMVYAHSNLSACVTSFTFGYFVYDFFDLLAASRWSISKNNFDIILHHVLVICCFGSCVVQQRYMGLSMLSILMEVNSVFLHLRKISRNFDIRSGIVYHAI-VALNFLTLIAFR 180          
BLAST of TLC domain-containing protein vs. Ensembl Cavefish
Match: tlcd2 (TLC domain-containing protein 2 [Source:NCBI gene;Acc:103028751])

HSP 1 Score: 65.4698 bits (158), Expect = 5.807e-12
Identity = 46/188 (24.47%), Postives = 101/188 (53.72%), Query Frame = 2
Query:  140 ECHNYLISLTHAVITSINCLLLIFYSEEIRNDL-KASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQEHVIIIVAVYPAFIGFLILNVYMSCLLMFK 700
            +  N   S  H++IT +  +L  +   ++  DL +  + ++  ++S S GYF+YD   ++        + ++ HH+ V+     ++    +I F++  ++VEIN+IF+HLR+++R  +V +  FY  +N+ +   ++V+ R   L  ++ +L   VL   +I +++     +G  I+ V M+ +L ++
Sbjct:   39 KWRNICTSFIHSLITGVWAVLCFYMHPQMAEDLIETHSVFSHALVSVSIGYFIYDFLDMVLNQKIYQSWELLFHHVVVITCFGLSVLTCRYIGFAVVALLVEINSIFLHLRQMLRMANVSKSTFYR-VNSMINLGTYVVFRINTLAWMTRWL---VLNRDLIPLLSYTVGSVGLAIMTV-MNIVLFYR 221          
BLAST of TLC domain-containing protein vs. Ensembl Cavefish
Match: tlcd1 (TLC domain containing 1 [Source:NCBI gene;Acc:103044061])

HSP 1 Score: 53.5286 bits (127), Expect = 7.589e-8
Identity = 42/155 (27.10%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  131 KLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNT-YAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYL 592
            K     N  +SL H++++    +  +     + +DL +S T  A  ++  S GYF+ D+  +I  G   + +  +IHH+ V+ T   AL   +++A ++  + VE+N++F+HLR L++   VP     Y +N  +   +++  R G    LS+Y+
Sbjct:   45 KSWRWENLSVSLVHSLLSGAWAVFCVLQYPLMVHDLHSSFTPLAYLLVVISTGYFIQDAGDIIFSGHARESWEFLIHHVLVISTFMYALITSVYVAGAVIALFVEVNSVFLHLRLLLKLAGVPRDSLLYTVNKLINVATYISFRLGAQFYLSWYI 199          
BLAST of TLC domain-containing protein vs. Ensembl Cavefish
Match: TLCD1 (calfacilitin-like [Source:NCBI gene;Acc:103023685])

HSP 1 Score: 50.0618 bits (118), Expect = 1.129e-6
Identity = 39/162 (24.07%), Postives = 78/162 (48.15%), Query Frame = 2
Query:  128 VKLSECHNYLISLTHAVIT---SINCLLLIFYSEEIRNDLKASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEV 604
            V+  +  N  +SL HA++T   ++ C+ L  + E + N        +  +L  S GYFL D+  ++  G     +  ++HH  VL     +L  Q +++  +  ++VE+N++ +H R L++       + Y+  N  +   +++  R      LS+YL K +
Sbjct:   46 VRCWKWRNLCVSLVHAMLTGPWAVTCVCL--WPEMLSNIHSYYTPMSYLLLCVSTGYFLQDTGDILLSGHARGSWEFLLHHFLVLWCFLYSLYTQRYVSGMVIALLVELNSVTLHARLLLKLAGAQASQLYH-TNKLLNLFTYITFRLSAQFYLSWYLLKNL 204          
BLAST of TLC domain-containing protein vs. Ensembl Sea Lamprey
Match: tlcd4b (TLC domain containing 4b [Source:NCBI gene;Acc:449652])

HSP 1 Score: 52.373 bits (124), Expect = 4.146e-8
Identity = 35/156 (22.44%), Postives = 69/156 (44.23%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRND-LKASNTYAECILSFSFGYFLYD----SCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTP 577
            P K  E H+  +S  HA+I    CL ++++ + +  D +       +  ++ + GY   D     C+   IG   D+FFI +HH+S L      +   +   F+    + E++  F++ R        P+    Y +N  ++ ++F  +R   + P
Sbjct:   56 PAKQIEWHSRTVSTLHALIVGFFCLYILWFDDAVNKDPVWGDPKIVQLNIAITTGYLFSDFLLIVCNWNAIG---DKFFI-MHHLSALYAYYYVMDRGVLPYFANFRQLAELSTPFVNQRWFYEALGYPKAGGPYVVNGVLMAVAFFAVRVAVMPP 207          
BLAST of TLC domain-containing protein vs. Ensembl Sea Lamprey
Match: tlcd1 (TLC domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-041010-173])

HSP 1 Score: 50.8322 bits (120), Expect = 4.889e-8
Identity = 37/131 (28.24%), Postives = 65/131 (49.62%), Query Frame = 2
Query:  203 LIFYSEEIRNDLKASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEG-KFYYCINTAMLFISFVILRWGFLTPLSFYL 592
            LIF+  E+  DL +       +L+ S GYFL D+  ++  G     +  + HH  VL     +L  + ++A +   ++VE+N++F+H R LM+      G    Y +N  +   ++VI R G    L+ Y+
Sbjct:    1 LIFF-PEVLTDLTSYTLPMNVLLAISTGYFLQDTLDIVWSGQVKASWEFLFHHALVLSCFGYSLLTRQYVAGTTVALLVEVNSVFLHARLLMKLAGANAGCSRAYRLNRYLNAFTYVIFRLGAQAYLTAYV 130          
BLAST of TLC domain-containing protein vs. Ensembl Nematostella
Match: EDO35196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM93])

HSP 1 Score: 53.1434 bits (126), Expect = 3.226e-8
Identity = 50/191 (26.18%), Postives = 98/191 (51.31%), Query Frame = 2
Query:  146 HNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAEC-ILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQ-EHVIIIVAVYPAFIGFLILNVYMSCLLMFKNELW 712
            +N  ISL H+ +T+I  L   +    + +D+    T +   +L  S GYFL+D   ++   L S    ++IHH  V++    A+  + +  +    +++E+N++F+H R++M  +DV      Y +N  ++  +FV  R  FLT  S ++   V++  H+I    V+  + GF +  + +  + +F  +LW
Sbjct:   50 YNISISLIHSTVTAIWSLYCFYNEPAMLSDMIGVWTSSSYFLLCLSTGYFLHDFLDMLLNDL-SRSTVLLIHHTLVVVAFLIAILTKNYCGYGTCSLLMEVNSVFLHSRRIMLFHDVDRKSTLYELNGLLMLATFVFFR--FLT--SAWMMNFVIKARHIIPATHVF--YGGFAMAAMIIMNIQLF-TQLW 232          
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Match: tlcd2 (TLC domain containing 2 [Source:NCBI gene;Acc:101172260])

HSP 1 Score: 68.5514 bits (166), Expect = 4.752e-13
Identity = 48/189 (25.40%), Postives = 100/189 (52.91%), Query Frame = 2
Query:  140 ECHNYLISLTHAVITSINCLLLIFYSEEIRNDL-KASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQEHVIIIVAVYPAFIGFLI---LNVYMSCLLM 694
            +  N   S  H+ IT+I  +L  F   ++  DL +  + ++  ++SFS GYF+YD   ++     S  + ++ HHI V+     ++ +  ++ F++  ++VEIN++F+HLR+++R   +  G  Y  +N+ +   ++V+ R   L  ++ +L   VL    + ++A     +G  I   +N+ + C L+
Sbjct:   39 KWRNISTSFVHSFITAIWAVLCFFLHPQMAEDLIETFSWFSHALVSFSIGYFIYDFLDMVVHQKLSQSWELLFHHIVVITCFGLSVLSNRYLGFAVVALLVEINSVFLHLRQILRMASMASGTLYR-VNSMINLGTYVVFRINTLAWMTRWL---VLNRDKVPLLAYTLGSVGMAIMTAMNIVLFCRLL 223          
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Match: tlcd1 (TLC domain containing 1 [Source:NCBI gene;Acc:101163189])

HSP 1 Score: 59.6918 bits (143), Expect = 6.740e-10
Identity = 41/152 (26.97%), Postives = 78/152 (51.32%), Query Frame = 2
Query:  140 ECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECILS-FSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYL 592
            +  N  +S+ H+V+T+   L     S E+ +++++ NT    +L   S GYF+ D+  +I  G     +  ++HH  V+      L   +FIA ++  + VE+N+I +HLR +++     +   YY +N  +  I++V  R      L++YL
Sbjct:   48 KWKNLSVSMVHSVLTAAWALTCFVVSPELLSNIRSYNTPLSYLLVCISTGYFVQDAADIILTGHAKGSWEFLLHHAVVIWCFLYTLYTHLFIAGAVIALFVEVNSITLHLRLMLKLASAQDSSLYY-VNKFVNLITYVTFRLSAQFYLTWYL 198          
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Match: tlcd4b (transmembrane protein 56-B [Source:NCBI gene;Acc:101162842])

HSP 1 Score: 50.0618 bits (118), Expect = 1.019e-6
Identity = 35/150 (23.33%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIR-NDLKASNTYAECILSFSFGYFLYD----SCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            P KL+E ++ L+S  HA+I    CL ++++ + +  N +       +  ++ + GY +YD    +C+   +G   D FF V HH++ L      L+  +   F+   +I E++  F++ R        P   +    N   + + F ++R
Sbjct:   40 PPKLTEWNSRLVSTVHALIVGFFCLYILWFDDAVNANPVWGDPNLVKLNVAITCGYLVYDLVLLACNWKTMG---DGFF-VCHHLAALYAYGYVLTRGVLPYFANFRLISELSTPFVNQRWFFEALKYPRSHWMVVSNGVAMAVVFFLVR 185          
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Match: tlcd4b (transmembrane protein 56-B [Source:NCBI gene;Acc:101162842])

HSP 1 Score: 50.0618 bits (118), Expect = 1.019e-6
Identity = 35/150 (23.33%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIR-NDLKASNTYAECILSFSFGYFLYD----SCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            P KL+E ++ L+S  HA+I    CL ++++ + +  N +       +  ++ + GY +YD    +C+   +G   D FF V HH++ L      L+  +   F+   +I E++  F++ R        P   +    N   + + F ++R
Sbjct:   40 PPKLTEWNSRLVSTVHALIVGFFCLYILWFDDAVNANPVWGDPNLVKLNVAITCGYLVYDLVLLACNWKTMG---DGFF-VCHHLAALYAYGYVLTRGVLPYFANFRLISELSTPFVNQRWFFEALKYPRSHWMVVSNGVAMAVVFFLVR 185          
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Match: tlcd4b (transmembrane protein 56-B [Source:NCBI gene;Acc:101162842])

HSP 1 Score: 49.6766 bits (117), Expect = 1.286e-6
Identity = 35/150 (23.33%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIR-NDLKASNTYAECILSFSFGYFLYD----SCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            P KL+E ++ L+S  HA+I    CL ++++ + +  N +       +  ++ + GY +YD    +C+   +G   D FF V HH++ L      L+  +   F+   +I E++  F++ R        P   +    N   + + F ++R
Sbjct:   40 PPKLTEWNSRLVSTVHALIVGFFCLYILWFDDAVNANPVWGDPNLVKLNVAITCGYLVYDLVLLACNWKTMG---DGFF-VCHHLAALYAYGYVLTRGVLPYFANFRLISELSTPFVNQRWFFEALKYPRSHWMVVSNGVAMAVVFFLVR 185          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000068531.1 (SMESG000068531.1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.316e-147
Identity = 205/206 (99.51%), Postives = 205/206 (99.51%), Query Frame = 2
Query:  125 PVKLSECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQEHVIIIVAVYPAFIGFLILNVYMSCLLMFKNELWFSLNPKNWIF 742
            PVKL ECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQEHVIIIVAVYPAFIGFLILNVYMSCLLMFKNELWFSLNPKNWIF
Sbjct:   32 PVKLCECHNYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKEVLQEHVIIIVAVYPAFIGFLILNVYMSCLLMFKNELWFSLNPKNWIF 237          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000060101.1 (SMESG000060101.1)

HSP 1 Score: 73.1738 bits (178), Expect = 8.041e-15
Identity = 44/140 (31.43%), Postives = 82/140 (58.57%), Query Frame = 2
Query:  149 NYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAEC---ILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            N L SL H++++    LL  + +E+IR+DL   NTY      ++SFS GYF++D+  +IK       + +VIHH  + +    ++ +++FI +++  ++VE+N+IF+H+R+L+      +    Y IN  +   SF++ R
Sbjct:   40 NVLGSLFHSILSGTFALLCFYQNEDIRSDL--INTYTTGCLILVSFSLGYFIHDAFDMIKNSSEQQSYELVIHHSIIFVCFGISVFSRLFIGYALVALLVEVNSIFLHMRQLLGFLGFNKSDCKYRINNILNIGSFLVFR 177          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000060101.1 (SMESG000060101.1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.935e-15
Identity = 44/138 (31.88%), Postives = 81/138 (58.70%), Query Frame = 2
Query:  149 NYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECIL-SFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            N L SL H++++    LL  + +E+IR+DL  + T    IL SFS GYF++D+  +IK       + +VIHH  + +    ++ +++FI +++  ++VE+N+IF+H+R+L+      +    Y IN  +   SF++ R
Sbjct:   55 NVLGSLFHSILSGTFALLCFYQNEDIRSDLINTYTTGCLILVSFSLGYFIHDAFDMIKNSSEQQSYELVIHHSIIFVCFGISVFSRLFIGYALVALLVEVNSIFLHMRQLLGFLGFNKSDCKYRINNILNIGSFLVFR 192          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000060101.1 (SMESG000060101.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.049e-14
Identity = 44/138 (31.88%), Postives = 81/138 (58.70%), Query Frame = 2
Query:  149 NYLISLTHAVITSINCLLLIFYSEEIRNDLKASNTYAECIL-SFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVPEGKFYYCINTAMLFISFVILR 559
            N L SL H++++    LL  + +E+IR+DL  + T    IL SFS GYF++D+  +IK       + +VIHH  + +    ++ +++FI +++  ++VE+N+IF+H+R+L+      +    Y IN  +   SF++ R
Sbjct:   51 NVLGSLFHSILSGTFALLCFYQNEDIRSDLINTYTTGCLILVSFSLGYFIHDAFDMIKNSSEQQSYELVIHHSIIFVCFGISVFSRLFIGYALVALLVEVNSIFLHMRQLLGFLGFNKSDCKYRINNILNIGSFLVFR 188          
BLAST of TLC domain-containing protein vs. Planmine SMEST
Match: SMESG000026799.1 (SMESG000026799.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.159e-11
Identity = 46/153 (30.07%), Postives = 80/153 (52.29%), Query Frame = 2
Query:  149 NYLISLTHAVITSINCLLLIFYSEEIRNDL-KASNTYAECILSFSFGYFLYDSCSLIKIGLRSDRFFIVIHHISVLLTLTAALSNQIFIAFSIHCMIVEINNIFMHLRKLMRCYDVP-EGKFYYCINTAMLFISFVILRWGFLTPLSFYLFKE 601
            N L+S  HA+I     LL  +Y  E+ +DL    N++   ++ FS GYFLYD   +I        + + +HH++V+ T    L     + +++  ++ E+N+ F+H RKL++ Y VP     Y C+    L I+F I R   L  +++ ++ E
Sbjct:   37 NLLMSWVHALIVGSWDLLCFYYYPELTDDLVDFKNSFCYYLIVFSTGYFLYDFADMIYNKKVLKMWELTLHHLAVISTFLYNLCTMTCVGYNVVALLCEVNSFFLHSRKLLQLYHVPFRHVGYRCVAVVNL-ITFAIFRGIALVTITYGMYVE 188          
The following BLAST results are available for this feature:
BLAST of TLC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TLCD18.457e-1021.68TLC domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y48G8AL.133.529e-628.83pep chromosome:WBcel235:I:1223959:1227858:-1 gene:... [more]
Y48G8AL.133.529e-628.83pep chromosome:WBcel235:I:1223959:1229282:-1 gene:... [more]
Y48G8AL.133.529e-628.83pep chromosome:WBcel235:I:1223957:1226812:-1 gene:... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TLC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tlcd11.647e-923.87TLC domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tlcd25.111e-922.34TLC domain containing 2 [Source:NCBI gene;Acc:5594... [more]
tlcd4b6.175e-623.08TLC domain containing 4b [Source:NCBI gene;Acc:449... [more]
tlcd4b6.175e-623.08TLC domain containing 4b [Source:NCBI gene;Acc:449... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TLCD29.262e-923.62TLC domain containing 2 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tlcd13.914e-1024.17TLC domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
Tlcd14.461e-1024.17TLC domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of TLC domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99JT6|TLCD1_MOUSE3.120e-924.17TLC domain-containing protein 1 OS=Mus musculus OX... [more]
sp|Q96CP7|TLCD1_HUMAN4.061e-921.68TLC domain-containing protein 1 OS=Homo sapiens OX... [more]
sp|Q5U2T1|TLCD1_RAT4.420e-924.59TLC domain-containing protein 1 OS=Rattus norvegic... [more]
sp|A8WGS4|TLCD2_DANRE3.858e-822.34TLC domain-containing protein 2 OS=Danio rerio OX=... [more]
sp|F1NZP5|TLCD1_CHICK7.136e-723.94TLC domain-containing protein 1 OS=Gallus gallus O... [more]
back to top
BLAST of TLC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A9WGL41.458e-1531.91TLC domain-containing protein 2 OS=Lygus hesperus ... [more]
A0A146KZI61.852e-1531.91TLC domain-containing protein 2 OS=Lygus hesperus ... [more]
A0A0A9VU594.881e-1531.21TLC domain-containing protein 2 OS=Lygus hesperus ... [more]
E4YBW11.200e-1229.93TLC domain-containing protein OS=Oikopleura dioica... [more]
E4WSD71.468e-1229.93TLC domain-containing protein OS=Oikopleura dioica... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tlcd25.807e-1224.47TLC domain-containing protein 2 [Source:NCBI gene;... [more]
tlcd17.589e-827.10TLC domain containing 1 [Source:NCBI gene;Acc:1030... [more]
TLCD11.129e-624.07calfacilitin-like [Source:NCBI gene;Acc:103023685][more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tlcd4b4.146e-822.44TLC domain containing 4b [Source:NCBI gene;Acc:449... [more]
tlcd14.889e-828.24TLC domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TLC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO351963.226e-826.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TLC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tlcd24.752e-1325.40TLC domain containing 2 [Source:NCBI gene;Acc:1011... [more]
tlcd16.740e-1026.97TLC domain containing 1 [Source:NCBI gene;Acc:1011... [more]
tlcd4b1.019e-623.33transmembrane protein 56-B [Source:NCBI gene;Acc:1... [more]
tlcd4b1.019e-623.33transmembrane protein 56-B [Source:NCBI gene;Acc:1... [more]
tlcd4b1.286e-623.33transmembrane protein 56-B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of TLC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068531.13.316e-14799.51SMESG000068531.1[more]
SMESG000060101.18.041e-1531.43SMESG000060101.1[more]
SMESG000060101.19.935e-1531.88SMESG000060101.1[more]
SMESG000060101.11.049e-1431.88SMESG000060101.1[more]
SMESG000026799.11.159e-1130.07SMESG000026799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017888 ID=SMED30017888|Name=TLC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=987bp
AGTATAAATATTTTTTTATTTTACTTTTTTAATGCTGCTGTTAATTGTTA
TATTTTCCAGTTTTTTATTTTTTCTTAGTTATTCTTTTTTACTTAAAAAA
AATTTTAAATCATCTTCTCTTAGTCCTGTAAAATTATCTGAATGTCACAA
TTACTTGATATCATTGACTCATGCTGTAATTACTTCAATTAATTGCTTAT
TACTAATTTTTTATTCAGAGGAAATTCGCAATGACTTAAAAGCGTCGAAT
ACTTACGCTGAATGTATTTTATCATTTTCATTCGGTTATTTTTTATATGA
CTCGTGTTCTTTAATCAAAATTGGATTAAGATCTGATAGATTTTTTATTG
TAATTCATCATATTTCTGTTTTATTGACTTTAACAGCAGCACTGAGTAAT
CAAATTTTTATTGCTTTTTCAATACATTGTATGATTGTTGAAATAAACAA
TATTTTCATGCACTTGAGAAAACTTATGAGATGCTATGATGTCCCCGAAG
GGAAATTCTATTATTGCATTAATACGGCAATGTTGTTTATTTCATTTGTC
ATTCTGCGGTGGGGTTTTTTAACTCCTTTGTCATTTTATTTATTCAAAGA
AGTACTACAAGAACATGTCATTATTATAGTCGCTGTTTATCCAGCTTTTA
TTGGTTTTCTGATTCTTAATGTATACATGTCTTGTCTTTTAATGTTCAAA
AACGAATTGTGGTTTTCTTTAAATCCGAAAAATTGGATATTTTAGAAAAG
TATAGAAATGAAATTAATAAGTGTGATTGGGTAGACCTATTTAAAGTATT
GAAAAAAAAATTTTTTTTAATAGTTTTTTTAATTGTATTTTGTACTGTGG
TTTTTAAGAGATGTTATGACATTTTGTATAGCATGTTCGCTAAAGCTTAA
TGTTCTATGTGATATTTTTGTAAGTACTTTGATATTTTTACTGTGTTTCT
TTGCTCAGCTGAATTTATTTGCCGATGTCTTTTAGAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006634TLC-dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 4..25