Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30017883
Length (bp)1261
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30017883) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30017883) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase (SMED30017883) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30017883) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017883

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017883 Contig7144newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017883 Contig7144uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30017883 dd_Smed_v4_1407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017883 dd_Smed_v4_1407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017883 dd_Smed_v4_1407_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30017883 dd_Smed_v4_1407_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CA (protein phosphatase 1 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9281])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 302/323 (93.50%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/324 (91.98%), Postives = 307/324 (94.75%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MAD DKLN+DSII RLLEVRGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK          RP+TPPRG + 
Sbjct:    1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNATRPVTPPRGMIT 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 297/320 (92.81%), Postives = 305/320 (95.31%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPR 1005
            MAD DKLN+DSII RLLEVRGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK          RP+TPPR
Sbjct:    1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNATRPVTPPR 314          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CA (protein phosphatase 1 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9281])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 302/334 (90.42%), Postives = 310/334 (92.81%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLE-----------VRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLE           V+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 334          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 283/295 (95.93%), Postives = 290/295 (98.31%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQI 930
            MAD DKLN+DSII RLLEVRGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQ+
Sbjct:    1 MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQV 295          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-2 (Serine/threonine-protein phosphatase PP1-beta [Source:UniProtKB/Swiss-Prot;Acc:P48727])

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 294/323 (91.02%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   52 DSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQG-NRPITPPRGGVA 1017
            D +KLNLD+II+RLLEVRGS+PGKNVQL+E+EI+GLC KSREIFLSQPILLELEAPLKICGD+HGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFG EVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG+MM+VDETLMCSFQILKPADKKK+PY +   G NRP+TPPR   A
Sbjct:    2 DVEKLNLDNIISRLLEVRGSKPGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVDETLMCSFQILKPADKKKYPYGAGGVGSNRPVTPPRNAPA 324          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-1 (Serine/threonine-protein phosphatase PP1-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q27497])

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 273/325 (84.00%), Postives = 295/325 (90.77%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGGVA 1017
            M++   LN+D++I RLLEVRG RPGK V +SE EIR LC KSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYK+KYPENFFLLRGNHECASINRIYGFYDECKRR++IKLWKTFTDCFNCLPIAA+IDEKIFCCHGGLSPDLQ+MEQIRR+MRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFG +VVAKFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDETLMCSFQILKP++KK K+ Y  +N G   +   R G  
Sbjct:    1 MSNDGDLNIDNLITRLLEVRGCRPGKPVTMSEAEIRALCHKSREIFLSQPILLELEAPLKICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDLQNMEQIRRVMRPTDVPDTGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYQGMNSGRPAVGGGRPGTT 325          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-1 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EC18])

HSP 1 Score: 437.573 bits (1124), Expect = 4.149e-153
Identity = 198/296 (66.89%), Postives = 247/296 (83.45%), Query Frame = 1
Query:   61 KLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK 948
            +LN+D +I+ L+ V+     K + ++E EIR +C+ +R+IF+ QP+LLELE PLKI GDIHGQ+ DLLRLF   G+PPESNYLFLGDYVDRG +S+ETI LLL YKIKYP NFFLLRGNHE A++NRIYGFYDECKRRY++KLWK F D FNC+P+AA+ID KIFCCHGGLSP+L+S++Q++R+ RP DV + GLLCD+LWSDPD   +GW  N+RGVS+ FG +V+A+FL K DLD++ R HQVVEDGYEFF +R LVT+FSAPNYCGEFDNAGA+M+VDE L+CSFQILKP  +
Sbjct:   13 ELNIDQLISTLVSVKPWH--KTLDVTENEIRMVCVLARQIFMHQPMLLELEPPLKIGGDIHGQFADLLRLFNLAGYPPESNYLFLGDYVDRGPKSIETIVLLLCYKIKYPNNFFLLRGNHEVANLNRIYGFYDECKRRYSVKLWKCFQDVFNCMPVAALIDNKIFCCHGGLSPNLRSLDQLKRLSRPCDVQETGLLCDVLWSDPDATVVGWAPNERGVSYVFGVDVLAQFLQKMDLDIVVRGHQVVEDGYEFFGRRGLVTVFSAPNYCGEFDNAGAVMNVDENLLCSFQILKPQSQ 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-3 (Serine/threonine-protein phosphatase PP1-gamma [Source:UniProtKB/Swiss-Prot;Acc:O02658])

HSP 1 Score: 366.311 bits (939), Expect = 7.992e-126
Identity = 161/297 (54.21%), Postives = 224/297 (75.42%), Query Frame = 1
Query:   64 LNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 951
            +++D++++RLL V  S       ++E E++  C  ++ +F SQ  LLE+E P+ +CGDIHGQY DLLR+F+  GFPP+ N+LFLGDYVDRG+Q++ETICL+L +KIKYPENFF+LRGNHEC +INR+YGFY+EC RRY + +LW  F D FN +P+  +I  +I C HGGLSP LQ+++Q+R++ RP D P+  +  DLLW+DPD+   GW  N RGVS+ FG +VVA    + D+DL+ RAHQVV+DGYEFFA +++VT+FSAP+YCG+FDN+ A M VDE ++C+F + KP  K 
Sbjct:    5 MDVDNLMSRLLNVGMSGGRLTTSVNEQELQTCCAVAKSVFASQASLLEVEPPIIVCGDIHGQYSDLLRIFDKNGFPPDVNFLFLGDYVDRGRQNIETICLMLCFKIKYPENFFMLRGNHECPAINRVYGFYEECNRRYKSTRLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPHLQTLDQLRQLPRPQDPPNPSIGIDLLWADPDQWVKGWQANTRGVSYVFGQDVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPHYCGQFDNSAATMKVDENMVCTFVMYKPTPKS 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-4 (Serine/threonine-protein phosphatase PP1-delta [Source:UniProtKB/Swiss-Prot;Acc:P91420])

HSP 1 Score: 364.385 bits (934), Expect = 5.809e-125
Identity = 160/300 (53.33%), Postives = 224/300 (74.67%), Query Frame = 1
Query:   55 SDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 951
            +  +++D++++RLL V  S       ++E E++  C  ++ +F SQ  LLE+E P+ +CGDIHGQY DLLR+F+  GFPP+ N+LFLGDYVDRG+Q++ETICL+  +KIKYPENFF+LRGNHEC +INR+YGFY+EC RRY + +LW  F D FN +P+  +I  +I C HGGLSP LQ+++Q+R++ RP D P+  +  DLLW+DPD+   GW  N RGVS+ FG +VVA    + D+DL+ RAHQVV+DGYEFFA +++VT+FSAP+YCG+FDN+ A M VDE ++C+F + KP  K 
Sbjct:    2 TATIDVDNLMSRLLNVGMSGGRLTTSVNEQELQTCCAVAKSVFASQASLLEVEPPIIVCGDIHGQYSDLLRIFDKNGFPPDINFLFLGDYVDRGRQNIETICLMFCFKIKYPENFFMLRGNHECPAINRVYGFYEECNRRYKSTRLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPHLQTLDQLRQLPRPQDPPNPSIGIDLLWADPDQWVKGWQANTRGVSYVFGQDVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPHYCGQFDNSAATMKVDENMVCTFVMYKPTPKS 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1alpha-96A (gene:FBgn0003134 transcript:FBtr0334334)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 288/319 (90.28%), Postives = 303/319 (94.98%), Query Frame = 1
Query:   55 SDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGG 1011
            SD +N+DSII+RLLEVRG+RPGKNVQLSE+EIR LCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY ENFFLLRGNHECASINRIYGFYDECKRRY IKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDL SMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+TMGWGENDRGVSFTFGAEVV KFL KH+ DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD+TLMCSFQILKPADK++F Y +     RP+TPPRG 
Sbjct:    2 SDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRRFVYPNFGSSGRPLTPPRGA 320          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1alpha-96A (gene:FBgn0003134 transcript:FBtr0084642)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 288/319 (90.28%), Postives = 303/319 (94.98%), Query Frame = 1
Query:   55 SDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGG 1011
            SD +N+DSII+RLLEVRG+RPGKNVQLSE+EIR LCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY ENFFLLRGNHECASINRIYGFYDECKRRY IKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDL SMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+TMGWGENDRGVSFTFGAEVV KFL KH+ DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD+TLMCSFQILKPADK++F Y +     RP+TPPRG 
Sbjct:    2 SDIMNIDSIISRLLEVRGARPGKNVQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRRFVYPNFGSSGRPLTPPRGA 320          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1-87B (gene:FBgn0004103 transcript:FBtr0082595)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 280/299 (93.65%), Postives = 292/299 (97.66%), Query Frame = 1
Query:   58 DKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKK 954
            D +N+DSII+RLLEVRG+RPGKNVQLSE EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY ENFFLLRGNHECASINRIYGFYDECKRRY+IKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDL SMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+TMGWGENDRGVSFTFGAEVVAKFL KH+ DLICRAHQVVEDGYEFFAKR LVTLFSAPNYCGEFDNAGAMMSVD+TLMCSFQILKPADK+K
Sbjct:    3 DVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKRK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1-13C (gene:FBgn0003132 transcript:FBtr0074017)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 274/300 (91.33%), Postives = 289/300 (96.33%), Query Frame = 1
Query:   55 SDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKK 954
            ++ LNL+SII+RLLEVRG+RPGKNVQLSE EIRGLCLKSREI L+QPILLELEAPLKICGDIHGQY+DLLRLFEYGG+PPE+NYLFLGDYVDRGKQSLETICLLLAYKIKY ENFFLLRGNHECASINRIYGFYDECKRRY IKLWKTFTDCFNCLP+ AI+DEKIFCCHGGLSPDL SMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+T+GWGENDRGVSFTFGAEVV KFL KHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVD TLMCSFQILKP +K+K
Sbjct:    2 AEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0071447)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 270/323 (83.59%), Postives = 295/323 (91.33%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGG 1011
            M D D LN+DS+I RLLE+R  R GK VQ++E E+RGLCLKSREIFL QPILLELEAPL ICGDIHGQY DLLRLFEYGGFPP +NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN+KLWKTFTDCFNCLP+AAIIDEKIFCCHGGLSPDLQ MEQIRR+MRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFG +VV+KFL++H+LDLICRAHQVVEDGYEFFA+RQLVTLFSAPNYCGEFDNAG MM+VD+TLMCSFQILKP++KK K+ Y+ +N  +RP TP R  
Sbjct:    1 MGDFD-LNVDSLIQRLLEMRSCRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVDDTLMCSFQILKPSEKKAKYLYSGMN-SSRPTTPQRSA 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: CABZ01076667.1 (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:571753])

HSP 1 Score: 615.535 bits (1586), Expect = 0.000e+0
Identity = 296/324 (91.36%), Postives = 307/324 (94.75%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MAD DKLN+DSII RLLEVRGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGG+PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC+RRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK         +RP+TPPR  V 
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECRRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNPSRPVTPPRNMVT 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 291/322 (90.37%), Postives = 309/322 (95.96%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQ-GN-RPITPPR 1005
            MA+SDK+N+DSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGD+HGQY+DLLRLFEYGG+PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDLQSMEQIRR+MRPTDVPDQGLLCDLLW+DPDK+ MGWGENDRGVSFTFG++VVAKFLHKHD+DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KK   Y      GN RP+TPPR
Sbjct:    1 MAESDKINIDSIIQRLLEVKGSRPGKNVQLTEQEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKVLSYGGAGGFGNSRPVTPPR 322          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 288/324 (88.89%), Postives = 307/324 (94.75%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGGV 1014
            MA+ DKLN+DSII RLLEV+GSRPGKNVQL+E+EIRGLCLKSREIFLSQPILLELEAPLKICGD+HGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK+KYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDLQSMEQ+RR+MRPTDVPDQGLLCDLLW+DPDK+ +GWGENDRGVSFTFGA+VVAKFLHKHD+DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK  +         RP+TPPR   
Sbjct:    1 MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLYYGGGGGMGSGRPVTPPRNSA 324          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 284/325 (87.38%), Postives = 307/325 (94.46%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGGVA 1017
            MA+ + LN+DS+I+RLLEVRG RPGK VQ++E E+RGLC+KSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFGA+VV+KFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDE+LMCSFQILKP++KK K+ Y+ +N G RP+TPPR   A
Sbjct:    1 MAEGE-LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYSGVNSG-RPVTPPRTAQA 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 278/321 (86.60%), Postives = 299/321 (93.15%), Query Frame = 1
Query:   55 SDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGGV 1014
            ++KL+L S    L  ++GSRPGKNVQL+E+EIRGLCLKSREIFLSQPILLELEAPLKICGD+HGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK+KYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDLQSMEQ+RR+MRPTDVPDQGLLCDLLW+DPDK+ +GWGENDRGVSFTFGA+VVAKFLHKHD+DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK  +         RP+TPPR   
Sbjct:    4 TNKLSLKS----LHNLKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLYYGGGGGMGSGRPVTPPRNSA 320          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 298/324 (91.98%), Postives = 308/324 (95.06%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MAD DKLN+DSII RLLEVRGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK         +RP+TPPRG + 
Sbjct:    1 MADVDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNASRPVTPPRGMIT 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 285/321 (88.79%), Postives = 305/321 (95.02%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPR 1005
            MAD + LN+DS+I+RLLEVRG RPGK VQ++E E+RGLC+KSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFGA+VV+KFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDETLMCSFQILKP++KK K+ Y  LN G RP+TPPR
Sbjct:    1 MADGE-LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSG-RPVTPPR 319          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 283/312 (90.71%), Postives = 295/312 (94.55%), Query Frame = 1
Query:   82 IARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            + R  ++RGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK         +RP+TPPRG + 
Sbjct:    1 MCRTDQLRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNASRPVTPPRGMIT 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 283/312 (90.71%), Postives = 294/312 (94.23%), Query Frame = 1
Query:   82 IARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            I  L ++ GS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK         +RP+TPPRG + 
Sbjct:   11 ICDLKKLSGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNASRPVTPPRGMIT 316          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 282/305 (92.46%), Postives = 291/305 (95.41%), Query Frame = 1
Query:  103 RGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            RGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK         +RP+TPPRG + 
Sbjct:   26 RGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNASRPVTPPRGMIT 324          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 301/323 (93.19%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKI+YPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 301/323 (93.19%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKI+YPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 298/324 (91.98%), Postives = 307/324 (94.75%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MAD DKLN+DSII RLLEVRGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK          RP+TPPRG + 
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNATRPVTPPRGMIT 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 298/322 (92.55%), Postives = 306/322 (95.03%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGG 1011
            MAD DKLN+DSII RLLEVRGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK          RP+TPPR G
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNATRPVTPPRVG 316          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cb (protein phosphatase 1 catalytic subunit beta [Source:MGI Symbol;Acc:MGI:104871])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 285/321 (88.79%), Postives = 304/321 (94.70%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPR 1005
            MAD + LN+DS+I RLLEVRG RPGK VQ++E E+RGLC+KSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFGA+VV+KFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDETLMCSFQILKP++KK K+ Y  LN G RP+TPPR
Sbjct:    1 MADGE-LNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSG-RPVTPPR 319          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62138|PP1A_RAT (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp1ca PE=1 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 302/323 (93.50%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 323          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62139|PP1A_RABIT (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus OX=9986 GN=PPP1CA PE=1 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 302/323 (93.50%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 323          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62136|PP1A_HUMAN (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA PE=1 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 302/323 (93.50%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 323          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q3T0E7|PP1A_BOVIN (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus OX=9913 GN=PPP1CA PE=2 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 302/323 (93.50%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 323          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62137|PP1A_MOUSE (Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus OX=10090 GN=Ppp1ca PE=1 SV=1)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 301/323 (93.19%), Postives = 310/323 (95.98%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY---NSLNQGNRPITPPR 1005
            M+DS+KLNLDSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKI+YPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK K  Y   + LN G RPITPPR
Sbjct:    1 MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPR 323          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A2T7PI72 (Serine/threonine-protein phosphatase OS=Pomacea canaliculata OX=400727 GN=C0Q70_08546 PE=3 SV=1)

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 312/323 (96.59%), Postives = 318/323 (98.45%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGV 1014
            MAD+DKLN+DSIIARLLEVRGSRPGKNVQL+E+EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY  LNQG RP+TPPRG  
Sbjct:    1 MADTDKLNIDSIIARLLEVRGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYGGLNQG-RPVTPPRGNA 322          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: K1PXG6 (Serine/threonine-protein phosphatase OS=Crassostrea gigas OX=29159 GN=CGI_10013946 PE=3 SV=1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 311/321 (96.88%), Postives = 317/321 (98.75%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRG 1008
            MAD+DKLN+DSIIARLLEVRGSRPGKNVQL+E+EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY  LN G RP+TPPRG
Sbjct:    1 MADTDKLNIDSIIARLLEVRGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYGGLNAG-RPVTPPRG 320          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1S3I9H3 (Serine/threonine-protein phosphatase OS=Lingula unguis OX=7574 GN=LOC106162205 PE=3 SV=1)

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 311/321 (96.88%), Postives = 316/321 (98.44%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRG 1008
            MAD+DKLN+DSIIARLLEVRGSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY  L QG RP+TPPRG
Sbjct:    1 MADADKLNIDSIIARLLEVRGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYGGLQQG-RPVTPPRG 320          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A267ENW3 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013359g1 PE=3 SV=1)

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 311/324 (95.99%), Postives = 316/324 (97.53%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MADSDKLN+DSIIARLLEVRGSRPGKNVQLSE EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ+MEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY  +  G RP+TPPRG  A
Sbjct:    1 MADSDKLNIDSIIARLLEVRGSRPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQTMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYGGIGSG-RPVTPPRGAKA 323          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A267F934 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028215g1 PE=3 SV=1)

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 311/324 (95.99%), Postives = 316/324 (97.53%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MADSDKLN+DSIIARLLEVRGSRPGKNVQLSE EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQ+MEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY  +  G RP+TPPRG  A
Sbjct:    1 MADSDKLNIDSIIARLLEVRGSRPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQTMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYGGIGSG-RPVTPPRGTKA 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:103034518])

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 290/325 (89.23%), Postives = 307/325 (94.46%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLN--QGNRPITPPRGGV 1014
            M +SDKLN+DSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGD+HGQY+DLLRLFEYGG+PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDLQSMEQIRR+MRPTDVPDQGLLCDLLW+DPDK+ MGWGENDRGVSFTFG++VVAKFLHKHD+DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK   Y+        RP+TPPR   
Sbjct:    1 MTESDKLNIDSIIQRLLEVKGSRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVMGWGENDRGVSFTFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLLSYSGAGGFGSGRPVTPPRNAA 325          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ENSAMXT00000007129.2 (protein phosphatase 1 catalytic subunit gamma [Source:NCBI gene;Acc:103037187])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 297/324 (91.67%), Postives = 308/324 (95.06%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MAD DKLN+DSII RLLEVRGS+PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGG+PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDEC+RRYNIKLWKTFTDCFNCLPIAAI+D KIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK P +S     RP+TPPR  V 
Sbjct:    1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECRRRYNIKLWKTFTDCFNCLPIAAIVDGKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK-PNSS-----RPVTPPRNMVT 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1caa (serine/threonine-protein phosphatase alpha-2 isoform-like [Source:NCBI gene;Acc:103034594])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 288/325 (88.62%), Postives = 306/325 (94.15%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK--KFPYNSLNQGNRPITPPRGGV 1014
            MA+ DKLN+DSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGD+HGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYK+KYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDLQSMEQ+RR+MRPTDVPDQGLLCDLLW+DPDK+ +GWGENDRGVSFTFGA+VVAKFLHKHD+DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK   +         RP+TPPR   
Sbjct:    1 MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLYSYGGGGGMGSGRPVTPPRNSA 325          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 286/325 (88.00%), Postives = 307/325 (94.46%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGGVA 1017
            MA+S+ LN+DS+I+RLLEVRG RPGK VQ++E E+RGLCLKSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFGA+VV+KFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDE+LMCSFQILKP++KK K+ Y  +N G RP+TPPR   A
Sbjct:    1 MAESE-LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYGGVNSG-RPVTPPRTTQA 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103028275])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 284/325 (87.38%), Postives = 306/325 (94.15%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGGVA 1017
            MA+ + LN+DS+I+RLLEVRG RPGK VQ++E E+RGLC+KSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFGA+VV+KFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDE+LMCSFQILKP++KK K+ Y  +N G RP+TPPR   A
Sbjct:    1 MAEGE-LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYGGVNSG-RPVTPPRTAQA 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 291/305 (95.41%), Postives = 296/305 (97.05%), Query Frame = 1
Query:  100 VRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGV 1014
            VRGSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHE ASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+TMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY  LN G RP+TPPR   
Sbjct:    1 VRGSRPGKNVQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHE-ASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYVGLNAG-RPVTPPRNAA 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 489.189 bits (1258), Expect = 3.144e-175
Identity = 234/265 (88.30%), Postives = 248/265 (93.58%), Query Frame = 1
Query:  232 GDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ---GLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGGV 1014
            GDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD    GLLCDLLWSDPDK+  GWGENDRGVSFTFG +VV+KFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDETLMCSFQILKP++KK K+ Y  +N G RP+TPP+  V
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGDAGLLCDLLWSDPDKDVQGWGENDRGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSG-RPVTPPKAAV 264          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 426.402 bits (1095), Expect = 2.538e-151
Identity = 202/221 (91.40%), Postives = 211/221 (95.48%), Query Frame = 1
Query:   88 RLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKF 750
            RL  VRG RPGK V ++E E+RGLC+KSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFGA+VV+KF
Sbjct:    1 RLPTVRGCRPGKTVHMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005085.1 (pep scaffold:Pmarinus_7.0:GL481040:2845:3652:-1 gene:ENSPMAG00000004627.1 transcript:ENSPMAT00000005085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.113 bits (601), Expect = 9.017e-78
Identity = 112/123 (91.06%), Postives = 117/123 (95.12%), Query Frame = 1
Query:   91 LLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 459
            +  VRGSRPGK V +SE E+R LC+KSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD
Sbjct:   12 MYAVRGSRPGKTVHMSEAEVRALCIKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 134          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 223.016 bits (567), Expect = 4.905e-68
Identity = 106/259 (40.93%), Postives = 158/259 (61.00%), Query Frame = 1
Query:  178 IFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGEND-------RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM 915
            I   +  ++++EAP+ +CGDIHGQ+FDL++LFE GG P  + YLFLGDYVDRG  S+E +  L A KI YP   FLLRGNHEC  +   + F  ECK +Y   ++    D F+CLP+AA+++++  C HGGLSP++ ++E IR++ R  + P  G +CDLLWSDP ++       +       RG S+ +    V  FL  ++L  + RAH+  + GY  + K Q      L+T+FSAPNY   ++N  A++  +  +M
Sbjct:   54 ILRREKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTETVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFKEPPAFGPMCDLLWSDPSEDFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM 312          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 256/299 (85.62%), Postives = 278/299 (92.98%), Query Frame = 1
Query:   52 DSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK 948
            DS  +++D+II RLLEVRGS+PG+ V L E EIR LC K+R IF+ QPILLELEAP+KICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF+LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFC HGGLSPDL SMEQIRR+MRPTD+PD GLLCDLLWSDPDK+ +GW ENDRGVSFTFG +VV +FL K D++LICRAHQVVEDGYEFF+KRQLVTLFSAPNYCGEFDNAGAMMSVDE+L+CSFQILKPA K
Sbjct:    2 DSQPVDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ1 (Serine/threonine protein phosphatase Z, isoform of Ppz2p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000004478])

HSP 1 Score: 418.313 bits (1074), Expect = 1.258e-141
Identity = 195/295 (66.10%), Postives = 230/295 (77.97%), Query Frame = 1
Query:   64 LNLDSIIARLLEV-RGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD 945
            +++D  I +LL+    ++  KNV L   EI  +C+K+REIFLSQP LLEL  P+KI GD+HGQY DLLRLF   GFPP SNYLFLGDYVDRGKQSLETI LL  YKIKYPENFFLLRGNHECA++ R+YGFYDECKRR NIK+WKTF D FN LP+AAI+  KIFC HGGLSP L SM++IR ++RPTDVPD GL+ DLLWSDP      W +N+RGVS+ +    + KFL+K   DL+CRAH VVEDGYEFF  R LVT+FSAPNYCGEFDN GA+MSV E L+CSF++L P D
Sbjct:  361 IDIDETIQKLLDAGYAAKRTKNVCLKNNEILQICIKAREIFLSQPSLLELSPPVKIVGDVHGQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLFCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDEIRHVVRPTDVPDFGLINDLLWSDPTDSPNEWEDNERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSVSEGLLCSFELLDPLD 655          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ2 (Serine/threonine protein phosphatase Z, isoform of Ppz1p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000002844])

HSP 1 Score: 413.69 bits (1062), Expect = 1.466e-139
Identity = 194/295 (65.76%), Postives = 231/295 (78.31%), Query Frame = 1
Query:   64 LNLDSIIARLLEVR-GSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD 945
            +++D II RLL+    ++  KNV L  +EI  +C K+RE+FL+QP LLEL   +KI GD+HGQY DLLRLF   GFPP +NYLFLGDYVDRGKQSLETI LLL YKIKYPENFFLLRGNHECA++ R+YGFYDECKRR NIK+WKTF D FN LP+AAI+  KIFC HGGLSP L SM++IR + RPTDVPD GL+ DLLWSDP   +  W +N+RGVSF +    + KFL+K   DL+CRAH VVEDGYEFF  R LVT+FSAPNYCGEFDN GA+M+V E L+CSF++L P D
Sbjct:  396 VDIDEIIQRLLDAGYAAKRTKNVCLKNSEIIQICHKARELFLAQPALLELSPSVKIVGDVHGQYADLLRLFTKCGFPPMANYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTDSSNEWEDNERGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMTVSEGLLCSFELLDPLD 690          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPQ1 (Protein phosphatase that regulates the mating response; negatively regulates the MAP kinase signaling cascade during mating; member of the serine/threonine phosphatase PP1 family [Source:SGD;Acc:S000006100])

HSP 1 Score: 389.808 bits (1000), Expect = 2.766e-132
Identity = 178/303 (58.75%), Postives = 225/303 (74.26%), Query Frame = 1
Query:   49 ADSDKLNLDSIIARLLEVRGSR------PGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP 939
            + ++ L++D  I +LL+V  SR        KN      EI+ +C  +REIFL+QP LL L+AP+K+ GD+HGQ+ DLLR+ +  G P ++NYLFLGDYVDRGK SLETI LLL YKIKY +NFF+LRGNHE A++ ++YGFYDECKRR + K+WK F D FN LP+AAII +KIFC HGG+SPDL  M+QI ++ RPTD+P+ GL+ DLLWSDPD +   W ENDRGVS+TF    V  F  K   DLI R H VVEDGYEFFA+++ VT+FSAPNYCGEF N GA+MSV   +MCSF++LKP
Sbjct:  233 SSNEGLDIDVAIEKLLQVGESREITKTSKKKNFPFHSWEIQLICYHAREIFLNQPTLLRLQAPIKVVGDVHGQFNDLLRILKLSGVPSDTNYLFLGDYVDRGKNSLETILLLLCYKIKYKDNFFMLRGNHESANVTKMYGFYDECKRRLSSKVWKMFVDVFNTLPLAAIIQDKIFCVHGGISPDLHDMKQIEKVARPTDIPESGLVTDLLWSDPDPQVTDWSENDRGVSYTFSKRNVLDFCAKFKFDLILRGHMVVEDGYEFFARKKFVTIFSAPNYCGEFHNWGAVMSVTTGMMCSFELLKP 535          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 280.411 bits (716), Expect = 5.191e-92
Identity = 132/277 (47.65%), Postives = 185/277 (66.79%), Query Frame = 1
Query:  133 LSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFP 960
            LSE ++  LC  + ++   +  +  +  P+ ICGD+HGQ+ DLL LF+ GG  P++NYLF+GDYVDRG  S+ET+  L+A K++YP    +LRGNHE   I ++YGFYDEC R+Y +  +WK FTD F+  PI A++D KIFC HGGLSP +++++Q+R + R  +VP +G +CDLLWSDPD    GWG + RG  FTFG +V  +F H +DL LI RAHQ+V +GY +  ++ +VT+FSAPNYC    N  A+M VDE     F    P+ +   P
Sbjct:   83 LSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRG-GWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEP 358          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 300/321 (93.46%), Postives = 312/321 (97.20%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRG 1008
            MA+ +KLN+DSII+RLLEVRGSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+  GWGENDRGVSFTFG ++VAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY  LN G RP+TPPRG
Sbjct:    1 MAEPEKLNVDSIISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYGGLNSG-RPVTPPRG 320          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 292.738 bits (748), Expect = 3.542e-97
Identity = 137/298 (45.97%), Postives = 199/298 (66.78%), Query Frame = 1
Query:   73 DSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY 963
            D   A+ LEV   +  +  QL+E +++ LC K++EI   +  + E++ P+ +CGD+HGQ+ DL+ LF  GG  P++NYLF+GDYVDRG  S+ET+ LL+  K+++P    +LRGNHE   I ++YGFYDEC R+Y N  +WK FTD F+ LP+ A++D +IFC HGGLSP + +++ IR + R  +VP +G +CDLLWSDPD +  GWG + RG  +TFG ++   F H + L LI RAHQ+V +GY +   R +VT+FSAPNYC    N  A+M +D+ L  SF    PA ++  P+
Sbjct:    4 DKTTAKDLEVWIEQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNASVWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPD-DRGGWGISPRGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDALKYSFLQFDPAPRRGEPH 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 282.722 bits (722), Expect = 3.400e-93
Identity = 127/271 (46.86%), Postives = 193/271 (71.22%), Query Frame = 1
Query:  133 LSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA 942
            ++E E++ LC K+REI + +  +  +++P+ +CGDIHGQ++DL  LF+ GG  P++NYLF+GD+VDRG  S+ET  LLLA K++YP+   L+RGNHE   I ++YGFYDEC ++Y +I +W+   + F+ L ++AIID ++FC HGGLSP + +++QIR I R  +VP  G +CDLLWSDP+ +  GWG + RG  + FG++VVA++   +D+DLICRAHQ+V +GY++     ++T++SAPNYC    N  A++ +DE L   F I + A
Sbjct:   20 ITEKEVKQLCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDRKQEVPHDGPMCDLLWSDPE-DIQGWGVSPRGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLKREFTIFEAA 289          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO40084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D8])

HSP 1 Score: 256.914 bits (655), Expect = 3.040e-85
Identity = 115/159 (72.33%), Postives = 136/159 (85.53%), Query Frame = 1
Query:  466 KRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA 942
            KRRYNIKLWK FTDCFNCLPIAAI+++ IFC HGGLSPDLQ +++IR + RP DVPD+GL+CDLLWSDPD++  GWG+NDRGVS+TFG +VV ++L K+   L+ RAHQVVEDGY FF KR+LVTLFSAPNYCGEFDNAG +MSV E LMCSF ILK +
Sbjct:    2 KRRYNIKLWKIFTDCFNCLPIAAIVEQTIFCMHGGLSPDLQGLDEIRNLERPMDVPDKGLVCDLLWSDPDEDITGWGDNDRGVSWTFGGDVVREYLEKYGFSLVVRAHQVVEDGYRFFEKRKLVTLFSAPNYCGEFDNAGGVMSVGENLMCSFSILKVS 160          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 211.846 bits (538), Expect = 6.096e-64
Identity = 101/259 (39.00%), Postives = 158/259 (61.00%), Query Frame = 1
Query:  178 IFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDP------DKETMGWGEND-RGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM 915
            I   +  +LE++AP+ +CGDIHGQ++DL++LFE GG P  + YLFLGDYVDRG  S+E +  L   K  Y    FLLRGNHEC  +   + F  ECK +Y+  ++    + F+CLP+AA+++++  C HGGLSP++ +++ ++++ R  + P  G +CDLLWSDP      +K +  +  N  RG S+ +      +FL  ++L  I RAH+  + GY  + K Q      L+T+FSAPNY   ++N  A++  +  +M
Sbjct:   49 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFKEPPAFGPMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM 307          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1caa (serine/threonine-protein phosphatase alpha-2 isoform-like [Source:NCBI gene;Acc:101169945])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 292/320 (91.25%), Postives = 308/320 (96.25%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPR 1005
            MA+ DKLN+DSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGD+HGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDLQSMEQIRR+MRPTDVPDQGLLCDLLW+DPDK+ +GWGENDRGVSFTFGA+VVAKFLHKHD+DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK +PY       RP+TPPR
Sbjct:    1 MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLYPYGGGMGSGRPVTPPR 320          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000019964.2 (protein phosphatase 1 catalytic subunit gamma [Source:NCBI gene;Acc:101161814])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 297/324 (91.67%), Postives = 308/324 (95.06%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MAD DKLN+DSII RLLEVRG++PGKNVQL E EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDK+ +GWGENDRGVSFTFG+EVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA+KKK        G+RP+TPPR  V 
Sbjct:    1 MADVDKLNIDSIIQRLLEVRGAKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGSEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK------PNGSRPVTPPRNMVT 318          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:101171445])

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 290/321 (90.34%), Postives = 306/321 (95.33%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKF-PYNSLNQGNRPITPPR 1005
            MA++DKLN+DSII RLLEV+GSRPGKNVQL+E EIRGLCLKSREIFLSQPILLELEAPLKICGD+HGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP+AAI+DEKIFCCHGGLSPDLQSMEQIRR+MRPTDVPDQGLLCDLLW+DPDK+ +GWGENDRGVSFTFGA+VV KFLHKHD+DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK F          RP+TPPR
Sbjct:    1 MAEADKLNIDSIIQRLLEVKGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVTKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKLFYGGGGGMGSGRPVTPPR 321          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101155811])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 284/325 (87.38%), Postives = 306/325 (94.15%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPRGGVA 1017
            MA+ + LN+DS+I+RLLEVRG RPGK VQ++E E+RGLC+KSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFGA+VV+KFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDE+LMCSFQILKP++KK K+ Y  +N G RP+TPPR   A
Sbjct:    1 MAEGE-LNVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSFQILKPSEKKAKYQYGGVNSG-RPVTPPRTAQA 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000013925.2 (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101158483])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 282/321 (87.85%), Postives = 305/321 (95.02%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPITPPR 1005
            MA+ + L++DS+I+RLLEVRG RPGK VQ++E E+RGLC+KSREIFLSQPILLELEAPLKICGDIHGQY DLLRLFEYGGFPPE+NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFTDCFNCLPIAAI+DEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPD GLLCDLLWSDPDK+  GWGENDRGVSFTFGA+VV+KFL++HDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG MMSVDETLMCSFQILKP++KK K+ Y  +N G RP+TPPR
Sbjct:    1 MAEGE-LDVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNTG-RPVTPPR 319          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000067423.1 (SMESG000067423.1)

HSP 1 Score: 671.774 bits (1732), Expect = 0.000e+0
Identity = 324/324 (100.00%), Postives = 324/324 (100.00%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA
Sbjct:    1 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 324          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000075857.1 (SMESG000075857.1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 314/324 (96.91%), Postives = 317/324 (97.84%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYNSLNQGNRPITPPRGGVA 1017
            M D DKLN+DSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQY+DLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPY  +NQGNRPITPPR   A
Sbjct:    1 MGDVDKLNIDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKKKFPYRDMNQGNRPITPPRAAAA 324          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000015282.1 (SMESG000015282.1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 264/318 (83.02%), Postives = 287/318 (90.25%), Query Frame = 1
Query:   46 MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK-KFPYNSLNQGNRPIT 996
            M DSD LN+DS+I RLLEVRG RPGK V + E EIR LCLKS+EIFL+Q ILLELEAP+KICGDIHGQY DLLRLFEYGGFPP+SNYLFLGDYVDRGK SLETICLLLAYKIKYPENFFLLRGNHE A+INRIYGFYDECKRR+ IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSM+QIRRI RPT++PD GLLCD+LWSDPDKE   WGENDRGVSFTFG+++V+KFL++HDLDLICRAHQVVEDGYEFFA+RQLVTLFSAPNYCGEFDNAG MMSVDE L+CSFQILKP +KK K+ Y  LN    P T
Sbjct:    1 MPDSD-LNVDSLITRLLEVRGCRPGKTVDMKEDEIRALCLKSKEIFLNQNILLELEAPIKICGDIHGQYTDLLRLFEYGGFPPDSNYLFLGDYVDRGKFSLETICLLLAYKIKYPENFFLLRGNHESAAINRIYGFYDECKRRFTIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMDQIRRITRPTEIPDTGLLCDILWSDPDKEVEAWGENDRGVSFTFGSDIVSKFLNRHDLDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMSVDENLLCSFQILKPTEKKAKYQYLGLNTRPNPTT 317          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000024840.1 (SMESG000024840.1)

HSP 1 Score: 456.833 bits (1174), Expect = 2.176e-161
Identity = 211/299 (70.57%), Postives = 256/299 (85.62%), Query Frame = 1
Query:   55 SDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 951
            S  +NL++II++LLE + S   K V L+E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP+++  G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    3 SMTVNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 301          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000024840.1 (SMESG000024840.1)

HSP 1 Score: 456.833 bits (1174), Expect = 2.353e-161
Identity = 210/296 (70.95%), Postives = 255/296 (86.15%), Query Frame = 1
Query:   64 LNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKK 951
            +NL++II++LLE + S   K V L+E EI+GLC KS+EIF+SQ  LLELEAPLKICGDIHGQY DLLRLF+YGG+PP +NYLFLGDYVDRGKQS+E +CLLLAYKIK+PENFFLLRGNHE +++NR+YGFYDE KRRY+IK+WK FTD FN LP AA+IDEKI C HGGLSP L+  +Q+R I RPT+VPD+GL CD+LW+DP+++  G+ ENDRGVS+ FG + V +FL ++D+DLICRAHQVVEDGYEFF KR+LVT+FSAPNYCGEFDNAGAMMSVDE L+CSF +LKP  K+
Sbjct:    3 VNLETIISKLLEFKNSNAIKLVNLTEYEIKGLCSKSKEIFMSQSSLLELEAPLKICGDIHGQYVDLLRLFDYGGYPPTANYLFLGDYVDRGKQSIECMCLLLAYKIKFPENFFLLRGNHESSALNRVYGFYDEVKRRYSIKVWKMFTDMFNTLPFAALIDEKIICFHGGLSPSLKFAKQLRDIKRPTEVPDEGLECDILWADPERDIKGFRENDRGVSYVFGEDAVERFLAENDIDLICRAHQVVEDGYEFFCKRKLVTIFSAPNYCGEFDNAGAMMSVDENLLCSFHVLKPQTKR 298          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1CA0.000e+093.50protein phosphatase 1 catalytic subunit alpha [Sou... [more]
PPP1CC0.000e+091.98protein phosphatase 1 catalytic subunit gamma [Sou... [more]
PPP1CC0.000e+092.81protein phosphatase 1 catalytic subunit gamma [Sou... [more]
PPP1CA0.000e+090.42protein phosphatase 1 catalytic subunit alpha [Sou... [more]
PPP1CC0.000e+095.93protein phosphatase 1 catalytic subunit gamma [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsp-20.000e+091.02Serine/threonine-protein phosphatase PP1-beta [So... [more]
gsp-10.000e+084.00Serine/threonine-protein phosphatase PP1-alpha [S... [more]
pph-14.149e-15366.89Serine/threonine-protein phosphatase [Source:UniP... [more]
gsp-37.992e-12654.21Serine/threonine-protein phosphatase PP1-gamma [S... [more]
gsp-45.809e-12553.33Serine/threonine-protein phosphatase PP1-delta [S... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pp1alpha-96A0.000e+090.28gene:FBgn0003134 transcript:FBtr0334334[more]
Pp1alpha-96A0.000e+090.28gene:FBgn0003134 transcript:FBtr0084642[more]
Pp1-87B0.000e+093.65gene:FBgn0004103 transcript:FBtr0082595[more]
Pp1-13C0.000e+091.33gene:FBgn0003132 transcript:FBtr0074017[more]
flw0.000e+083.59gene:FBgn0000711 transcript:FBtr0071447[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01076667.10.000e+091.36protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cab0.000e+090.37protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1caa0.000e+088.89protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1cb0.000e+087.38protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1caa0.000e+086.60protein phosphatase 1, catalytic subunit, alpha is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cc0.000e+091.98protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cb0.000e+088.79protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cc0.000e+090.71protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cc0.000e+090.71protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cc0.000e+092.46protein phosphatase 1, catalytic subunit, gamma is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1ca0.000e+093.19protein phosphatase 1 catalytic subunit alpha [Sou... [more]
Ppp1ca0.000e+093.19protein phosphatase 1 catalytic subunit alpha [Sou... [more]
Ppp1cc0.000e+091.98protein phosphatase 1 catalytic subunit gamma [Sou... [more]
Ppp1cc0.000e+092.55protein phosphatase 1 catalytic subunit gamma [Sou... [more]
Ppp1cb0.000e+088.79protein phosphatase 1 catalytic subunit beta [Sour... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62138|PP1A_RAT0.000e+093.50Serine/threonine-protein phosphatase PP1-alpha cat... [more]
sp|P62139|PP1A_RABIT0.000e+093.50Serine/threonine-protein phosphatase PP1-alpha cat... [more]
sp|P62136|PP1A_HUMAN0.000e+093.50Serine/threonine-protein phosphatase PP1-alpha cat... [more]
sp|Q3T0E7|PP1A_BOVIN0.000e+093.50Serine/threonine-protein phosphatase PP1-alpha cat... [more]
sp|P62137|PP1A_MOUSE0.000e+093.19Serine/threonine-protein phosphatase PP1-alpha cat... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PI720.000e+096.59Serine/threonine-protein phosphatase OS=Pomacea ca... [more]
K1PXG60.000e+096.88Serine/threonine-protein phosphatase OS=Crassostre... [more]
A0A1S3I9H30.000e+096.88Serine/threonine-protein phosphatase OS=Lingula un... [more]
A0A267ENW30.000e+095.99Serine/threonine-protein phosphatase OS=Macrostomu... [more]
A0A267F9340.000e+095.99Serine/threonine-protein phosphatase OS=Macrostomu... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab0.000e+089.23serine/threonine-protein phosphatase alpha-2 isofo... [more]
ENSAMXT00000007129.20.000e+091.67protein phosphatase 1 catalytic subunit gamma [Sou... [more]
ppp1caa0.000e+088.62serine/threonine-protein phosphatase alpha-2 isofo... [more]
ppp1cb0.000e+088.00serine/threonine-protein phosphatase PP1-beta cata... [more]
PPP1CB0.000e+087.38serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab0.000e+095.41protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.13.144e-17588.30pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp1cb2.538e-15191.40protein phosphatase 1, catalytic subunit, beta iso... [more]
ENSPMAT00000005085.19.017e-7891.06pep scaffold:Pmarinus_7.0:GL481040:2845:3652:-1 ge... [more]
ppp3cb4.905e-6840.93protein phosphatase 3, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GLC70.000e+085.62Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPZ11.258e-14166.10Serine/threonine protein phosphatase Z, isoform of... [more]
PPZ21.466e-13965.76Serine/threonine protein phosphatase Z, isoform of... [more]
PPQ12.766e-13258.75Protein phosphatase that regulates the mating resp... [more]
PPH215.191e-9247.65Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO446480.000e+093.46Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297593.542e-9745.97Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499363.400e-9346.86Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO400843.040e-8572.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362726.096e-6439.00Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1caa0.000e+091.25serine/threonine-protein phosphatase alpha-2 isofo... [more]
ENSORLT00000019964.20.000e+091.67protein phosphatase 1 catalytic subunit gamma [Sou... [more]
ppp1cab0.000e+090.34serine/threonine-protein phosphatase alpha-2 isofo... [more]
PPP1CB0.000e+087.38serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSORLT00000013925.20.000e+087.85serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067423.10.000e+0100.00SMESG000067423.1[more]
SMESG000075857.10.000e+096.91SMESG000075857.1[more]
SMESG000015282.10.000e+083.02SMESG000015282.1[more]
SMESG000024840.12.176e-16170.57SMESG000024840.1[more]
SMESG000024840.12.353e-16170.95SMESG000024840.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017883 ID=SMED30017883|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1261bp
AAATATTTGAAATAGCATCTATTGCTAGCATAACCAAAACAAATAATGGC
AGATTCAGATAAATTAAATTTAGATAGTATAATTGCAAGACTTTTAGAAG
TACGAGGATCTCGACCTGGAAAAAATGTTCAATTATCTGAAACTGAAATT
CGTGGTTTATGCTTGAAGTCAAGAGAAATATTTCTCAGTCAACCGATTTT
ATTGGAATTAGAAGCACCATTAAAAATTTGTGGTGATATTCATGGTCAAT
ATTTTGATTTATTGAGGTTATTTGAATATGGTGGATTTCCTCCTGAATCA
AATTATTTATTTCTTGGCGATTATGTTGATCGTGGAAAGCAATCATTAGA
AACAATTTGTTTGTTATTAGCATATAAAATTAAATATCCAGAAAATTTCT
TTTTACTTCGTGGTAACCATGAATGTGCATCAATAAATAGAATTTATGGA
TTTTATGATGAATGTAAGCGACGATATAATATTAAACTCTGGAAAACGTT
TACTGACTGTTTCAATTGTTTACCAATCGCTGCAATAATTGATGAGAAGA
TATTTTGTTGTCATGGAGGTCTTTCACCAGATCTACAATCCATGGAACAA
ATTCGTCGCATAATGAGACCAACAGATGTTCCAGATCAAGGTTTACTTTG
TGATCTGTTGTGGTCTGATCCTGACAAAGAAACCATGGGCTGGGGTGAGA
ATGACCGTGGTGTCAGTTTTACTTTTGGAGCTGAAGTTGTTGCTAAATTT
TTACATAAACATGATTTGGATTTGATTTGTCGAGCTCATCAAGTTGTAGA
AGATGGTTATGAATTCTTTGCCAAACGACAATTGGTAACTTTATTTTCTG
CTCCTAATTATTGTGGAGAATTCGATAATGCTGGAGCAATGATGTCAGTT
GATGAAACGTTGATGTGTTCTTTTCAAATATTAAAGCCAGCTGACAAAAA
GAAATTTCCCTATAATTCATTGAATCAGGGCAATCGTCCTATAACCCCTC
CACGAGGAGGTGTTGCAAAAGGAAAAGGAAAAATGTAGATGTGAATTAGC
GACAAAAGTCAATTATGTTAATAAATATTGTTTATTGTCACATCTAACTA
GATACTAAATTCGCTAATACTTAATAAAAACTGTGAAATGATTTTATATT
GATCTTGTACCTTTGTACTCTCAATTTTGATGCTTATAATGCTTTGCAGT
CTTATGCTGCTTAAATACATACTACTTTACATTGAAACTGTTGATATTGA
GATAAATACAC
back to top

protein sequence of SMED30017883-orf-1

>SMED30017883-orf-1 ID=SMED30017883-orf-1|Name=SMED30017883-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=331bp
MADSDKLNLDSIIARLLEVRGSRPGKNVQLSETEIRGLCLKSREIFLSQP
ILLELEAPLKICGDIHGQYFDLLRLFEYGGFPPESNYLFLGDYVDRGKQS
LETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWK
TFTDCFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL
LCDLLWSDPDKETMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQV
VEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKKFPYNSLNQGNRPITPPRGGVAKGKGKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR037979PPP1CA
IPR006186Ser/Thr-sp_prot-phosphatase
IPR004843Calcineurin-like_PHP_ApaH
IPR029052Metallo-depent_PP-like
IPR031675STPPase_N
Vocabulary: molecular function
TermDefinition
GO:0004722protein serine/threonine phosphatase activity
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0000164protein phosphatase type 1 complex
GO:0072357PTW/PP1 phosphatase complex
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 58..85
score: 64.33
coord: 240..260
score: 61.61
coord: 262..278
score: 69.93
coord: 154..180
score: 61.27
coord: 183..210
score: 58.19
coord: 87..114
score: 73.97
coord: 120..144
score: 72.32
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 30..300
e-value: 2.3E-163
score: 558.7
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 121..126
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 60..249
e-value: 2.9E-40
score: 139.0
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 1..308
e-value: 4.3E-141
score: 470.9
IPR031675Serine-threonine protein phosphatase, N-terminalPFAMPF16891STPPase_Ncoord: 9..56
e-value: 9.0E-23
score: 80.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 311..330
NoneNo IPR availablePANTHERPTHR11668SERINE/THREONINE PROTEIN PHOSPHATASEcoord: 1..322
NoneNo IPR availableCDDcd07414MPP_PP1_PPKLcoord: 8..298
e-value: 0.0
score: 675.595
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 18..306
IPR037979Serine/threonine-protein phosphatase PP1-alpha catalytic subunitPANTHERPTHR11668:SF377SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA CATALYTIC SUBUNITcoord: 1..322