Alpha-int-1

Overview
NameAlpha-int-1
Smed IDSMED30017880
Length (bp)3694
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-int-1 (SMED30017880) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-int-1 (SMED30017880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-int-1 (SMED30017880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-int-1 (SMED30017880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017880

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017880SMESG000022733.1 dd_Smed_v4_11655_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017880SMESG000022733.1 dd_Smed_v4_11655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017880SMESG000022733.1 dd_Smed_v4_11655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30017880SMESG000022733.1 dd_Smed_v4_11655_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-int-1 vs. Ensembl Human
Match: ITGAV (integrin subunit alpha V [Source:HGNC Symbol;Acc:HGNC:6150])

HSP 1 Score: 109.768 bits (273), Expect = 1.935e-23
Identity = 175/753 (23.24%), Postives = 314/753 (41.70%), Query Frame = 3
Query:  318 SYFGYSISSFI--GQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNND-CSKVPMGSEGSGHVS---PGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD-----EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPK--GRSPFINSFSNEVV---VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQ-NFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPC------FGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNP----DCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPF 2462
            SYFG+++  F+       + LVGAP+           V  G V +  + +   C  +   + G+   +   P  F    W G SV +  +      L C P +  +T     + +Q+   +G C +  G+  + + +  C   D     +G C        S D ++  +V LG PGSF  +G +          + +++ K  P ++ +  YN     + A+  +     G S  +  F+ + +   V+  P  ++    G+V + D K ++S +    + +G  + + FG S+A  D NGD   D+ +GAP + D  +  K L ++G + +   + S  F+ T  N  +VF       +FG +IA LGD+D D  +D A+  P  G D  G VYI+ G         R   LN V        ++ +   RS   +FG+S+ G  DID N  PDLI+G +   + ++ R++ +I +   + + P+         N+ +K C         SC + +    K  G+ +    K+ F+V + LD   +    +R   + S+S   +K +  S   L    E+ + L +    + KL    P+ + +       +++    ++     +L+ F       +P ++ R      DCG D  C   + V +      +Y  D           +++   N GE AY  +L ++IP   +F       + L  L+C  +    T  VV  C   NP 
Sbjct:   47 SYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGI---VEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKI----LACAPLYHWRT-----EMKQEREPVGTCFLQDGT--KTVEYAPCRSQDIDADGQGFC----QGGFSIDFTKADRVLLGGPGSFYWQGQLI------SDQVAEIVSKYDP-NVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVP--RAARTLGMVYIYDGK-NMSSLY---NFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGK-LQEVGQVSVSLQRASGDFQTTKLNGFEVF------ARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNG---------RSTGLNAV----PSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSI-------LNQDNKTCSLPGTALKVSC-FNVRFCLKADGKGV-LPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLT---PITIFMEYRLDYRTAADTTGLQP----ILNQF-------TPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDD------NPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVV--CDLGNPM 717          
BLAST of Alpha-int-1 vs. Ensembl Human
Match: ITGAV (integrin subunit alpha V [Source:HGNC Symbol;Acc:HGNC:6150])

HSP 1 Score: 102.449 bits (254), Expect = 3.264e-21
Identity = 158/675 (23.41%), Postives = 284/675 (42.07%), Query Frame = 3
Query:  525 NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD-----EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPK--GRSPFINSFSNEVV---VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQ-NFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPC------FGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNP----DCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPF 2462
             W G SV +  +      L C P +  +T     + +Q+   +G C +  G+  + + +  C   D     +G C        S D ++  +V LG PGSF  +G +          + +++ K  P ++ +  YN     + A+  +     G S  +  F+ + +   V+  P  ++    G+V + D K ++S +    + +G  + + FG S+A  D NGD   D+ +GAP + D  +  K L ++G + +   + S  F+ T  N  +VF       +FG +IA LGD+D D  +D A+  P  G D  G VYI+ G         R   LN V        ++ +   RS   +FG+S+ G  DID N  PDLI+G +   + ++ R++ +I +   + + P+         N+ +K C         SC + +    K  G+ +    K+ F+V + LD   +    +R   + S+S   +K +  S   L    E+ + L +    + KL    P+ + +       +++    ++     +L+ F       +P ++ R      DCG D  C   + V +      +Y  D           +++   N GE AY  +L ++IP   +F       + L  L+C  +    T  VV  C   NP 
Sbjct:   76 QWFGASVRSKQDKI----LACAPLYHWRT-----EMKQEREPVGTCFLQDGT--KTVEYAPCRSQDIDADGQGFC----QGGFSIDFTKADRVLLGGPGSFYWQGQLI------SDQVAEIVSKYDP-NVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVP--RAARTLGMVYIYDGK-NMSSLY---NFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGK-LQEVGQVSVSLQRASGDFQTTKLNGFEVF------ARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNG---------RSTGLNAV----PSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSI-------LNQDNKTCSLPGTALKVSC-FNVRFCLKADGKGV-LPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLT---PITIFMEYRLDYRTAADTTGLQP----ILNQF-------TPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGD------DNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVV--CDLGNPM 671          
BLAST of Alpha-int-1 vs. Ensembl Human
Match: ITGA8 (integrin subunit alpha 8 [Source:HGNC Symbol;Acc:HGNC:6144])

HSP 1 Score: 100.908 bits (250), Expect = 9.885e-21
Identity = 136/577 (23.57%), Postives = 243/577 (42.11%), Query Frame = 3
Query:  273 FLVGLSKLYLHSNVN-SYFGYSISSFI-GQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFV---NNDCSKVPMGSEGS------GHVSPGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD-----EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIF-------LANFGPMSMIDKVLLKTSPSDLKNRGYN---LGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTD-HWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGG----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKR 1898
            F + + KL ++S    SYFGY++   I   + A  LVGAP+           V  G VY   +    +  C ++P  +  +      G   P  F    W G     TV    G  + C P +  +T     K   +   +G C +   +      F  C  ++     +G C     +  S D  +   + +G PGSF  +G +        +AN+    ++ K L     +++    Y+   LGY +                   S + +V   P    N   G V ++++    + + +I + +G  + S FG ++ V D N D + D++VGAP + +  + S+ R  ++G IY++    S  F+        +  G    G+FG ++A+LGD++ D  +D A+G P  G D  G V IY G     +  P QV++    +H + +                 FG++L G  DID N  PDLI+G + + ++ V R++ ++ ++  + L P   ++E      PD      +  + + + A V G+ I+ +  I+    + LD+  +    KR
Sbjct:   39 FNLDVEKLTVYSGPKGSYFGYAVDFHIPDARTASVLVGAPKANTSQPDI---VEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIRVNGTKEPIEFKSNQWFGA----TVKAHKGKVVACAPLYHWRTL----KPTPEKDPVGTCYVAIQNFSAYAEFSPCRNSNADPEGQGYC----QAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANYSFKDILRK-LAGEKQTEVAPASYDDSYLGYSVAAGEF-----------TGDSQQELVAGIPRGAQN--FGYVSIINS----TDMTFIQNFTGEQMASYFGYTVVVSDVNSDGLDDVLVGAPLFMEREFESNPR--EVGQIYLYLQVSSLLFR-----DPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLIYNGNKDGLNTKPSQVLQGVWASHAVPS----------------GFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVYRARPVVTVDAQLLLHPMIINLENKTCQVPDS--MTSAACFSLRVCASVTGQSIANT--IVLMAEVQLDSLKQKGAIKR 555          

HSP 2 Score: 68.9366 bits (167), Expect = 6.210e-11
Identity = 119/491 (24.24%), Postives = 205/491 (41.75%), Query Frame = 3
Query: 2181 DCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFD---KSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYP-------------ETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYF--LKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLK-QNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIE 3575
            DCG D  CV D++     LS+   K  +   ++  +  ++I   N GE AY  +L + IP+  ++       +G + L+C  ++   T  VV  C   NP V+  N                        +G      ++E T  + +FD   +S+NK + D     + FV +         V+ R  S    P Q V P             E +GP  +  + + N+GPS +    L +  PF ++  E +LY   ++ +       NP +I+  PQ I    +       PED+ +   L+A  RN    +   KR V  +E     + +P K              I++C N       +EC+ I C +  L       +++++R WA TF   K     + + +   +  + Y  +    L    + I  +VI+    ++  S +P+W I+L  LLGL++L ++ L LWKCGFF R R  + ++ +
Sbjct:  640 DCGEDNLCVPDLK-----LSARPDKHQVIIGDENHL-MLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENVTRMVV--CDLGNPMVSGTNY----------------------SLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPD-----SNFVSLQINITAVAQVEIRGVSH---PPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPF-SARDEFLLYIFHIQTLGPLQCQPNP-NIN--PQDIKPAAS-------PEDTPE---LSAFLRNSTIPHLVRKRDVHVVEF---HRQSPAK--------------ILNCTN-------IECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQRKNDPYALASLVSFEVKKMPYT-DQPAKLPEGSIVIKTSVIW-ATPNVSFS-IPLWVIILAILLGLLVLAILTLALWKCGFFDRARPPQEDMTD 1051          
BLAST of Alpha-int-1 vs. Ensembl Human
Match: ITGA3 (integrin subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:6139])

HSP 1 Score: 99.3673 bits (246), Expect = 2.749e-20
Identity = 135/484 (27.89%), Postives = 213/484 (44.01%), Query Frame = 3
Query:  309 NVNSYFGYSIS---SFIGQKEAYCLVGAPRD-EIDDESTNVNVNTGGVYRISFV--NNDCSKVPMGSEGSGHVSPGYF----NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDIS--------FLACSVTD---EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRG-YNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTK----LDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLI 1682
            N  S FGYS++       Q+    L GAPR+  + D  TN    TG VY        +DC ++ +  +      PG+      WLG +V++   G  G  L C  R+      G   SE Q   +G+C +       D S         +  S TD    G C        ++    +  V  G PG++  +GN ++     +   +  L + S  D +++G   +GY +++      PK          N  +VT +P    + + G V +L  +    L   Q+L        +G+ FG+++A+ D N D   D++VGAP+Y +     K  V  GAIY+F  Q    F    ++ + +  G +    FG+S+A++GDI+ D   D AVG P  G    G VYIY   SK             +L  PQ     +K  +     FG+SL+G+ D+D N  PDL++G   S  IV+LR++ +I
Sbjct:   47 NPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTN---RTGAVYLCPLTAHKDDCERMNITVKND----PGHHIIEDMWLGVTVAS--QGPAGRVLVCAHRYTQVLWSG---SEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMC-----QLGTSGGFTQNTVYFGAPGAYNWKGNSYM-----IQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPK----------NITIVTGAPR---HRHMGAVFLLSQEAGGDLRRRQVLE----GSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFER----KEEVG-GAIYVFMNQAGTSFP---AHPSLLLHGPS-GSAFGLSVASIGDINQDGFQDIAVGAPFEG---LGKVYIYHSSSK------------GLLRQPQQVIHGEKLGLPGLATFGYSLSGQMDVDENFYPDLLVGSL-SDHIVLLRARPVI 466          
BLAST of Alpha-int-1 vs. Ensembl Human
Match: ITGA3 (integrin subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:6139])

HSP 1 Score: 98.9821 bits (245), Expect = 3.228e-20
Identity = 135/484 (27.89%), Postives = 213/484 (44.01%), Query Frame = 3
Query:  309 NVNSYFGYSIS---SFIGQKEAYCLVGAPRD-EIDDESTNVNVNTGGVYRISFV--NNDCSKVPMGSEGSGHVSPGYF----NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDIS--------FLACSVTD---EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRG-YNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTK----LDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLI 1682
            N  S FGYS++       Q+    L GAPR+  + D  TN    TG VY        +DC ++ +  +      PG+      WLG +V++   G  G  L C  R+      G   SE Q   +G+C +       D S         +  S TD    G C        ++    +  V  G PG++  +GN ++     +   +  L + S  D +++G   +GY +++      PK          N  +VT +P    + + G V +L  +    L   Q+L        +G+ FG+++A+ D N D   D++VGAP+Y +     K  V  GAIY+F  Q    F    ++ + +  G +    FG+S+A++GDI+ D   D AVG P  G    G VYIY   SK             +L  PQ     +K  +     FG+SL+G+ D+D N  PDL++G   S  IV+LR++ +I
Sbjct:   47 NPGSLFGYSVALHRQTERQQRYLLLAGAPRELAVPDGYTN---RTGAVYLCPLTAHKDDCERMNITVKND----PGHHIIEDMWLGVTVAS--QGPAGRVLVCAHRYTQVLWSG---SEDQRRMVGKCYVRGNDLELDSSDDWQTYHNEMCNSNTDYLETGMC-----QLGTSGGFTQNTVYFGAPGAYNWKGNSYM-----IQRKEWDLSEYSYKDPEDQGNLYIGYTMQVGSFILHPK----------NITIVTGAPR---HRHMGAVFLLSQEAGGDLRRRQVLE----GSQVGAYFGSAIALADLNNDGWQDLLVGAPYYFER----KEEVG-GAIYVFMNQAGTSFP---AHPSLLLHGPS-GSAFGLSVASIGDINQDGFQDIAVGAPFEG---LGKVYIYHSSSK------------GLLRQPQQVIHGEKLGLPGLATFGYSLSGQMDVDENFYPDLLVGSL-SDHIVLLRARPVI 466          
BLAST of Alpha-int-1 vs. Ensembl Celegans
Match: ina-1 (Integrin alpha ina-1 [Source:UniProtKB/Swiss-Prot;Acc:Q03600])

HSP 1 Score: 88.5817 bits (218), Expect = 2.060e-17
Identity = 135/504 (26.79%), Postives = 220/504 (43.65%), Query Frame = 3
Query:  324 FGYSISSFIGQKEAYCLVGAPRDEIDDESTN-------VNVNT---GG------VYRISFVN-NDCSKVPMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDP--RFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTS---------PSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVL------DTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDI---GAIYIFYGQVSDKFKYT---VSNQNDVFKGVNVRGKFGMSIANLXXXX--XXXXXXFAVGCPNCGNDATGSVYIYLGGS------KVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLE 1691
            FGYS++      +   L+GAPR E     T         ++NT   GG        R  + N  D +K P  + G      G  + L  S   +    NG  L C P  R+    +Y      +    +   S Y     +++        + G C+ GFS++++     +  +  G+ G+    G +F A     ++ D V+ K +          + L    Y LGY + + R  +  +   P         VV+ +  +  +   G V+ L       +KL L++  +I + +  +GS FG S+ V D NGD   D+IVGAPF        +  +D    G +Y+++ Q   + ++    V +   + K  +   +FG+SI  LG++D     ++DFAVG P    D  G+VYIYLG        K P QVI+  +L ++   P          MRSF   G+SL+G  D+D N  PDL+IG  S + + +LRS+ +I +E
Sbjct:   38 FGYSVAEHFKGDKPVMLIGAPRGESGQTGTERAGAMYACDINTFYNGGSNHWCEQVRFEYENVEDYAKRPNETRGRTVHPLGKNDQLLASTIVSKGTKNGSALVCAPLIRYHQTAAYPQGACYELESNLRLQSTYATCAQKNLP-TTDRHNEYGGCMEGFSAAIT-----QDTIVTGLIGAVKWTGGVF-AKKSSANIFDSVVEKYTMNQPNGDMIRTRLVAHDY-LGYSVDIGRFGFWYEDGKPI-------TVVSGATRYGEH---GAVIFLPFIQDSSSKLTLNEDKFIINGTA-MGSAFGYSIEVVDLNGDGFDDLIVGAPF------EHRSGIDGNFGGIVYVYFSQGVQRKQHESHLVFHPPKILKNPDFYSQFGLSITKLGNVDGDKSKLNDFAVGAP-FAFDGAGAVYIYLGTKNIEKFRKKPAQVIKGNDLPNL---PPGG-------MRSF---GFSLSGGSDMDENGYPDLLIGSPSKNFVALLRSRPVISIE 502          
BLAST of Alpha-int-1 vs. Ensembl Celegans
Match: pat-2 (Integrin alpha pat-2 [Source:UniProtKB/Swiss-Prot;Acc:P34446])

HSP 1 Score: 81.2629 bits (199), Expect = 4.305e-15
Identity = 65/230 (28.26%), Postives = 108/230 (46.96%), Query Frame = 3
Query: 1026 KSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWT-------SSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGS----KVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLI 1682
            + N+  G +++  +KL +  I    ++S   G   G S+AV D N D   DII+G PFYTD+ +         K   D+G + +        F   ++       G +  G+FG ++A  GD++ D  +D  VG P  G +  G+VY+  G      ++P Q I   N+ H                 + ++FG+SL G  D+DGN +PD+ +G + S    VL +K ++
Sbjct:  270 RGNDLHGKLVLYTSKLKM-MINLTDEVSTQHGQYCGGSVAVADVNKDGRDDIIMGCPFYTDYGSVKDAKTQERKPQYDVGKVIVMLQTAPGVFGKQIA-----VVGDDQWGRFGHAVAAAGDLNLDGYNDVIVGAPYAGKNKQGAVYVIHGSKDGVRELPTQKIEGANIGH----------------GNIKSFGFSLTGNEDVDGNGMPDIAVGAWKSGNAAVLLTKPVV 477          
BLAST of Alpha-int-1 vs. Ensembl Fly
Match: if (gene:FBgn0001250 transcript:FBtr0301352)

HSP 1 Score: 103.605 bits (257), Expect = 8.049e-22
Identity = 134/496 (27.02%), Postives = 230/496 (46.37%), Query Frame = 3
Query:  315 NSYFGYSISSFIG-------QKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNNDCSKVPMGSEGSGH------VSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD------EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIF-YGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIY----LGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSI 1727
            NS FG+SI+   G       Q     +VGAP+ +       V    GGV++ S  ++DC  VP  S+G+        V    + WLG +V+T  +    + + C PR++  T         ++  +G C  +T     +   ++   T+      +G+C +GFS++++ + S   ++ +G PGS+  +G   +A+   ++  +  +  TS S   N    LGY +              F    S +V +           RG  LV    ++   +  I +++G  +G  FG SLA  D +GD + D+++GAP YTD      +  D+G +YI   G  +++ ++T  +  D   G + +G+FG+++  LGD++GD   DFAVG P  G +  G VYI+    +G    P Q+I+   L      P+               FG++L+G  D+DGN+ PDL +G YSS Q+ + +S+ +  +         SK I
Sbjct:   47 NSMFGFSIAMHKGRSGFYGNQNNVSLIVGAPKFDTSRYQQGV-TEAGGVFKCSLNDDDCKLVPFDSKGNNRNVDKEVVDRKSYQWLGATVATGRDSD--LVVACAPRYVFHTM--TPSRAFRIDPVGTC--FTSHNFEEFYEVSPCRTNNWGYHRQGSCQAGFSAAINGNGS---RLFIGAPGSWYWQG---MASSHDVTRPENQVFSTSESASVNDDSYLGYSMVTGD----------FDGDRSEDVAIGMP--------RGGNLVGRIVVNRWNMANIFNITGRQIGEYFGYSLATSDVDGDGLDDLLIGAPMYTDPDNVEGKY-DVGRVYILLQGGPTEEKRWTTEHIRD---GYHSKGRFGLALTTLGDVNGDGYGDFAVGAPYDGPEGRGVVYIFHGSPMGPLAKPSQIIKSEQLVEGAPYPRT--------------FGFALSGGLDMDGNTYPDLAVGAYSSDQVFIFKSRPVAAVNAETSFASNSKLI 493          
BLAST of Alpha-int-1 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0340190)

HSP 1 Score: 100.908 bits (250), Expect = 4.588e-21
Identity = 135/498 (27.11%), Postives = 216/498 (43.37%), Query Frame = 3
Query:  315 NSYFGYSISSFI-----GQKEAYC-LVGAPRDEIDDESTNVNVNTGGVYRISFVN--NDCSKVPMGSE---GSGHVSP------GYFNWLGGSVSTT---VNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLAC-------SVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMI-DKVLLKTSPSDLK---NRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYG-QVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSK----VPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPV 1700
            +S+FGYS+++       G  +  C LVGAP D+    +T    ++G ++R       +DC +V         S  +SP          W+G +V +     NGS G  + C  R++    Y V ++     G G C + T     +     C          D G C     +  SA   +   + LG PG +   G+I++   G   +  DK    +  SDL    ++   LG  +   R              F +      +P    +E  G V++ D   D    ++        GS+FG  LA  D NGD   D+IV AP Y   +T ++     GA+Y++   Q +   KYT+        G  +  +FG+++AN+GD++ D+ +D AVG P  GN   G VYIYLG S+     P Q I+   L   +   Q             + FG S++G  D+D NS PD++IG ++SS  V+L ++ +I ++  V
Sbjct:   49 HSHFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNT---THSGALWRCPMTQRFDDCEQVITDGRRNFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSGGKVIVCAHRYM----YIVRENR---YGQGLCYLLTNDLQFEEVHEPCKGRPVQRQHEDYGLC----QAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRF-------------FGHMSYAAGAPR---SEGHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLY---FTKTEG----GAVYVYQNIQDTLPMKYTLK-----LTGP-LESRFGLALANIGDLNKDNCEDLAVGAPYEGN---GVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQ-----------PIRTFGISISGNTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSV 489          
BLAST of Alpha-int-1 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0073732)

HSP 1 Score: 100.523 bits (249), Expect = 5.746e-21
Identity = 133/500 (26.60%), Postives = 216/500 (43.20%), Query Frame = 3
Query:  315 NSYFGYSISSFI-----GQKEAYC-LVGAPRDEIDDESTNVNVNTGGVYRISFVN--NDCSKVP-----------MGSEGSGHVSPGYFNWLGGSVSTT---VNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLAC-------SVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMI-DKVLLKTSPSDLK---NRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYG-QVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSK----VPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPV 1700
            +S+FGYS+++       G  +  C LVGAP D+    +T    ++G ++R       +DC +V            +   G+  +      W+G +V +     NGS G  + C  R++    Y V ++     G G C + T     +     C          D G C     +  SA   +   + LG PG +   G+I++   G   +  DK    +  SDL    ++   LG  +   R              F +      +P    +E  G V++ D   D    ++        GS+FG  LA  D NGD   D+IV AP Y   +T ++     GA+Y++   Q +   KYT+        G  +  +FG+++AN+GD++ D+ +D AVG P  GN   G VYIYLG S+     P Q I+   L   +   Q             + FG S++G  D+D NS PD++IG ++SS  V+L ++ +I ++  V
Sbjct:   49 HSHFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNT---THSGALWRCPMTQRFDDCEQVITDGRRNFDSEILSPPGNDEIKED--QWMGVTVRSNPLQANGSGGKVIVCAHRYM----YIVRENR---YGQGLCYLLTNDLQFEEVHEPCKGRPVQRQHEDYGLC----QAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRF-------------FGHMSYAAGAPR---SEGHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLY---FTKTEG----GAVYVYQNIQDTLPMKYTLK-----LTGP-LESRFGLALANIGDLNKDNCEDLAVGAPYEGN---GVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQ-----------PIRTFGISISGNTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSV 489          
BLAST of Alpha-int-1 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0310647)

HSP 1 Score: 98.5969 bits (244), Expect = 2.490e-20
Identity = 136/507 (26.82%), Postives = 217/507 (42.80%), Query Frame = 3
Query:  315 NSYFGYSISSFI-----GQKEAYC-LVGAPRDEIDDESTNVNVNTGGVYRISFVN--NDCSKVPM-GSEGSGHVS------------PG-----YFNWLGGSVSTT---VNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLAC-------SVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMI-DKVLLKTSPSDLK---NRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYG-QVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSK----VPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPV 1700
            +S+FGYS+++       G  +  C LVGAP D+    +T    ++G ++R       +DC +V   G   +G               PG        W+G +V +     NGS G  + C  R++    Y V ++     G G C + T     +     C          D G C     +  SA   +   + LG PG +   G+I++   G   +  DK    +  SDL    ++   LG  +   R              F +      +P    +E  G V++ D   D    ++        GS+FG  LA  D NGD   D+IV AP Y   +T ++     GA+Y++   Q +   KYT+        G  +  +FG+++AN+GD++ D+ +D AVG P  GN   G VYIYLG S+     P Q I+   L   +   Q             + FG S++G  D+D NS PD++IG ++SS  V+L ++ +I ++  V
Sbjct:   49 HSHFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNT---THSGALWRCPMTQRFDDCEQVITDGRRTNGAYEINKHFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSGGKVIVCAHRYM----YIVRENR---YGQGLCYLLTNDLQFEEVHEPCKGRPVQRQHEDYGLC----QAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRF-------------FGHMSYAAGAPR---SEGHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLY---FTKTEG----GAVYVYQNIQDTLPMKYTLK-----LTGP-LESRFGLALANIGDLNKDNCEDLAVGAPYEGN---GVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQ-----------PIRTFGISISGNTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSV 498          
BLAST of Alpha-int-1 vs. Ensembl Fly
Match: mew (gene:FBgn0004456 transcript:FBtr0330398)

HSP 1 Score: 90.5077 bits (223), Expect = 6.407e-18
Identity = 113/411 (27.49%), Postives = 179/411 (43.55%), Query Frame = 3
Query:  525 NWLGGSVSTT---VNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLAC-------SVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMI-DKVLLKTSPSDLK---NRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYG-QVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSK----VPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPV 1700
             W+G +V +     NGS G  + C  R++    Y V ++     G G C + T     +     C          D G C     +  SA   +   + LG PG +   G+I++   G   +  DK    +  SDL    ++   LG  +   R              F +      +P    +E  G V++ D   D    ++        GS+FG  LA  D NGD   D+IV AP Y   +T ++     GA+Y++   Q +   KYT+        G  +  +FG+++AN+GD++ D+ +D AVG P  GN   G VYIYLG S+     P Q I+   L   +   Q             + FG S++G  D+D NS PD++IG ++SS  V+L ++ +I ++  V
Sbjct:   36 QWMGVTVRSNPLQANGSGGKVIVCAHRYM----YIVRENR---YGQGLCYLLTNDLQFEEVHEPCKGRPVQRQHEDYGLC----QAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTYYSDHSDLNSPVDKYSYLGMSVTGGRF-------------FGHMSYAAGAPR---SEGHGQVVIFDKSTDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLY---FTKTEG----GAVYVYQNIQDTLPMKYTLK-----LTGP-LESRFGLALANIGDLNKDNCEDLAVGAPYEGN---GVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQ-----------PIRTFGISISGNTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSV 392          
BLAST of Alpha-int-1 vs. Ensembl Zebrafish
Match: itga3b (integrin, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-050411-55])

HSP 1 Score: 136.732 bits (343), Expect = 5.723e-32
Identity = 231/962 (24.01%), Postives = 402/962 (41.79%), Query Frame = 3
Query:  318 SYFGYSISSFIGQKEA---YCLVGAPRDEIDDESTNVNVN-TGGVYR--ISFVNNDCSKVPMGSE-GSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDIS-------FLACSVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNL--GY----DIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTK-LDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGG----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLE-----NPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRV---FISDLSSSLYKTDIYYKEKYQIRQVVIGIGNW------GENAYNVKLKITIPKVLEFQGLK---GLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGP--SPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVET 3071
            S FG+S++     ++A     LVGAP+++   + +   +N TG VY   I+   +DC  + + S   S  +  G   WLG +V++  NG  G  L C  R++ K    +   EQQ + +G+C +       D S       +  C    +       +  +S   +EK  V  G PGSF  +G + +      S         S   L    +N+  GY    DIKL         RS F        VV  +P    +E++G V++ D + L L Q++ I      +GS FG+ LAV D N D   D+IVGAPFY D +         GA+YIF  + +  F+   S    V KG    G FG ++A +GD++ D   D AVG P      +G VYI++G     +K P QVI  ++L                    FQ FG+SL+G  D+DGN  PD+++G     +I +LRS+ +I L       P  ++P+   I   K     K CF      Y         RK     +I  +  ID D   ++    R++ + +K S  T  L++S S   S  E+   +  P  +++     QP++ ++++S     +++   ++  + + +    G +  +    +  + +CG D  C S++++   F  +  +      + +    +   +++ + N        E+A+   L I+IP  L++ G++   G +      E  I     C   NPF +N+       +   T G              ++ T +++   +     +  +   +   L +   + +   +LE + +D+    + I          +G P +  F +  LG     L  + +    P+  +NG+ +LY  +                    I IKG++  +C  P + ++ LNL   +   K   RNKR V++
Sbjct:   39 SLFGFSVALHKQTEKAKKNLLLVGAPQEKAHPQLSKFKINETGAVYYCPITVNQDDCGSMDLISPPKSTDMLEGM--WLGVTVASQRNG--GRVLACGHRYVKKL---LGAEEQQRM-VGKCYVRGNDLSYDPSDYWQSETYELCDFNHDQDLEGMCNMGISGGMTEK-DVYFGTPGSFTWQGTVHMKCRDTDSDYAGDANDRSFGKLGEDKFNIYIGYSVLEDIKLL-------DRSVF-------TVVMGAPR---DEFKGSVILADKQDLILKQLMTIT--GEQIGSYFGSCLAVTDLNNDDWNDLIVGAPFYFDRYKEEG-----GAVYIFMNE-NGSFQKKASL---VLKGKKGSG-FGFAVAAVGDVNQDGFQDIAVGAP---FQDSGKVYIWMGSKSGITKEPSQVIEGKSLGP----------------SGFQTFGYSLSGGMDMDGNDYPDILVGSL-DDRIALLRSRPVIHLSKNFTVEPKIVIPSQCGISCIKV----KVCFS-----YTLSNGNSNFRK-----EITVKFTIDAD---QNRRGARVRFIDNKQSTFTGLLSFSAS---SCQELELSVNNPVTDKL-----QPIVFSLNVSLNQQKAAAQQTLQSLDSFPV--LSGQQILTDKAEINFHKECGDDNRCSSNLQLKARFADENYNPFPSQTLEFSSNVKKLVLMVEVSNTADENKPAEDAHQATLNISIPYSLKYSGVRPPAGFDMECSADEAVI-----CDLGNPFKSNQKV--SFIIIFETSGI-------------TLYTEQIQSQLQLSTISEQADLFPVLVTLNVKNTI-LTTFSLEKLIIDTSFSGNVIGESAMSSTSDVGSPLEFVFRVQVLGEPLGDLGTLVIDFDWPYAVANGKWLLYLTE--------------------IVIKGSSESHCVPPGNIVNYLNLTLSKEGTK---RNKREVDS 871          
BLAST of Alpha-int-1 vs. Ensembl Zebrafish
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 131.339 bits (329), Expect = 2.341e-30
Identity = 215/924 (23.27%), Postives = 380/924 (41.13%), Query Frame = 3
Query:  318 SYFGYSISSFIGQKE---AYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNND---CSKVPMGSEGS------GHVSPGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD-----EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKT------------SPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQG-------LKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYP-------ETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQ------QDSSGNPISIS 2930
            SYFGYS+  +   ++      LVGAP+           V  G VY   +  +D   C ++P     +      G   P  F    W G +V T      G  + C P +  +T     K   ++  +G C +   +      +  C   +     +G C     +  S D +++  + +G PGSF  +G +  A  G   +++   LKT            + SD  +  Y LGY + +                 S + +V   P    N   G V V++     + + +I + +G  + S FG ++AV D NGD + D++VGAP Y D    SK   ++G +Y++  +    F   ++       G+++ G++G +IA LGDI+ D   D A+G P  G D  G V+IY G              + +++        D         FG++L G  D+D N  PDL++G +  S++V  RS+ ++ ++  + L P   + E      P+      +C   +++ AK++G  I   + +  R+ + LD   +    KR+  + S     ++ L                L +    + KL+   P+ V ++ S   +S  +   +      + H  K + +  + I L    DCG D  C+ D++     LS+ + +T++   +   +  + I   N GE AY  +L +T+P   ++ G       L+ LNC  R   DT  VV  C   NP V + N      L++    +    ++    IG      +V+    N+D     N  S+   L L+  V  A   + G+     + +  + P  R  P       + +GP  Q  + + N GPS + +  L +  P +    E++LY L+ I+        +SS NP+ + 
Sbjct:   53 SYFGYSLDFYHPTQDRNVMSVLVGAPKANTSQPGI---VEGGAVYYCPWPASDPDSCRQIPFDKANNRMIKVNGTREPLEFKSHQWFGATVRT----HKGKVVACAPLYQWRTV----KVSSEMDPVGTCYVAVQNFSAYAEYSPCRTNNPDPEGQGFC----QAGFSVDFTKEGTLVVGGPGSFYWQGQVITA--GVAEILNGYSLKTILRKVQGEKQTVAASDTYDDSY-LGYSVAVGEF-----------TGDSEQELVAGVPRGAHN--FGYVTVINA----TNLTFIQNFTGEQMASYFGYTIAVTDLNGDGLDDVLVGAPLYMDREFESKPR-EVGRVYLYLQEDVLLFSPPIT-----LTGMHLFGRYGSAIAPLGDINQDGYLDVAIGAPFAGEDRGGRVFIYNGQK------------SGLMLQASQVLKGDWASSGIPAGFGFTLRGDSDLDNNQYPDLLVGAFGVSKVVAYRSRPVVTVDAQLILRPRILNPEDKSCRMPNSDIMV-TC-LSVNVCAKISG--IGIPDYVALRMELQLDWLKQRGAVKRVLFMDSHQHQRSQQLVLGQGDRQHCHNYSVYLRDEAEFRDKLS---PISVTLNYSLDQSSPPAGLQLRPV---LDHYSKTFHHEQANILL----DCGEDNMCIPDLK-----LSAKMDRTELIIGDD-NLLMLTINAANEGEGAYEAELHVTLPPEADYIGVERRREDLQRLNCEHRTENDTRIVV--CDLGNPMVADTN------LSVGLRFSVARLEDAPPTIG-----FEVQIHSSNKD-----NSRSVPVNLTLS-IVARAEVEIRGV----SHPAQVVLPFPRWEPKEKPVREDEVGPQVQHIYELHNKGPSSISRTVLEVGWPSRYRE-EHLLYALQVITDGPVHCSTNSSLNPLELE 879          
BLAST of Alpha-int-1 vs. Ensembl Zebrafish
Match: itgav (integrin, alpha V [Source:ZFIN;Acc:ZDB-GENE-060616-382])

HSP 1 Score: 110.923 bits (276), Expect = 5.147e-24
Identity = 220/960 (22.92%), Postives = 385/960 (40.10%), Query Frame = 3
Query:  528 WLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLAC-----SVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKV----------LLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKA-----KVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQ--IKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNP----DCGSDYNCVSDIRV-FISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHV----APENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFF 3290
            W G     TV  S    L C P +   T YG ++ E     +G C +  G+ I  + +  C     S   +G C     +  SAD  +K +V +G PGSF  +G +   +     +I++            L T P+  +     LGY + +              N    +  VT  P  +  +  G V + + +     +  + + +G  + + FG+S+A  D N D  +D+ VGAP + D  +  K L ++G +Y++ G+    F   +        G  +  ++G S+ ++GD++ D  +D A+  P  G    G VYI+ G S  P  V      + VL     S       +    +FG+S+ G  D+D N  PDLI+G + + + ++ R++       PV  + T+  I     N  DK C   S    +S        K +G+   +S  ++F+V + LD        KR+  + +K S  +K         N TV    GL     +   I  + ++  I  IS+  + +    +   +     +L         S+P ++ +      DCG D  C  D+++  +SD      + +IY  +   +  + +   N GE AY   L +T+P   +F       + L  L+C  +  +D    V +C   NP       +  L  +++      S ++ + K G     ++++ T  NQ F+ ++N  S+   L +   V +    APE    +++   N+  K +P   V  + +GP  Q  + + N GPS   K  L +  P++ +NG ++LY  K                     S+ G    NC    + ++PLN+ +  R L QN  +    E          + V    +  K      EI+ C       G+ EC  I C +  L       + I +R    TF 
Sbjct:  119 WFGA----TVRSSGDQILACAPLYQWST-YGFSEREP----VGTCYLKKGNNI--VEYSPCRSKSNSPEGQGFC----QAGFSADFVKKNRVVIGGPGSFYWQGQLISDDV--TEVINRYNKEFLTPYSNQLSTKPAGAQYDDSYLGYSVAVGDF-----------NEDGEDDYVTGVP--RGEKALGYVNIFNGR----NMESMYNFTGTQMAAYFGHSVAAVDVNNDGKMDLFVGAPLFMDRGSDGK-LREVGQVYVYLGKGGFTFNSVIK-----LTGSEIYARYGSSVCSVGDLNMDGYNDVAIAAPYGGPFHRGLVYIHNGRSTGPNPVA-----SQVLEGTWAS-------VSMPSSFGYSMNGGTDVDQNGYPDLIVGAFGADKAILYRAR-------PVISVNTTLDISPQILNPEDKSCTLPSTATKVSCFTVKYCLKASGKGAPSS--LLFQVDLTLDRLKHKGAIKRVLFLYNKMSHYSK---------NMTVNNNQGLACEELQAYLIDDSEFRDKITPISVFMEYSLDFKSAADKTGLLPILDQ-------SAPTNVTKQAHILLDCGEDNICKPDLKLSVVSD------QNEIYIGDDNPL-TLEVTAENGGEGAYEADLIVTLPSQADFTAVVRNSETLSRLSCAFK--KDNQTRVVVCDLGNPMKGGTKIVAGLRFSVHQ----LSEQDTEVKFG-----LQIQST--NQ-FNNTSNLVSVVTKLAVLAKVELRGVSAPEQ---VFLPIANWQPKENP---VLEDDIGPLVQHIYELRNKGPSTFSKAILDVQWPYRFNNG-SLLYITK--------------------FSVDGNM--NCSSNRE-LNPLNVTS-PRFLDQNDTSASGAEG------RNRHNVHRRDLEEKHGEENLEILDC-------GNAECQEIKCFVGRLEKGQSAILFIYSRLAVNTFL 936          
BLAST of Alpha-int-1 vs. Ensembl Zebrafish
Match: itga2b (integrin, alpha 2b [Source:ZFIN;Acc:ZDB-GENE-051031-1])

HSP 1 Score: 110.153 bits (274), Expect = 7.832e-24
Identity = 184/777 (23.68%), Postives = 323/777 (41.57%), Query Frame = 3
Query:  315 NSYFGYSISSF-IGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVN--NDCSKVPMGSEGSGHVSPGYF--------NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLAC-----------SVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPM-----SMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVV---VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSK-VPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKA-----KVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEI---FSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGL-------KGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTL 2504
            +SYFG+S+  +    K    +VGAPR   +    +   + G V+   +      C  +    +G  +++ G           WLG SV T     N   L C P F    +  V++ E     +G C +    T    ++  C              D   C     +  + D ++  +V LG PG +  +G I  A+   +     S   K  +       + R Y   YD+ L        G S     F+N+ +   V   P+       G V +++      QI+    +SG  + S FG+S+AV D N D   DI++GAP + +   S+++  ++G +Y++  +    F    S  N +  G    G+FG +IA LGD+D D  +D AVG P  G+   G V+IYLG S  +  Q ++      V+ +P  S +D          FG+S+ G  DID N  PDLIIG + +S++V  R++ ++  +  +   P          N  DK C       Y++        +V+G +I   ++I+F   + LD +++    +R  L+ S       Y N+  S   ++ ++   F+  + P F+  KL+   P+ ++++ S   + ++           +LH   G         +  N  CG D  C+ D+++       ++  T+           ++I   N GE AY  +L I+ P    +QG+         L C  +  ++  +V+ +C   NP    +     LY ++
Sbjct:   39 DSYFGFSVDFYQSSSKSVSVVVGAPRANTNQSGVS---HGGSVFMCPWATRGQSCQTLNFDQKGDENITFGNMLLMAHKSNQWLGASVRTY----NNYILACAPLF--HWNVLVDQEEAMNTPVGNCQLLNMKTGELANYAPCREEYVDAIYTRGYPDRRYC----EAGFTTDITKNGRVVLGAPGGYYFQGQIITASLVNIMSSGSSFTPKHSMNGETKTPQRRDY---YDLYL--------GYSVAAGKFNNDNIPDYVVGVPN--DLHTAGSVKIINGATVPLQIMKA--ISGTQIASYFGHSVAVTDINRDGWDDILIGAPLFMEQL-STQKFREVGQVYVYLQRNDFSF---ASRPNQILAGTYAYGRFGSAIAPLGDLDHDGFNDVAVGAP--GSVDGGKVFIYLGKSGGLSTQYVQ------VIESPFRSLIDPPM-------FGFSIRGGTDIDDNGYPDLIIGAWGASKVVTYRAQAVVRTQARLSFFP-------DLLNPEDKFCQLQQSGTYITCFTIMACIRVSGHRI--PQQIVFNTELQLD-RMKQSMARRTLLLDSNQ----PYTNFQISVDRNSRDVCRNFTAYLLPEFKD-KLS---PIFISVNYSLADSQNA-----------VLH---GQSVAVGQTRIILN--CGPDNVCIPDLQL------KAVASTEPILIGDENPALLIIEAENQGEGAYETELYISPPANTHYQGVLSNHEDFSALVCGQK--KENGSVIVVCDLGNPMEAGQQLKAGLYFSM 726          
BLAST of Alpha-int-1 vs. Ensembl Zebrafish
Match: itga3a (integrin, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090805-3])

HSP 1 Score: 101.293 bits (251), Expect = 4.482e-21
Identity = 146/513 (28.46%), Postives = 225/513 (43.86%), Query Frame = 3
Query:  318 SYFGYSIS---SFIGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYR--ISFVNNDCSKVPMGSEGSGHVSPGYFN------WLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQC-----------SIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVL---VLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGG----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEIM-RSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCF 1766
            S FG S++     + +K    LVGAP+++   ES      TG VY   IS  + DC+++ + S       P   N      WLG S+  + +   G  + C  R++   +            IG+C           S Y   +  +I     +   EG CL G S++V+       ++  G PG F  +GNIF     P       LLK+   D +     +GY   + +     KG+         + VVT +P    +E +G V+   VL +       + +      +GS FGNS+AV D N D   D+IVGAPFY D     +++   GA+Y++  Q +  F+    N++DV         FGMS+  +GD++ D   DFAVG P     +TG V I+ G     S+ P QVI                 D K+I    FQ FG+S++   D+D N  PD+ +G     ++V+LRS+ +I L+N   + P   ++E        K CF
Sbjct:   43 SLFGLSVALHEQVVNEKRHMLLVGAPKEKA--ESGLSANETGDVYACPISADSKDCARLNLISSNPED-KPDLKNYVIDGMWLGVSI-VSQSQPGGRVVACGHRYIRNFTSNFRM-------IGRCYVRGNDLQLNLSDYQWQSYDEICDPREAQNSEGMCLLGMSAAVTFS-----EIFFGAPGCFNWQGNIFSKWHNPADEFH--LLKSKLPDSRKGNIYIGYSTIVDQDVL-VKGK---------DTVVTGAPR---DEAKGSVMMAEVLKSGGSGEVKIKVTVTGEQVGSYFGNSVAVVDLNNDGWKDLIVGAPFYFD-----RKMDKGGAVYVYMNQ-NGSFR----NKSDVVLTGPKDSGFGMSVVAIGDVNQDGFQDFAVGAP---YHSTGRVSIWTGSKTGISQEPSQVI-----------------DGKDIPGGGFQTFGYSISRGLDVDRNGYPDIAVGSL-DDRVVLLRSRPVIHLKNTFTVTPMVINLEDCVACIEAKVCF 493          
BLAST of Alpha-int-1 vs. Ensembl Xenopus
Match: pycr1 (pyrroline-5-carboxylate reductase family, member 1 [Source:Xenbase;Acc:XB-GENE-1016046])

HSP 1 Score: 169.088 bits (427), Expect = 8.192e-42
Identity = 277/1146 (24.17%), Postives = 478/1146 (41.71%), Query Frame = 3
Query:  315 NSYFGYSISSFI-GQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNN---DCSKVPMGSEGS------GHVSPGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD---EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPM-------SMIDKVLLKTSPSDLKNRGYN---LGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTD-HWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSF-QNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHP-FKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRL-AGFVHVAPENLEG------IYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMIST------------LPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIEDSN 3584
            +SYFGYS+  ++    +   L+GAP+           V  G VY   F +     C ++P     +      G   P  F    W G     TV       + C P +  ++   +  SE+  +G    +I   S   + S     + D   +G C     +  S D  +   +ALG PGSF  +G +F A+   +       S+I K+  +   + +    Y+   LGY + +                 S + VV   P    N   G V ++++    + + +I + +G  + S FG ++AV D N D + DI+VGAP + D  + S+ R  ++G +Y++  + + +F+        V KG  V G+FG +IA+LGD++ D  +D AVG P  G D  G V+IY G S             + L T     ++     +S    FG++L G  DID N  PDLI+G + + + VV R++ +I ++  + L P   + E      P+   F  +C + + +   V+G+ I ++  I+ +  ++LD   +    KR   + S  +  +  L  +   L+  ++    L E    + KL    P+ VN++ S   ++   +          L P    YK  +         DCG D  C+ D++     LS+   K  +   E+  I   +I   N GE AY  +L++ IP   ++       +GL+ LNC  ++  ++  VV  C   NP V   N        L+ G   R    R   + +    + ++ +  N+D   SN       F+ L      VA   + G      I +   N+  K  P +    + +GP  Q  + + N+GPS + +  L +  P + S  E +LY     ++      P+      Q  S   T +     PED+ +   L A  RN   ++   R    +   +     P K              +++C N       V+C+ I C + +L       V+I++R WA TF   K      Y S+         + NVS ++K  P +I    +      ++I T            +P+W I+L  LLG+++L ++ L++WKCGFF R R  + ++ +D+ 
Sbjct:   72 DSYFGYSVDFYLPDSAKTSILIGAPKANTSQPQI---VEGGAVYYCPFPDTLPTGCKQIPFDITNNRNIRLNGTKQPVEFKSNQWFGA----TVRAHKEKVVACAPLYHWRSIKPI--SEKDPVGTCYIAIQNFSAYAEYSPCRSDLADPAGQGVC----QAGFSLDFYKNGDLALGGPGSFYWQGQVFTASIADIIKDYSFKSIIRKISGEKQ-TKMAQSAYDDSYLGYSVAVGEF-----------TDDSVQEVVAGVPRGAQN--FGYVSIINS----TDMTFIQNFTGDQMASYFGYTVAVSDVNNDGLDDILVGAPLFMDREFESNPR--EVGKVYLYMQESALEFR-----DPQVLKGTEVFGRFGSAIAHLGDLNQDGYNDIAVGSPFAGEDRKGRVFIYNGNS-------------NGLNTDTSQILEGAWASQSMPAGFGFTLRGDSDIDKNDYPDLIVGAFGAGKAVVYRARPVITVDAQLLLHPMILNPENKTCQLPNSE-FLVTC-FTVRVCVTVSGQSIPSN--IVVKADLELDWLKQKGAVKRTLFMESHQAHHSFDLIINKQRLSQCLDFLVYLREESEFRDKLT---PISVNLNYSLDESAYLGDQE--------LKPILNRYKKATIQEQAHILVDCGEDNMCIPDLK-----LSARPDKNQLVIGEENHIL-FIINTKNQGEGAYEAELRMIIPPEADYVGIERNMEGLRQLNCEYKMENESRLVV--CDLGNPMVAGTN--------LSVG--LRFVVQRLETVDAITFDLYIKSS--NKDNPNSN-------FVSLQVNITAVAQVEIRGVSHPPQIILPIPNWEPKEKPSEE---KDVGPLVQHIYELHNIGPSAISETQLNVGWPSQ-SRDEFLLYVFHIQTE-----GPLKC----QAGSAINTLNIKPSEPEDTPE---LAAFLRNTSVSHAVSRRDVAVAEALRHIPTPTK--------------LLNCTN-------VKCLMISCKVGHLGGGQRAVVKIRSRLWAPTFLQRKND----YYSL---------IANVSFEVKKMPYDIQPAKLPAAT--ILIKTSVIWATPNISFAIPLWVILLAILLGILVLAILTLVMWKCGFFDRARPPQDDVADDTQ 1072          
BLAST of Alpha-int-1 vs. Ensembl Xenopus
Match: pycr1 (pyrroline-5-carboxylate reductase family, member 1 [Source:Xenbase;Acc:XB-GENE-1016046])

HSP 1 Score: 137.502 bits (345), Expect = 3.710e-32
Identity = 203/828 (24.52%), Postives = 356/828 (43.00%), Query Frame = 3
Query: 1167 KILDIIVGAPFYTD-HWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSF-QNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHP-FKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMIST------------LPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIEDSN 3584
            ++ DI+VGAP + D  + S+ R  ++G +Y++  + + +F+        V KG  V G+FG +IA+LGD++ D  +D AVG P  G D  G V+IY G S             + L T     ++     +S    FG++L G  DID N  PDLI+G + + + VV R++ +I ++  + L P   + E      P+   F  +C + + +   V+G+ I ++  I+ +  ++LD   +    KR   + S  +  +  L  +   L+  ++    L E    + KL    P+ VN++ S   ++   +          L P    YK  +         DCG D  C+ D++     LS+   K  +   E+  I   +I   N GE AY  +L++ IP   ++       +GL+ LNC  ++  ++  VV  C   NP V   N    L +          Y + K+   S+ ++++V  T   Q              + + G  H  P+    I +   N+  K  P +    + +GP  Q  + + N+GPS + +  L +  P + S  E +LY     ++      P+      Q  S   T +     PED+ +   L A  RN   ++   R    +   +     P K              +++C N       V+C+ I C + +L       V+I++R WA TF   K      Y S+         + NVS ++K  P +I    +      ++I T            +P+W I+L  LLG+++L ++ L++WKCGFF R R  + ++ +D+ 
Sbjct:  280 RLDDILVGAPLFMDREFESNPR--EVGKVYLYMQESALEFR-----DPQVLKGTEVFGRFGSAIAHLGDLNQDGYNDIAVGSPFAGEDRKGRVFIYNGNS-------------NGLNTDTSQILEGAWASQSMPAGFGFTLRGDSDIDKNDYPDLIVGAFGAGKAVVYRARPVITVDAQLLLHPMILNPENKTCQLPNSE-FLVTC-FTVRVCVTVSGQSIPSN--IVVKADLELDWLKQKGAVKRTLFMESHQAHHSFDLIINKQRLSQCLDFLVYLREESEFRDKLT---PISVNLNYSLDESAYLGDQE--------LKPILNRYKKATIQEQAHILVDCGEDNMCIPDLK-----LSARPDKNQLVIGEENHIL-FIINTKNQGEGAYEAELRMIIPPEADYVGIERNMEGLRQLNCEYKMENESRLVV--CDLGNPMVAGTNVSFVLCILF--------YSSNKDNPNSNFVSLQVNITAVAQ--------------VEIRGVSH-PPQ----IILPIPNWEPKEKPSEE---KDVGPLVQHIYELHNIGPSAISETQLNVGWPSQ-SRDEFLLYVFHIQTE-----GPLKC----QAGSAINTLNIKPSEPEDTPE---LAAFLRNTSVSHAVSRRDVAVAEALRHIPTPTK--------------LLNCTN-------VKCLMISCKVGHLGGGQRAVVKIRSRLWAPTFLQRKND----YYSL---------IANVSFEVKKMPYDIQPAKLPAAT--ILIKTSVIWATPNISFAIPLWVILLAILLGILVLAILTLVMWKCGFFDRARPPQDDVADDTQ 985          
BLAST of Alpha-int-1 vs. Ensembl Xenopus
Match: pycr1 (pyrroline-5-carboxylate reductase family, member 1 [Source:Xenbase;Acc:XB-GENE-1016046])

HSP 1 Score: 129.798 bits (325), Expect = 1.127e-29
Identity = 205/835 (24.55%), Postives = 355/835 (42.51%), Query Frame = 3
Query: 1167 KILDIIVGAPFYTD-HWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSF-QNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHP-FKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRL-AGFVHVAPENLEG------IYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMIST------------LPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIEDSN 3584
            ++ DI+VGAP + D  + S+ R  ++G +Y++  + + +F+        V KG  V G+FG +IA+LGD++ D  +D AVG P  G D  G V+IY G S             + L T     ++     +S    FG++L G  DID N  PDLI+G + + + VV R++ +I ++  + L P   + E      P+   F  +C + + +   V+G+ I ++        ++LD   +    KR   + S  +  +  L  +   L+  ++    L E    + KL    P+ VN++ S   ++   +          L P    YK  +         DCG D  C+ D++     LS+   K  +   E+  I   +I   N GE AY  +L++ IP   ++       +GL+ LNC  ++  ++  VV  C   NP V   N        L+ G   R    R   + +    + ++ +  N+D   SN       F+ L      VA   + G      I +   N+  K  P +    + +GP  Q  + + N+GPS + +  L +  P + S  E +LY     ++      P+      Q  S   T +     PED+ +   L A  RN   ++   R    +   +     P K              +++C N       V+C+ I C + +L       V+I++R WA TF   K      Y S+         + NVS ++K  P +I    +      ++I T            +P+W I+L  LLG+++L ++ L++WKCGFF R R  + ++ +D+ 
Sbjct:  306 RLDDILVGAPLFMDREFESNPR--EVGKVYLYMQESALEFR-----DPQVLKGTEVFGRFGSAIAHLGDLNQDGYNDIAVGSPFAGEDRKGRVFIYNGNS-------------NGLNTDTSQILEGAWASQSMPAGFGFTLRGDSDIDKNDYPDLIVGAFGAGKAVVYRARPVITVDAQLLLHPMILNPENKTCQLPNSE-FLVTC-FTVRVCVTVSGQSIPSN-----IADLELDWLKQKGAVKRTLFMESHQAHHSFDLIINKQRLSQCLDFLVYLREESEFRDKLT---PISVNLNYSLDESAYLGDQE--------LKPILNRYKKATIQEQAHILVDCGEDNMCIPDLK-----LSARPDKNQLVIGEENHIL-FIINTKNQGEGAYEAELRMIIPPEADYVGIERNMEGLRQLNCEYKMENESRLVV--CDLGNPMVAGTN--------LSVG--LRFVVQRLETVDAITFDLYIKSS--NKDNPNSN-------FVSLQVNITAVAQVEIRGVSHPPQIILPIPNWEPKEKPSEE---KDVGPLVQHIYELHNIGPSAISETQLNVGWPSQ-SRDEFLLYVFHIQTE-----GPLKC----QAGSAINTLNIKPSEPEDTPE---LAAFLRNTSVSHAVSRRDVAVAEALRHIPTPTK--------------LLNCTN-------VKCLMISCKVGHLGGGQRAVVKIRSRLWAPTFLQRKND----YYSL---------IANVSFEVKKMPYDIQPAKLPAAT--ILIKTSVIWATPNISFAIPLWVILLAILLGILVLAILTLVMWKCGFFDRARPPQDDVADDTQ 1023          
BLAST of Alpha-int-1 vs. Ensembl Xenopus
Match: pycr1 (pyrroline-5-carboxylate reductase family, member 1 [Source:Xenbase;Acc:XB-GENE-1016046])

HSP 1 Score: 129.413 bits (324), Expect = 1.384e-29
Identity = 205/835 (24.55%), Postives = 355/835 (42.51%), Query Frame = 3
Query: 1167 KILDIIVGAPFYTD-HWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSF-QNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHP-FKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRL-AGFVHVAPENLEG------IYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMIST------------LPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIEDSN 3584
            ++ DI+VGAP + D  + S+ R  ++G +Y++  + + +F+        V KG  V G+FG +IA+LGD++ D  +D AVG P  G D  G V+IY G S             + L T     ++     +S    FG++L G  DID N  PDLI+G + + + VV R++ +I ++  + L P   + E      P+   F  +C + + +   V+G+ I ++        ++LD   +    KR   + S  +  +  L  +   L+  ++    L E    + KL    P+ VN++ S   ++   +          L P    YK  +         DCG D  C+ D++     LS+   K  +   E+  I   +I   N GE AY  +L++ IP   ++       +GL+ LNC  ++  ++  VV  C   NP V   N        L+ G   R    R   + +    + ++ +  N+D   SN       F+ L      VA   + G      I +   N+  K  P +    + +GP  Q  + + N+GPS + +  L +  P + S  E +LY     ++      P+      Q  S   T +     PED+ +   L A  RN   ++   R    +   +     P K              +++C N       V+C+ I C + +L       V+I++R WA TF   K      Y S+         + NVS ++K  P +I    +      ++I T            +P+W I+L  LLG+++L ++ L++WKCGFF R R  + ++ +D+ 
Sbjct:  306 RLDDILVGAPLFMDREFESNPR--EVGKVYLYMQESALEFR-----DPQVLKGTEVFGRFGSAIAHLGDLNQDGYNDIAVGSPFAGEDRKGRVFIYNGNS-------------NGLNTDTSQILEGAWASQSMPAGFGFTLRGDSDIDKNDYPDLIVGAFGAGKAVVYRARPVITVDAQLLLHPMILNPENKTCQLPNSE-FLVTC-FTVRVCVTVSGQSIPSN-----IADLELDWLKQKGAVKRTLFMESHQAHHSFDLIINKQRLSQCLDFLVYLREESEFRDKLT---PISVNLNYSLDESAYLGDQE--------LKPILNRYKKATIQEQAHILVDCGEDNMCIPDLK-----LSARPDKNQLVIGEENHIL-FIINTKNQGEGAYEAELRMIIPPEADYVGIERNMEGLRQLNCEYKMENESRLVV--CDLGNPMVAGTN--------LSVG--LRFVVQRLETVDAITFDLYIKSS--NKDNPNSN-------FVSLQVNITAVAQVEIRGVSHPPQIILPIPNWEPKEKPSEE---KDVGPLVQHIYELHNIGPSAISETQLNVGWPSQ-SRDEFLLYVFHIQTE-----GPLKC----QAGSAINTLNIKPSEPEDTPE---LAAFLRNTSVSHAVSRRDVAVAEALRHIPTPTK--------------LLNCTN-------VKCLMISCKVGHLGGGQRAVVKIRSRLWAPTFLQRKND----YYSL---------IANVSFEVKKMPYDIQPAKLPAAT--ILIKTSVIWATPNISFAIPLWVILLAILLGILVLAILTLVMWKCGFFDRARPPQDDVADDTQ 1023          
BLAST of Alpha-int-1 vs. Ensembl Xenopus
Match: pycr1 (pyrroline-5-carboxylate reductase family, member 1 [Source:Xenbase;Acc:XB-GENE-1016046])

HSP 1 Score: 128.257 bits (321), Expect = 3.186e-29
Identity = 193/838 (23.03%), Postives = 341/838 (40.69%), Query Frame = 3
Query: 1167 KILDIIVGAPFYTD-HWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSF-QNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHP-FKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRL-AGFVHVAPENLEG------IYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIH---------------PISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIEDSN 3584
            ++ DI+VGAP + D  + S+ R  ++G +Y++  + + +F+        V KG  V G+FG +IA+LGD++ D  +D AVG P  G D  G V+IY G S             + L T     ++     +S    FG++L G  DID N  PDLI+G + + + VV R++ +I ++  + L P   + E      P+   F  +C + + +   V+G+ I ++  I+ +  ++LD   +    KR   + S  +  +  L  +   L+  ++    L E    + KL    P+ VN++ S   ++   +          L P    YK  +         DCG D  C+ D++     LS+   K  +   E+  I   +I   N GE AY  +L++ IP   ++       +GL+ LNC  ++  ++  VV  C   NP V   N        L+ G   R    R   + +    + ++ +  N+D   SN       F+ L      VA   + G      I +   N+  K  P +    + +GP  Q  + + N+GPS + +  L +  P   S  E +LY     ++      P+      Q  S   T +     PED+ +   L A  RN   ++   R    +   +     P K              +++C N       V+C+ I C + +L       V+I++R WA TF   K      Y S+  N+                P + +   +  L+ +  + + N +F  +  +++  +                       W CGFF R R  + ++ +D+ 
Sbjct:  287 RLDDILVGAPLFMDREFESNPR--EVGKVYLYMQESALEFR-----DPQVLKGTEVFGRFGSAIAHLGDLNQDGYNDIAVGSPFAGEDRKGRVFIYNGNS-------------NGLNTDTSQILEGAWASQSMPAGFGFTLRGDSDIDKNDYPDLIVGAFGAGKAVVYRARPVITVDAQLLLHPMILNPENKTCQLPNSE-FLVTC-FTVRVCVTVSGQSIPSN--IVVKADLELDWLKQKGAVKRTLFMESHQAHHSFDLIINKQRLSQCLDFLVYLREESEFRDKLT---PISVNLNYSLDESAYLGDQE--------LKPILNRYKKATIQEQAHILVDCGEDNMCIPDLK-----LSARPDKNQLVIGEENHIL-FIINTKNQGEGAYEAELRMIIPPEADYVGIERNMEGLRQLNCEYKMENESRLVV--CDLGNPMVAGTN--------LSVG--LRFVVQRLETVDAITFDLYIKSS--NKDNPNSN-------FVSLQVNITAVAQVEIRGVSHPPQIILPIPNWEPKEKPSEE---KDVGPLVQHIYELHNIGPSAISETQLNVGWP-SQSRDEFLLYVFHIQTE-----GPLKC----QAGSAINTLNIKPSEPEDTPE---LAAFLRNTSVSHAVSRRDVAVAEALRHIPTPTK--------------LLNCTN-------VKCLMISCKVGHLGGGQRAVVKIRSRLWAPTFLQRKND----YYSLIANVSFEVKKMPYDIQPAKLPAATILKRNALLETFHFDSNFNFVFWLVFPLLMLAM-----------------------WFCGFFDRARPPQDDVADDTQ 998          
BLAST of Alpha-int-1 vs. Ensembl Mouse
Match: Itga2b (integrin alpha 2b [Source:MGI Symbol;Acc:MGI:96601])

HSP 1 Score: 110.153 bits (274), Expect = 9.331e-24
Identity = 127/497 (25.55%), Postives = 223/497 (44.87%), Query Frame = 3
Query: 1005 VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMS---LKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFY-KRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPF 2462
            V+ +P W      G V +LD+       L+       + S FG+S+AV D NGD   D++VGAP Y +   + ++L ++G +Y+F   +  K    +S    +  G  + G+FG +IA LGD++ D  +D AV  P  G    G V I+LG S    + + PR  + VL +P            +   FG+SL G  DID N  PDLI+G Y +S++ V R++ ++        + T + +     N   K C  D  +  +S   ++  V     +  +K+  +  + LD  L+ P   +R+ L++S+ + +T  L+      +  +   +G    R E    +   P+++++++S  P  +     +      +LH   G  +      +    DCG D  CV  +R+  +   S L            + ++ I   N GE AY  +L + +P    +       +G + L CT +  ++  + VALC+  NP 
Sbjct:  284 VSGAPTWSWT--LGAVEILDSYYQPLHRLH----GEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMES-RADRKLAEVGRVYLF---LQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDIAVAAPYGGPSGQGQVLIFLGQS----EGLSPRP-SQVLDSP----------FPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASKVAVYRAQPVV--------MATVQLMVQDSLNPTLKNCVLDQTKTPVSCFNIQMCVGATGHNIPQKLHLKAELQLD--LQKPRQGRRVLLLASQQASLT--LSLDLGGRDKPICHTTGAFL-RDEADFRDKLSPIVLSLNVSLPPEETGGAPAV------VLH---GETHVQEQTRIIL--DCGEDDLCVPQLRLTATAGDSPLLIG------ADNVLELKIEAANDGEGAYEAELAVHLPPGAHYMRALSNIEGFERLVCTQK--KENESRVALCELGNPM 723          
BLAST of Alpha-int-1 vs. Ensembl Mouse
Match: Itga8 (integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442])

HSP 1 Score: 102.834 bits (255), Expect = 1.679e-21
Identity = 143/566 (25.27%), Postives = 240/566 (42.40%), Query Frame = 3
Query:  273 FLVGLSKLYLHSNVN-SYFGYSISSFI-GQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNN---DCSKVPMGSEGS------GHVSPGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQC--SIYTGSTIRDISFLACSVTD---EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIF-------LANFGPMSMIDKVLLKTSPSDLKNRGYN---LGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTD-HWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKP----CFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDL 1865
            F + + KL ++S    SYFGYS+  +I   + A  LVGAP+           V  G VY   + +     C ++P  +  +      G   P  F    W G     TV    G  + C P +  +T     K       +G C  +I   S   + S    S  D   +G C     +  S D  +   + +G PGSF  +G +        +AN+    ++ K L     +D+    Y+   LGY +                   S + +V   P    N   G V ++++    + + +I + +G  + S FG ++ V D N D + DI+VGAP + +  + S+ R  ++G +Y++    +  F+        V  G    G+FG S+A+LGD++ D  +D A+G P  G D  G V IY G          PR L H   +     +   + + S   FG+SL G  DID N  PDL++G +   ++ V R++ ++ ++  + L P   ++E      P+ P    CF       + + A +AG+ IS +  ++  V +D 
Sbjct:   38 FNLDVDKLTVYSGPEGSYFGYSLDFYIPDARTASVLVGAPKANTSQPDI---VEGGAVYYCPWPSERSAQCKQIPFDTTNNRKIRVNGTKEPIEFKSNQWFGA----TVRAHKGKVVACAPLYHWRTL----KPNPAKDPVGTCYVAIQNFSAYAEHSPCRNSNADPEGQGYC----QAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSIADIIANYSFKDILRK-LAAEKQTDVAPASYDDSYLGYSVAAGEF-----------TGDSQQELVAGIPRGAQN--FGYVSIINS----TDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPR--EVGQVYLYLQASALLFQ-----DPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLIYNGN---------PRGL-HSKPSQVLQGIWGSQTIPS--GFGFSLRGDADIDKNDYPDLLVGAFGKGKVAVYRARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFS------VRVCASIAGQSISNTIALLAEVQLDF 545          

HSP 2 Score: 74.7146 bits (182), Expect = 6.674e-13
Identity = 122/491 (24.85%), Postives = 205/491 (41.75%), Query Frame = 3
Query: 2181 DCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFD---KSNNKGSIDY-FLRLA-GFVHVAPENLEG------IYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYF--LKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISY------VFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIE 3575
            DCG D  CV D++     LS+   K  I   ++  +  ++I   N GE AY  +L + IP+  ++       +GL+ L+C  ++   T  VV  C   NP V              TG  F         +G      ++E T  + +FD   +S+NK + D  F R+      +A   + G      I +   N+  +  P +    E +GP  +  + + N+GPS +    L +  PF ++  E +LY   L+ +       NP    Q      IK  A      PED+ +   L+A  RN            TI ++V  +  PV     V   +     I++C N       ++C+ I C +  L       +++++R WA TF   K     + + +   +  + Y      +   S  +K   +  + NV F         ++P+W I+L  LLGL++L ++ L LWKCGFF R R  + E+ +
Sbjct:  639 DCGEDNLCVPDLK-----LSARPDKHQIIIGDENHL-MLIINARNEGEGAYEAELFVIIPEEADYVGIERNNKGLRPLSCEYKMENVTRMVV--CDLGNPMV--------------TGTNF--------SLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFERVQINITAIAQVEIRGVSHPPQIVLPIHNWEPEKKPHKE---EEVGPLVEHIYELHNIGPSTISDSILDVGWPF-SARDEFLLYIFHLQTLGPLQCQTNPEINPQ-----DIKPAAS-----PEDTPE---LSAFLRN-----------ATIPHLVRKRDVPV-----VQLHRQSPARILNCTN-------IDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLKRKNDHYALASLVSFEVKKMPYKEQPAKLPAGSTAVKTSVIWATPNVSF---------SIPLWVIILAILLGLLVLAILTLALWKCGFFDRARPPQDEMTD 1050          
BLAST of Alpha-int-1 vs. Ensembl Mouse
Match: Itga8 (integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442])

HSP 1 Score: 100.523 bits (249), Expect = 3.713e-21
Identity = 143/566 (25.27%), Postives = 240/566 (42.40%), Query Frame = 3
Query:  273 FLVGLSKLYLHSNVN-SYFGYSISSFI-GQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNN---DCSKVPMGSEGS------GHVSPGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQC--SIYTGSTIRDISFLACSVTD---EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIF-------LANFGPMSMIDKVLLKTSPSDLKNRGYN---LGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTD-HWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKP----CFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDL 1865
            F + + KL ++S    SYFGYS+  +I   + A  LVGAP+           V  G VY   + +     C ++P  +  +      G   P  F    W G     TV    G  + C P +  +T     K       +G C  +I   S   + S    S  D   +G C     +  S D  +   + +G PGSF  +G +        +AN+    ++ K L     +D+    Y+   LGY +                   S + +V   P    N   G V ++++    + + +I + +G  + S FG ++ V D N D + DI+VGAP + +  + S+ R  ++G +Y++    +  F+        V  G    G+FG S+A+LGD++ D  +D A+G P  G D  G V IY G          PR L H   +     +   + + S   FG+SL G  DID N  PDL++G +   ++ V R++ ++ ++  + L P   ++E      P+ P    CF       + + A +AG+ IS +  ++  V +D 
Sbjct:   38 FNLDVDKLTVYSGPEGSYFGYSLDFYIPDARTASVLVGAPKANTSQPDI---VEGGAVYYCPWPSERSAQCKQIPFDTTNNRKIRVNGTKEPIEFKSNQWFG----ATVRAHKGKVVACAPLYHWRTL----KPNPAKDPVGTCYVAIQNFSAYAEHSPCRNSNADPEGQGYC----QAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSIADIIANYSFKDILRK-LAAEKQTDVAPASYDDSYLGYSVAAGEF-----------TGDSQQELVAGIPRGAQN--FGYVSIINS----TDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPR--EVGQVYLYLQASALLFQ-----DPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLIYNG---------NPRGL-HSKPSQVLQGIWGSQTIPS--GFGFSLRGDADIDKNDYPDLLVGAFGKGKVAVYRARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFS------VRVCASIAGQSISNTIALLAEVQLDF 545          
BLAST of Alpha-int-1 vs. Ensembl Mouse
Match: Itga5 (integrin alpha 5 (fibronectin receptor alpha) [Source:MGI Symbol;Acc:MGI:96604])

HSP 1 Score: 99.7525 bits (247), Expect = 1.390e-20
Identity = 179/728 (24.59%), Postives = 297/728 (40.80%), Query Frame = 3
Query:  318 SYFGYSISSF-IGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNN--DCSKVPMGSEGS-----------GHVSPGY--FNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLAC-----SVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMS--MIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFS---NEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQ---VSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGG----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGD----SCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGE-NAYNVKLKITIPKVLEFQGL 2384
            S FG+S+  +  G+     LVGAP+           +  G VY   +  +   C+ +   S+GS           G     Y    W G     TV       L C P +  +T     + + Q   +G C + T +  R + +  C     S   +G C        SA+ ++  +V LG PGS+  +G I  A    +S     + L+      L+ R  +  YD           G S  +  FS    E  V   P  K N   G V VL+     S I  + ++SG  + S FG ++A  D NGD + D++VGAP   +  T+  R  ++G +YI+  +   +      T++ Q++         +FG S+  LGD+D D  +D A+G P  G    G V+I+ GG    S  P QV++P  L     TP                FG +L G  D+DGN  PDLI+G +   + +V R + +I     + + P       + +N  ++ C  +    SC   +S     +G+ +  S  I F V + LD + +    +R   ++SK + +T+ L           E+   L   R E    +   P+ + ++ S  P +   +  +      +LH ++          +  +  CG D  CV D+++ +        K  +Y  +K  +  +     N GE  AY  +L++T P   E+ GL
Sbjct:   61 SLFGFSVEFYRPGRDGVSVLVGAPKANTSQPGV---LQGGAVYVCPWGTSPIQCTTIQFDSKGSRILESSLYSAKGEEPVEYKSLQWFG----ATVRAHGSSILACAPLYSWRT-----EKDPQNDPVGTCYLSTENFTRILEYAPCRSDFGSAAGQGYC----QGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQISESYYPEYLINPVQGQLQTRQASSVYDDSYL-------GYSVAVGEFSGDDTEDFVAGVP--KGNLTYGYVTVLNG----SDIHSLYNVSGEQMASYFGYAVAATDTNGDGLDDLLVGAPLLMER-TADGRPQEVGRVYIYLQRPAGIDPTPTLTLTGQDEF-------SRFGSSLTPLGDLDQDGYNDVAIGAPFGGEAQQGVVFIFPGGPGGLSTKPSQVLQP--LWAAGRTPDF--------------FGSALRGGRDLDGNGYPDLIVGSFGVDKALVYRGRPIISASASLTIFP-------SMFNPEERSCSLEGNPVSC-INLSFCLNASGKHVPNS--IGFEVELQLDWQKQKGGVRRALFLTSKQATLTQTLLIQNGAREDCREMKIYL---RNESEFRDKLSPIHIALNFSLDPKAPMDSHGLRP----VLH-YQSKSRIEDKAQILLD--CGEDNICVPDLQLDVYG-----EKKHVYLGDKNALN-LTFHAQNLGEGGAYEAELRVTAPLEAEYSGL 709          
BLAST of Alpha-int-1 vs. Ensembl Mouse
Match: Itga3 (integrin alpha 3 [Source:MGI Symbol;Acc:MGI:96602])

HSP 1 Score: 98.2117 bits (243), Expect = 4.425e-20
Identity = 128/471 (27.18%), Postives = 202/471 (42.89%), Query Frame = 3
Query:  309 NVNSYFGYSIS---SFIGQKEAYCLVGAPRD-EIDDESTNVNVNTGGVYRISFV--NNDCSKVPMG--SEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMI-DKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTK----LDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLI 1682
            N  S FGYS++       Q+    L GAPRD  + D+ TN    TG VY        +DC ++ +   S+   H+      WLG +V++   G  G  L C  R+      G+   E Q   +G+C +           L     D+         + + D  +     LG  G F T+  ++    G  +   +  +++    DL    Y    +     + Y  +  +  ++      VVT +P    +++ G V +L  +    L   Q+L        +G+ FG+++A+ D N D   D++VGAP+Y +     K  V  GA+Y+F  Q    F     +Q  +      R  FG+SIA++GDI+ D   D AVG P  G    G VYIY   S              +L  PQ     +K  +     FG+SL+GK D+D N  PDL++G   S  IV+LR++ +I
Sbjct:   47 NPGSLFGYSVALHRQTERQQRYLLLAGAPRDLAVGDDYTN---RTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIEDM--WLGVTVAS--QGPAGRVLVCAHRYTKVLWSGL---EDQRRMVGKCYVRGND-------LQLDPGDDWQTYHNEMCNSNTDYLQTGMCQLGTSGGF-TQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYRGSEEQGNLYIGYTVQVGNAILHPTDIITVVTGAPR---HQHMGAVFLLKQESGGDLQRKQVLK----GTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFER----KEEVG-GAVYVFMNQAGASFP----DQPSLLLHGPSRSAFGISIASIGDINQDGFQDIAVGAPFEG---LGKVYIYHSSS------------GGLLRQPQQIIHGEKLGLPGLATFGYSLSGKMDVDENLYPDLLVGSL-SDHIVLLRARPVI 467          
BLAST of Alpha-int-1 vs. UniProt/SwissProt
Match: sp|P26009|ITA8_CHICK (Integrin alpha-8 OS=Gallus gallus OX=9031 GN=ITGA8 PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 9.280e-36
Identity = 271/1126 (24.07%), Postives = 463/1126 (41.12%), Query Frame = 3
Query:  318 SYFGYSISSFIGQKEAY-CLVGAPRDEIDDESTNVNVNTGGVYRISFVNNDCSKVPMGSEGS------GHVSPGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD---EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPM------SMIDKVLLKTSPSDLKNRGYN---LGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLG---GSKV-PVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSK-----NLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFS-TLNSTVEIFSG--LVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHP-FKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQG-------LKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHV-APENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQD----SSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHR 3551
            SYFGYS+  +I        LVGAPR           V  G VY   +    C ++P  +  +      G   P  F    W G     TV       + C P +  +T    +  E+  +G    +I   S   + S    S  D   +G C     +  S D  +   + +G PGSF  +G +  A+   +        I + L     + +    Y+   +GY +                   S E +V   P    N   G V ++++    S + +I + +G  + S FG ++AV D N D + DI+VGAP + +    SK   ++G +Y++  + +  F+        +  G  V G+FG +I +LGD++ D  +D AVG P  G D  G V IY G   G K  P QV     LN    +         + M S   FG++L G  D+D N  PDLI+G + + + VV R++     N + + NP+ + P +K+ +      P  P F  +C    +++   A    S S++I+ +  + LD+  +    KR        S      ++ FS  +    +++    LV  R E    +   P+ +N++ S   +    +         ++ P    Y+  S     +   DCG D  C+ D+      LS+   K  +   E+  +  ++I   N GE AY  +L I IP   ++ G       L+ L+C  ++  +T  VV  C   NP V   N         +TG  F S ++ +N   S    ++++ +      + ++N  ++   +  A  V V    +   I +   N+  K  P +    E +GP  +  + + N+GPS +    L +  P   S+GE  L ++  I         + +PI+I Q+            N  +P+D+  P     +  +   +Y  +R V   E        P +  S          +I++C N       V+CI I C++  L       ++I++R WAETF   K     + +++   +  + Y       L    + I  +VI+       +  +P+W I+L  +LGL++L ++ L LWKCGFF R R
Sbjct:   40 SYFGYSVDFYIPDPSTVSVLVGAPRANTTQPDI---VEGGAVYHCGWPAARCRQIPFDNTNNRKIKVNGTREPIEFKTNQWFGA----TVKAHKEKVVACAPLYHWRTLK--DSPEKDPVGTCYVAIQNFSAYAEYSPCRNSNADPEGQGFC----QAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIITNYSFKDILRKLAHEKQTGVAPPTYDDNYMGYSVAAGEF-----------TGDSEEELVAGVPRGAQN--FGYVSIINS----SDLTFIQNFTGEQMASYFGYTVAVSDVNNDGLDDILVGAPLFMEREFESKPK-EVGQVYLYLQESAFLFR-----DPQILTGTEVFGRFGSAITHLGDLNQDGYNDIAVGAPFAGEDRRGKVLIYNGYSNGLKTDPSQV-----LNGAWAS---------QSMPS--GFGFTLRGDSDVDKNDYPDLIVGAFGAGKAVVYRARPVVTVNALLILNPMIVNPDNKTCQ-----PPGSPLFV-AC---FTVRVCAAFEGQSISDEIVLKGELQLDSLKQKGAVKRTLFFDYHQS------HHYFSIVMERQKKLYCQDFLVYLRDETEFRDKLSPININLNYSLDESHFKDS--------LLVKPILNYYQRPSVTEQAYILVDCGEDNLCIPDLH-----LSAVPDKDQLIIGEENCV-MLIINPRNDGEGAYEAELHIKIPPEADYTGVERNNKALRVLSCDYKMENETRMVV--CDLGNPMVAGAN--------FSTGIRF-SVQHFENSDFSINFELQIKSS---NKINSTSNLVNLHINITAAAQVQVRGVSHPPQIILPLHNWEPKDEPTKE---EEIGPLVEHIYELHNIGPSAINNTVLHVGWP--VSSGEEFLLYILHIQTHGPLHCQTSSPINIMQI------------NFAIPQDT--PELAAFLYNSTISHYIRRREVAVAE--------PYRRNS---------AKILNCTN-------VKCILISCNVGQLERGKSAALKIRSRLWAETFLQRKNDPYTLSSNVSFKVKNMPYKVQ-PAKLPEGSIAIRTSVIWSTPNVSFV--IPLWVIILAIMLGLLVLAVLTLALWKCGFFDRAR 1024          
BLAST of Alpha-int-1 vs. UniProt/SwissProt
Match: sp|P26008|ITAV_CHICK (Integrin alpha-V OS=Gallus gallus OX=9031 GN=ITGAV PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.669e-31
Identity = 239/1033 (23.14%), Postives = 408/1033 (39.50%), Query Frame = 3
Query:  318 SYFGYSISSFIGQKEA-YCLVGAPRDEIDDESTNVNVNTGGVYRISF-VNNDCSKVPMGSEGSGHVSPG------YFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD-----EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPK------GRSPFINSFSN---EVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQ-NFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLE-----NPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNP----DCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQG-------LKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHV-APENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYR-NKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFF 3290
            SYFG+++  F     + + LVGAP+   +   +NV V  G V + ++  N +C  +   S G+   +P          W G SV +     N   L C P +  +T     +++Q+   +G C ++ GS  + + +  C  T      +G C        S D ++  +V LG PGSF  +G +          + ++L K       ++ Y+  YD +LA             G S  +  FS    E  V+  P  ++    G+V + + K ++S +    + +G  + + FG S+A  D NGD   D+ +GAP + D  +  K L ++G + I   + S  F+    N  ++F       +FG +IA LGD+D D  +D AV  P  G D  G VYIY G         R   LN V        ++ +   R+   +FG+SL G  D+D N  PDLI+G +     V+ R++ +I +      NP  L P +K+            CF    +    LKA   G+       + F+V + LD   +    +R   + SK    +K +  +     +  E+ + L +    + KL    P+ + +       ++             LHP         P ++ R      DCG D  C   + V +      +Y  D           +++   N GE AY  +L + +P   +F G       L  L+C  +    T  VV  C   NP       +  L  +++      +      +I SS L            FD  +        L ++  V +    + + I++   N+  K +P      + +GP  Q  + + N GPS   K+ +T+  P+K  N     Y L  I Q D  G P++ +   ++  +K       ++     D  N     R   +N+R ++R +  IE  V+T                             G G+ +C+ I C + +L       + +K+R W +TF 
Sbjct:   36 SYFGFAVDFFAPDASSMFLLVGAPK--ANTSQSNV-VEGGQVLQCNWNSNRNCQPIIFDSTGNRDFAPDDPLEFKSHQWFGASVRS----KNDKILACAPLYHWRT-----ETKQEREPVGTCYLFDGS--KSVEYAPCRSTTIDADGQGFC----QGGFSIDFTKGDRVLLGGPGSFYWQGQLI------SDRVAEILAK-----YDSKVYSTKYDDQLATRPASAAFDDSYLGYSVAVGDFSGDGIEDFVSGVP--RAARTLGMVSIYNGK-NMSSMY---NFTGEQMAAYFGYSVATTDINGDDYTDLFIGAPLFMDRGSDGK-LQEVGQVSICLQRASGGFQIAKLNGFEIF------ARFGSAIAPLGDLDQDGFNDIAVAAPYGGEDKRGLVYIYNG---------RATGLNAV----PSRILEGQWAARTMPPSFGYSLKGATDVDKNGYPDLIVGAFGVDTAVLYRARPVIRVNAALEVNPTILNPENKACSLADVK---VSCF----KVKFCLKADGKGK---LPNSLNFQVELLLDKLKQKGAIRRALFLHSKQPSHSKNMTITKGGKMNCEELDAFLRDESEFRDKLT---PITIFMEYRLDYKTAVDATG--------LHPILNQFI---PANMSRQAHILLDCGEDNICKPKLEVSVRSDQKKIYIGDD------NPLTLIVTAENQGEGAYEAELFVIVPPQADFIGVVRNNEALARLSCAFKTENQTRMVV--CDLGNPMKAGTKLLAGLRFSVHQQSEMDTSVKFDLQIRSSNL------------FDNLSPVAFYQVDLAISAAVEIRGVSSPDHIFLPIANWQPKENPETE---DDIGPLVQHIYELRNNGPSAFSKVMMTLQWPYKYKN-----YTLLYIVQYDIDG-PMNCTSDMEINPLK------IKISAPKEDEKN-ETFSREDNRNHRISRRDLTAIEGDVQTL----------------------------GCGNADCLKIVCQVGHLERGKSAILYLKSRLWTQTFM 925          
BLAST of Alpha-int-1 vs. UniProt/SwissProt
Match: sp|Q9QUM0|ITA2B_MOUSE (Integrin alpha-IIb OS=Mus musculus OX=10090 GN=Itga2b PE=1 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 6.527e-23
Identity = 127/497 (25.55%), Postives = 223/497 (44.87%), Query Frame = 3
Query: 1005 VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMS---LKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFY-KRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPF 2462
            V+ +P W      G V +LD+       L+       + S FG+S+AV D NGD   D++VGAP Y +   + ++L ++G +Y+F   +  K    +S    +  G  + G+FG +IA LGD++ D  +D AV  P  G    G V I+LG S    + + PR  + VL +P            +   FG+SL G  DID N  PDLI+G Y +S++ V R++ ++        + T + +     N   K C  D  +  +S   ++  V     +  +K+  +  + LD  L+ P   +R+ L++S+ + +T  L+      +  +   +G    R E    +   P+++++++S  P  +     +      +LH   G  +      +    DCG D  CV  +R+  +   S L            + ++ I   N GE AY  +L + +P    +       +G + L CT +  ++  + VALC+  NP 
Sbjct:  284 VSGAPTWSWT--LGAVEILDSYYQPLHRLH----GEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMES-RADRKLAEVGRVYLF---LQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDIAVAAPYGGPSGQGQVLIFLGQS----EGLSPRP-SQVLDSP----------FPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASKVAVYRAQPVV--------MATVQLMVQDSLNPTLKNCVLDQTKTPVSCFNIQMCVGATGHNIPQKLHLKAELQLD--LQKPRQGRRVLLLASQQASLT--LSLDLGGRDKPICHTTGAFL-RDEADFRDKLSPIVLSLNVSLPPEETGGAPAV------VLH---GETHVQEQTRIIL--DCGEDDLCVPQLRLTATAGDSPLLIG------ADNVLELKIEAANDGEGAYEAELAVHLPPGAHYMRALSNIEGFERLVCTQK--KENESRVALCELGNPM 723          
BLAST of Alpha-int-1 vs. UniProt/SwissProt
Match: sp|P06756|ITAV_HUMAN (Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV PE=1 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 9.292e-23
Identity = 175/753 (23.24%), Postives = 314/753 (41.70%), Query Frame = 3
Query:  318 SYFGYSISSFI--GQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNND-CSKVPMGSEGSGHVS---PGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD-----EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPK--GRSPFINSFSNEVV---VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQ-NFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPC------FGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNP----DCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEF-------QGLKGLNCTLRISEDTINVVALCQFPNPF 2462
            SYFG+++  F+       + LVGAP+           V  G V +  + +   C  +   + G+   +   P  F    W G SV +  +      L C P +  +T     + +Q+   +G C +  G+  + + +  C   D     +G C        S D ++  +V LG PGSF  +G +          + +++ K  P ++ +  YN     + A+  +     G S  +  F+ + +   V+  P  ++    G+V + D K ++S +    + +G  + + FG S+A  D NGD   D+ +GAP + D  +  K L ++G + +   + S  F+ T  N  +VF       +FG +IA LGD+D D  +D A+  P  G D  G VYI+ G         R   LN V        ++ +   RS   +FG+S+ G  DID N  PDLI+G +   + ++ R++ +I +   + + P+         N+ +K C         SC + +    K  G+ +    K+ F+V + LD   +    +R   + S+S   +K +  S   L    E+ + L +    + KL    P+ + +       +++    ++     +L+ F       +P ++ R      DCG D  C   + V +      +Y  D           +++   N GE AY  +L ++IP   +F       + L  L+C  +    T  VV  C   NP 
Sbjct:   47 SYFGFAVDFFVPSASSRMFLLVGAPKANTTQPGI---VEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKI----LACAPLYHWRT-----EMKQEREPVGTCFLQDGT--KTVEYAPCRSQDIDADGQGFC----QGGFSIDFTKADRVLLGGPGSFYWQGQLI------SDQVAEIVSKYDP-NVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVP--RAARTLGMVYIYDGK-NMSSLY---NFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGK-LQEVGQVSVSLQRASGDFQTTKLNGFEVF------ARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNG---------RSTGLNAV----PSQILEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSI-------LNQDNKTCSLPGTALKVSC-FNVRFCLKADGKGV-LPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLT---PITIFMEYRLDYRTAADTTGLQP----ILNQF-------TPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDD------NPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVV--CDLGNPM 717          
BLAST of Alpha-int-1 vs. UniProt/SwissProt
Match: sp|Q06274|ITA5_XENLA (Integrin alpha-5 OS=Xenopus laevis OX=8355 GN=itga5 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.091e-22
Identity = 178/757 (23.51%), Postives = 298/757 (39.37%), Query Frame = 3
Query:  318 SYFGYSISSFIGQKEAYC-LVGAPRDEIDDESTNVNVNTGGVYRISFVNN--DCSKVPMGSEGS-----------GHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVT-DEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPM--SMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVV---VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGG----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGD------SCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGL-VEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYK---YFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQG-------LKGLNCTLRISEDTINVVALCQFPNPF 2462
            S+FG+S+  ++   ++   LVGAP+              G V+   +  N  +C+++   S G             H+      W G     TV       L C PR+    S+   K E++   +G C +   +    + +  C     + A         SA+ ++  +V LG PGS+  +G +  A    +  +   +  +      ++ R     YD           G S  +  FS +     V   P  K N   G V +L+   DL  +    + SG  + S FG S++  D N D + D+++GAP + D  T   R+ ++G +Y++      +  +  S  + +  G+   G+FG SIA+LGD+D D  +D A+G P  G    G+V+I+ G        P QV++         + Q S+            FG S  G  D+DGN  PDLI+G +     +V R +       P+     S SI    +N  +K C  +      SC   +S     +G+ +  S  I  +V + LD   +    KR   + ++   +T+ ++     LN   E    + +  R E    +   P+ V ++ S  P + +            L P   YK   Y      +    DCG D  CV D+++ +S    S+Y  D  +        +     N G  AY  +L +T+P   E+ G       L  L C   +   T  V+  C   NP 
Sbjct:   49 SFFGFSVDFYLPDAQSISILVGAPKANTSQPGV---FEGGAVFYCPWQRNGTNCTEISFDSHGDRQRELFDTPQPKHMESKSEQWFG----ATVRAHGKTILACAPRY----SWRTEKEEKRSDPVGTCYLSVNNFTTFVEYSPCRTDFSDAAGQGYCQGGFSAEFTKSGRVLLGGPGSYFWQGQVITATQDEIQEAYYPEYFVLEYKKQMQTRQAASSYDDSYF-------GYSVAVGEFSEDATEDFVVGVP--KGNITYGYVTILNGT-DLRSLY---NFSGEQMASYFGYSVSATDLNSDGLDDLLIGAPLFMDR-THDGRVQEVGRVYVYL-----QGDHMESTPHLILTGMEEYGRFGSSIASLGDLDQDGFNDIAIGAPFGGEAQRGAVFIFNGQPGGVDSKPSQVLQ----GQWGSSQQPSF------------FGLSTRGGHDLDGNGYPDLIVGAFGVDTTLVYRGR-------PIIHASASLSISPNMFNPEEKTCTLEGNASAVSC-INLSFCLNASGKHVPNS--IGIKVELQLDQTKQKGAVKRALFLKTRQPQLTQTIHL----LNGGKEECRAMKIYLREESEFRDKLSPIYVGLNFSLDPLAPADAHG--------LMPIFNYKTKNYIEQKAQI--QLDCGEDNICVPDLKLNVSGDRKSVYLGDENF------LTLFFNAQNLGGGAYEAELYVTLPPEAEYSGIVRNNEHLLILPCAYEMENQTRLVI--CDLGNPM 727          
BLAST of Alpha-int-1 vs. TrEMBL
Match: A0A1P8CUY4 (Alpha-int-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1442.56 bits (3733), Expect = 0.000e+0
Identity = 740/740 (100.00%), Postives = 740/740 (100.00%), Query Frame = 3
Query:  852 MSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVET 3071
            MSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLGDIDGDDIDDFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNISISYQPTSSSSNDNIEISNFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVET
Sbjct:    1 MSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLGDIDGDDIDDFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNISISYQPTSSSSNDNIEISNFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVET 740          
BLAST of Alpha-int-1 vs. TrEMBL
Match: G7YUI6 (Integrin alpha-5 OS=Clonorchis sinensis OX=79923 GN=CLF_111216 PE=3 SV=1)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 412/1284 (32.09%), Postives = 652/1284 (50.78%), Query Frame = 3
Query:  261 DNDIFLVGLSKLYLHSNVNSYFGYSISSFIGQKEAYCLVGAPRDEID----------DESTNVNVNTGGVYRIS--FVNNDCSKVPMGSEGS-----GHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFL-------SKTSYGVNKSEQQ------LLGIGQCSIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXX-EKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLW-----YGPKGRSPFINSFSNEVV----------VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDH----------WTS--------------------------------SKRLVDIGAIYIFYGQVSDKFKYTVSNQND-----------VFKGV-NVRGKFGMSIANLXXXXXXXXXXFAVGCPNC----GNDATGSVYIYLGG-----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEI-MRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGR----KISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSK--------------SSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLS-SSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSY-----------------------------------KNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRIS-QQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNK---------RSVETIEN-----------VVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQY 3557
            D+ +F     + Y H+   SYFGYS++S++GQ +++CLVGAPR   D            +++ +  TG VYRI   F    CS VP+ +        G  +PG  +WLGG+V+   N  NG+QLGCDPR++          S G+  ++ +      LLG GQC++YTG++++  S  AC   +EGACL+GFS+ V    +  +  V LGMPGS+LTEGN+FL ++    +++ + LK+SP DLK++G+NLGY + L  L      Y    R  + N    E V          + SS  W  N+YRG+V++LD  +DL  I Y+ D  GH+GS FG SLA  D +G+ I DIIVG+P++T+           W+                                  + L DIG +Y+F+G  S+    T+ N +            +  G  +V G+FG S+ ++GD+DGD  +D A+ CP C    G    G+V+IYLG         P QVI P  L        C   D  +   R F++FGWSL+   D+D N  PDLI+GD+ S Q+V LR++N IW + P W LP ++++ W+    PD+   G  CR+   L  +V G+    +   +E+    V +D+D  + +  YKRL  +S                 S++   +        + + + S  +EP+  +++  IW+P+++N +I+    +       +  N WMLHPF G ++F S    F NP CG+D  C +D++V + D+S  +L K  +Y++E+   R + +G+GN GENAY  +L++TIP    F   + L+C  ++  D      LC+  +P       +      LNT GAFR                                     ++++  +    +T+  E  C N+D D  +NK +I Y L+LA  + ++   L+   +D+RNF+ ++  +QRV+PETLGP  +  + +SN GPSP+E + + +S+P +TS GE+++Y L R+    +  G P+  +  P+VIS +G   G C  PE +++PL LNA+ R  +Q   N          R V +IE+            +E  S+   + SI+  ++ R QEI+ C       G+  C  I C I  L+    +++ I+   WA+TFF +K+SD  I +     +  +++  +V G+  I PL IS N +F+GI+  +   +P+WPI+LG +LG  LL  IIL +W+CGFF+R R Y
Sbjct:   36 DDLLFPPNAVQRYAHTKPGSYFGYSVASYVGQSQSFCLVGAPRASQDRPGDLLADFGSSTSDPSSATGLVYRIDLDFKLPYCSVVPIATTDEARREHGTPTPGISSWLGGTVAAASNAQNGIQLGCDPRYIYAPEPINQTVSDGIRPTDSRPLHSRNLLGTGQCALYTGASMQYTSVDACIGQEEGACLAGFSADVETGTAFGEAHVVLGMPGSYLTEGNVFLGHYRGRELVNAMRLKSSPQDLKHKGFNLGYAVLLDELVRKSVSYPTPAR--YQNGLDIEPVGQDRRVRLSLLVSSSMWLDNDYRGIVMILDQAMDLGGITYLKDQWGHIGSFFGYSLATADLDGNGIADIIVGSPYFTERKDDKDQDDSDWSVKSAKSNRPRDTLNAPREEEQVDSDPNIVDRLWGRLLPDIGRVYVFHGFPSNLTSNTLVNSDSLRPDYLSRPPVILDGPKSVGGRFGHSVVSMGDVDGDGTEDLAISCPYCSDPEGTREKGAVFIYLGKKDSMLEDEPFQVIWPAELPRAAPITTCGDFDTHDSGHRMFKSFGWSLSAGIDLDANHAPDLIVGDFDSDQVVFLRARNTIWFDAPEWDLPLARTLPWSG---PDETECGTQCRFRGQLSVRVHGKPSLLQRHQTERFKLHVAVDMDASIVNLVYKRLAGISDTGNAGGSGFMSMGMLESVVPVTITRDTLMNTNRMVLLSLTLEPQSARVRPYIWKPILLNATITPAFDAMPHVPGPKQVNSWMLHPFLGERHFVSRPLQFANPACGADNICYADLQVRMMDMSVGALEKLVVYFRERVTQRNLTVGVGNLGENAYAAQLRMTIPHQFSFVIPEELHCQSKVLPDIQATQILCELGDPLGYTGRNLRPFLFQLNTAGAFRELDEPVNDQPTTSPNASESNLEPSLKPQWSPSNDSLKRSKRATVSKDSVTITAEVLCGNEDQDLRDNKATITYKLQLAAKIELSSSALDRTTIDTRNFTVQLYEMQRVHPETLGPEIKHIYLVSNDGPSPIENLWVNVSLPIQTSEGEHLVYILDRVRYHAEDGGPPLIAATAPEVISAEGDVRGMCITPEWALNPLRLNAVHRGRRQQTFNARLEDEDNLIRRVRSIEDDDYKPAHRKQSELENSSSVRATRSIISGVRKRQQEIIKCEQETVNLGTPLCATIRCRIDQLSRGDAVRIVIRGHVWADTFFRHKISDLAIVSEARSEMASVAFGISVHGNRTIEPLAISQNFVFQGIKVPLFRQIPLWPIILGCILGAALLAFIILGMWRCGFFRRRRWY 1314          
BLAST of Alpha-int-1 vs. TrEMBL
Match: A0A4S2LXG9 (Integrin_alpha2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004334 PE=3 SV=1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 412/1281 (32.16%), Postives = 653/1281 (50.98%), Query Frame = 3
Query:  261 DNDIFLVGLSKLYLHSNVNSYFGYSISSFIGQKEAYCLVGAPRDEIDDES----------TNVNVNTGGVYRIS--FVNNDCSKVPMGSEGS-----GHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFL-------SKTSYGVNKSE------QQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXX-EKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDI---KLARLWYGPKGRSPFINSFSNEVV----------VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDH----------WTS-------------------------------SKRLVDIGAIYIFYGQVSDKFKYTVSNQND------------VFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNC----GNDATGSVYIYLGG-----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEI-MRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGR----KISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSK--------------SSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLS-SSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSY-----------------------------------KNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRIS-QQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNK---------RSVETIEN-----------VVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQY 3557
            D+ +F     + Y H+   SYFGYS++S++GQ +++CLVGAPR   D             ++ +  TG VYRI   F    CS VP+ +        G  +PG  +WLGG+V+   N  NG+QLGCDPR++          S G+  ++      Q LLG GQC++YTG++++  S  AC   +EGACL+GFS+ V    +  +  V LGMPGS+LTEGN+FL ++    +++ + LK+SP DLK++G+NLGY +   +L R        +   N    E V          + SS  W  N+YRG+V++LD  +DL  I Y+ D  GH+GS FG SLA  D +G+ I DIIVG+P++T+           W+                                 + L DIG +Y+F+G  S+    T+ N +             V    +V G+FG S+ ++GD+DGD  +D A+ CP C    G    G+V+IYLG         P QVI P  L        C   D  +   R F++FGWSL+   D+DGN  PDLI+GD+ S Q+V LR++N IW ++P W LP ++++ W+    PD+   G  C++ + L  +V G+    +   + +    V +D+D  + +  YKRL  +S+                S++   +     T  + + + S  +EP+  +++  IW+P+++N +I+    + S     +  N WMLHPF G ++F S    F NP CG+D  C +D++V + D+S  +L K  +Y++E+   R + +G+GN GENAY  +L+ITIP    F   + L+C   +  D      LC+  +P       +      LNT GAFR                                     ++++  +    +T+  E  C N+D D  +NK +I Y L+LA  + ++  +L+   +D+RNF+ ++  +QRV+PETLGP  +  + +SN GPSP+E + + +S+P +TS GE+++Y L R+    +  G P+  +  P+VIS +G   G C  P+ +++PL LNA+ R   Q   N          R V +IE+            +E  S+   + SI+  ++ R QEI+ C       G+  C  I C I  L+    +++ I+   WA+TFF +K+SD  I +     +  +++  +V G+  I PL IS N +F+GI+  +   +P+WPI+LG +LG  LL  IIL +W+CGFF+R R Y
Sbjct:   36 DDLLFPPNAVQRYAHTKPGSYFGYSVASYVGQSQSFCLVGAPRASQDRPGDLLADFGSSSSDPSSATGLVYRIDLDFKLPYCSVVPIATTDEARREHGTPTPGISSWLGGTVAAASNAQNGIQLGCDPRYIYAPEPINQTASDGIRPTDSRPLHSQNLLGTGQCALYTGASMQYTSVDACIGQEEGACLAGFSADVETGTAFGEAHVVLGMPGSYLTEGNVFLGHYRGRELVNAMRLKSSPQDLKHKGFNLGYAVLLDELVRKSVSHPTSAQHQNGLDVEPVGQDRRARMSLLVSSSMWLDNDYRGIVMILDQAMDLGGITYLNDQWGHIGSFFGYSLATADLDGNGIADIIVGSPYFTERKDDKDQDDSDWSVKSAKSNRPRDTLNAPREEEVDSDPNIVDRLWGRLLPDIGRVYVFHGFPSNLTSNTLVNSDSLRPDYLSRPPVIVDGPKSVGGRFGHSVVSMGDVDGDGTEDLAISCPYCSDPEGTREKGAVFIYLGKKDSILEDEPFQVIWPAELPRAAPITTCGDFDTHDSGHRIFKSFGWSLSAGIDLDGNHAPDLIVGDFDSDQVVFLRARNTIWFDSPEWDLPLARTLPWSG---PDETECGTQCQFRVQLSVRVHGKPSLLQRHQTAQFKLHVAVDMDASIVNLVYKRLAGISNVENAGGSGFMSMGMLESVVPVTITRDTLTDTNRMVLLSLTLEPQSARVRPYIWKPILLNATITPASNAMSHVPGPKEVNSWMLHPFLGERHFVSRPLQFANPACGADNICYADLQVRMMDMSVGALEKLVVYFRERVTQRNLTVGVGNLGENAYAAQLRITIPHQFSFVIPEELHCQSTVFPDIQATQILCELGDPLGYTGRNLRPFVFQLNTAGAFRELDEPVNDQPATSSNASESNLEPSLKPQWSSSNDRLRRSKRATVSKDSVTITAEVICGNEDQDLRDNKATITYKLQLAAKIELSSSSLDRTTIDTRNFTVQLYEMQRVHPETLGPEIKHIYLVSNDGPSPIENLWVNVSLPIQTSEGEHLVYILDRVRYHAEDGGPPLIAATAPEVISAEGDVRGMCTTPDWALNPLRLNAVHRGRGQQIFNAQPEDEDNLIRRVRSIEDDNYKPPHPKQSELENSSSVRATRSIISGVRKRQQEIIKCEQETVNLGTPLCATIRCRIDQLSRGDAVRIVIRGHVWADTFFRHKISDLAIVSEARSEMASVAFGISVHGNRTIEPLAISQNFVFQGIKVPLFRQIPLWPIILGCILGAALLAFIILGMWRCGFFRRRRWY 1313          
BLAST of Alpha-int-1 vs. TrEMBL
Match: A0A4E0RJF2 (Integrin alpha-5 OS=Fasciola hepatica OX=6192 GN=D915_001333 PE=3 SV=1)

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 419/1289 (32.51%), Postives = 652/1289 (50.58%), Query Frame = 3
Query:  270 IFLVGLSKLYLHSNVNSYFGYSISSFIGQKEAYCLVGAPRDEID--------DESTNVNVNTGGVYRISFVNN--DCSKVPMGSEGS-----GHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFL---------SKTSYGV-----------NKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXX-EKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGP-KGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTD-------------------HWTSSKR------------------------------LVDIGAIYIFYGQVSDKFKYTVSNQND-------VFKGVNVR-GKFGMSIANLXXXXXXXXXXFAVGCPNCGN----DATGSVYIYLGG-----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEI-MRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYI--DLDTKLEHPFYKRL---QLVSSKSSIITKYLNYSFSTLNSTVEIFSGLV--------------EPRFEQIKLNIWQPLIVN--IXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTD-IYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSY-------------------------------KNRKNK------IGS-------SILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQ-DSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQN-YRNKRSVE-TIENVV-------ETKS-------NPVKSA-SIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEII 3572
            IF     K Y H+   SYFGYS+++++GQ +++CLVGAPR ++D          + N   +TG VYR+        CS VP+ +        G  +PG   WLGGSV+   N  NG+QLGCDPR++           +++G            ++S + +LG GQC++YTG++++     AC   +EGACLSGFS+ V A     +  VALGMPGS+LTEGN+FL ++    +++   LK+SP D+K+ G+NLGY +KLA L   P +  +  ++  S   ++TSS  W  N+YRG+V++LD  +DL  I Y+ D  GH+GS FG SL   D NGD I DI+VGAP++TD                   H T + +                              L D+G +Y+FYG+ ++      + + D       +  G  +  G+FG +I +L D+DGD  +D AV CP C +    +  G+V +YLG      +  P Q+I   +L        C     +E   R+FQ+FGWSL+G  D+DGN  PDL++GD+ S Q+V++R++N +W ++P W LP ++++ W+    P +     +C + + L   V GR        +FRV +  DLD  +E    KRL    L     S      N  +  L++ V I    +              +P  +++   +W+P+ +N  I+    P +   +  IE    W+LHPF G +YF S    F NP CG D  C+++++V ++D S    +   IY++E+   R + + +GN GENAY   LK+ IP    +   K L C   I  +      +C   +P     +K+      LNT GAF+                                 K+R ++      +GS         +T+  EG   N D D  NN  SI Y L+LA  + ++   L+   +DSRNF++++  +QRV+PET+GP  +  + +SN GPSP+E + + I++P KT N E+++YFL RI    +  G P +++  P+VIS +G   G C  P+ +++PL LNA+ R+   +  RN RS E T E+++       ET++       NP +S  SI+P ++ R QEI+ C       G   C  I+C I NL+    +++ ++   WA+TFF YK+ D  I +     +   ++   V G+  I PL IS N +F GI+      +P+WPI+LG +LG  LL  II  LW+CGFF+R   Y A+ +
Sbjct:   56 IFPFDAVKRYAHTESGSYFGYSVAAYVGQAQSFCLVGAPRAKLDGFNDLPLSTFNPNTEDSTGLVYRLDLDTRLPYCSLVPIATTDEARKEYGTPTPGISKWLGGSVAAASNSLNGIQLGCDPRYIYAPDLINQTGSSTWGTGHWNGGPTGTSSRSGRTMLGTGQCALYTGASMQYTPVDACLTQEEGACLSGFSADVEAGTEFGEALVALGMPGSYLTEGNVFLGHYRGRELLNAFRLKSSPEDVKHMGFNLGYSVKLAHLIRRPFRDENGRVDGTSGASLLTSSSMWFDNDYRGIVMILDQAMDLGGITYLKDKWGHIGSFFGYSLTTADLNGDGIADIVVGAPYFTDRKETADQSQTDIYVQGASSHNTETPKSELSQKTRSGTDDAAEEKNDKERDTDWGRLLPDVGRVYVFYGRPANVTGMGANRRPDYTGHEPVILNGPRLAGGRFGHAITSLSDVDGDGTEDIAVSCPYCTDPRNREEKGAVLVYLGRKTGRITDDPSQIIWAGDLPKEDPVTTCGDFGLEESGPRTFQSFGWSLSGGTDLDGNRAPDLVVGDFESDQVVIIRARNTLWFDDPQWDLPVARTLPWSG---PGQTLCDTACHFEVRLTVAVHGRAEVLRNPGVFRVRVRSDLDAGMEESAMKRLIGFDLAEPAESSPPNMSNTGY--LDTVVTIRPNKLIDSSNRLTLLTLRLQPVLDRVMHLLWKPIRINASINPVDNPATKVRDSVIEPIPSWVLHPFLGERYFVSRQLRFANPACGPDNVCMAELQVRLTDQSHGPTENQVIYFRERISQRNLTVHVGNLGENAYASWLKLLIPHQFSYIIPKNLACETNIRMEQKATEIVCSLGDPLQYTGSKLIPFVFQLNTAGAFKPLDLPMSDAPQDGVRALNETDNPTWSEKSTARSKSRHSRQTGLDPVGSVANSFVNDTVTIYAEGFSGNDDLDPWNNNASITYKLQLAAKIDLSSSALDRTIIDSRNFTAQLYEMQRVHPETIGPEIKHIYLVSNNGPSPIENLWVNITMPVKTENDEHLVYFLDRIRYHVEDGGPPRTVNVAPEVISAEGHVRGMCLTPDWALNPLRLNAVNRSPAGSPKRNPRSAELTREDLLAESADGSETRTYVDPNRPNPTRSTRSILPGVRKRQQEIIKCGQESPNIGVPICATIYCRIDNLSRGDAVRIVLRGHVWADTFFRYKIPDLAIVSEAHSELAEYAFGIPVHGNRTIQPLAISQNFVFHGIKVPAFREIPLWPIILGCILGAALLAGIIFGLWRCGFFRRKPIYDAQPV 1339          
BLAST of Alpha-int-1 vs. TrEMBL
Match: A0A158R999 (Integrin_alpha2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6897 PE=3 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 410/1294 (31.68%), Postives = 639/1294 (49.38%), Query Frame = 3
Query:  288 SKLYLHSNVNSYFGYSISSFIGQKEAYCLVGAPR----------DEID-----DESTNVNVNTGG-VYRISFVNN--DCSKVPMGSEGS-----GHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTS------------YGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXXE-KIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSK-----------------------------RLV--DIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVR------------------GKFGMSIANLXXXXXXXXXXFAVGCPNCGNDA----TGSVYIYLG--GSKV---PVQVIRPRNL-NHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEK----IIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNS------TVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXX-XXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLY-----KTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLR-----------------------------ISEDTINVVA-LCQFPNPFVNNRNKIHKLYLTLNTGGAFR---------------SYKNRKNKIGSSILT----------MKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSS-GNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQN--------------YRNKRSVETIENVVETKSNPVKSA-----SIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHR----QYKAEIIEDSNGHNGY 3599
            +++Y      S FGYS++S++ Q +A+CLVGAP+          D +D     D  T++  NT G +YR++   +  DCSK+P+          G + PG   W+GG V+ T NG +G+QLGCDPR+L   S              +   E Q LG G C++YTG +++     AC   +EGACLSGFS  +   D   +    LGMPGS+LTEGN+F  ++    ++ ++ LK++P DLK++G+NLGY + L +  +   G     +SFS   ++ SSP W  N+YRGVV++L   L+L  I YI D  GH+GS FG S+A  D NGD+I +IIVG+P+++++   +K                             R +  D+G +Y+FYG+  +        +N+   G   R                  G+FG  + ++GD+DGD  +D AV CP C +       G+VY+YLG   SK+   P QVI P +L    +   + S+ D   + R F  FGWS+A K D+DGN  PDL++GDY S QIV LRS+NL WLE P+W LP   +++W+     + PC    C Y ++L   +  R+   S K    + FR  IDLD++++    KRLQ V    S++   +    S L          ++F  +VEPR+ Q    +W+P+++N++I                   W LHP KG   F S    F NPDCG D  CV D+ V + D S          + IYYKE+   R   + + N GENAY+ K+++ IP    +   K   C +                              +++  I +   +C  PNPF++   +  K+   L T G F+                 +   N  G+ + T          +  E T +N++           Y L+L   + ++  ++     D RNFSS+ +  QRV+PE++GP ++  F +SNLGPSP+E I + +S+P +T +G+ ++Y L  I  Q+++ G+P+ I   P V+S  G   G C  PE +I+PL L A++R                   YR +R  ET        ++PV+ A     + +     + Q+IVSCN      GS  C++I C I  L     +++  +   WA+T F +K SD  I T+    I   ++   V+G+  I  L +S N +F+GI+ ++  T+PI P+++G +LG++LL +II+++W+CGFF+R R       A     +NG NG+
Sbjct:   48 ARIYSTEKRGSNFGYSVASYVAQSQAFCLVGAPKAQNTYYFLGHDPVDIHSQQDSLTSMFGNTTGLIYRLNLDMDYPDCSKMPIADNNEDRRLYGTLEPGISQWIGGLVAATSNGGDGLQLGCDPRYLYTPSPLTASSKASSASASLTGLEVQNLGTGTCALYTGVSMQYTPIDACVSAEEGACLSGFSGVLEPGDEPGEAFTVLGMPGSYLTEGNVFFGHYQGRRVLKQLRLKSTPQDLKHKGFNLGYAVGLYK--HPQWGNQDSTSSFSRFTILASSPMWVENDYRGVVMLLTEALNLDSIQYIKDKWGHIGSFFGYSIAAADLNGDEIPEIIVGSPYFSENQRFTKPQKGPETSPDMQADQATQLDEDDNQENRYRPITPDVGRVYVFYGRPQEGIMGAGYMENEEDLGQRGRGEYMHEPPVILRGPRRSGGRFGHMVLSMGDLDGDGTEDLAVSCPFCQDSHKSVDKGAVYVYLGRKDSKIKDEPDQVIYPADLPTKGVFACESSFDDAPPLKRPFSAFGWSMASKSDVDGNMSPDLVVGDYESEQIVTLRSRNLAWLEQPLWRLPERPTLDWS--GPQNSPCESSRCHYRVALNLSLHAREAFFSSKRGVALRFRYRIDLDSRIKQENAKRLQSVKLGKSVVEDTVEIQLSNLEGYSVGFRRFQLFELIVEPRWRQTAQQLWKPVVINVTIEMFSEDMDFITTEGAKIPHWSLHPLKGEPTFLSQPMYFSNPDCGYDDICVPDLNVEVYDTSEGFEFGGEGPSTIYYKERVSERNFTVAVRNLGENAYDTKVRVHIPAHFAYIPDKNYACKIESELTEMEEEDVEEKRDGGVVMGGSGARMGVNKSKIPITTVVCSLPNPFLSTSPRWEKIRFQLGTSGVFQPPPGGTRSRSLESPNGSQASGNATGAVVTTPIWLPPRRLEIVAEVTSDNENMRDRKVVAKFSYDLKLFADIKLSSSSVGHTVFDRRNFSSQFTERQRVHPESIGPEFEQIFLVSNLGPSPMENIWVNLSVPLQTESGDFLVYLLDLIRTQNANGGSPLQIPVTPDVVSADGQLRGTCYTPESAINPLRLTAVDRKRSGGSSTSAGRNSARSFLYRGRRDTETAFETASESASPVREARSTVGADLLSEHVQQQKIVSCNRPLENLGSPVCLHIPCKIDRLGRGDAVRIVFRGWVWADTLFRHKFSDIAIVTTATAQIPLYAFGIPVTGNFTITGLTVSQNFVFEGIKMIITQTIPILPVIVGVVLGILLLIIIIIIMWRCGFFKRKRLTDEAVAAASGATANGENGH 1337          
BLAST of Alpha-int-1 vs. Ensembl Cavefish
Match: itga3b (integrin alpha-3-like [Source:NCBI gene;Acc:103040573])

HSP 1 Score: 155.606 bits (392), Expect = 6.648e-38
Identity = 268/1129 (23.74%), Postives = 466/1129 (41.28%), Query Frame = 3
Query:  318 SYFGYSISSF--IGQKEAYCLV-GAPRDEIDDESTNVNVN-TGGVYRISFVNN--DCSKVPM-GSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRD-------ISFLACS----VTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPS---DLKNRGYNLGYDIKL-ARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRG-VVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGS----KVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLN----STVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRV---FISDLSSSLYKTDIYYKEKYQIRQVVIGI----------GNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRN-KIHKLYLTLNTGGAFRSYKNR-KNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKI---SPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISI---PFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIE-DMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQR 3545
            S+FG+S++      + E Y L+ GAPR++     +N+ VN TG VY     ++  DC+++ +  S  S  +  G   WLG +V++  +  +G  L C  R++     G+   E+Q   +G+C +       D         +  C+    +  EG C     +   +    K  V +G  GS+L +GN+ +               TSP    D  +R  +LG   K  + + Y     +  ++  +   +VT +P    +E RG V L      DL   + IP     +GS FG+S+AV D N D   D+IVGAPFY D +         GA+Y+F  +       +   +  V KG+   G FG+++A +GDI+ D   DFAVG P  G   +G VYI+ G      K P QVI   ++                    FQ FG+SL+G  D+DGN  PD+++G     +I +LR++ +I L     + P        K  +P + C        M     ++        KI  +  ++ D  L +P   R+Q   +K +  T  L +S ST      S  +     ++P    + +++ +P +                   + N  +       +  +    +    +CG+D  C S+++V   F ++        D     +Y    V + +          G   E+A+   L +TIP  L++ GL+     ++    T NV  +C   NPF +N+    H ++ T     +   Y ++ + ++  S L+       E  D     N  SI   +R     ++AP       V++  FS K+   S ++ +    +G P +  F +S  G  PL ++     +   P +  NG+ +LY  +                    I   GT+   C      ++PLNL   E+N K   RNKR ++   N+ +T++       + P+   +   ++ C+       +  C+   C + N++  +EI V  +AR W  T     + D      +    H    +      +K+    +   V    +  +      P+W  ++  + G++LL +I L+LWKCGFF+R
Sbjct:   39 SFFGFSVAQHKQTQKGEKYLLLTGAPREKA---PSNLKVNETGAVYSCPITSDVADCTRMDIITSTDSSEMIEGM--WLGVTVASQRDQPDGRVLACGHRYVKVVPGGI---EEQRRMVGKCYVRGNDLTYDNRDDWQNHPYEVCNHNFDMEKEGMC-----NMGISGGMTKSDVYIGCTGSYLWQGNVHV-----------TWRDTSPGNSWDYNDR--DLGQQAKRNSYMGYSVTEETKLLDG-TEFTLVTGAPR---DESRGSVTLAAVGNSDLVVKVTIP--GEQVGSYFGSSIAVTDLNNDNWNDLIVGAPFYFDRYKEQG-----GAVYVFMNE-----NGSFGGKKMVLKGMKGSG-FGIAVAAIGDINQDGFQDFAVGAPFHG---SGKVYIWTGSKEGIMKDPSQVIEGNSVGS----------------GGFQTFGYSLSGGMDMDGNKYPDILVGSL-DDRIALLRARPVIQLSRTFTVEP--------KIVDPLQ-CKDACVTVKMCFAYTLSNGNPDFKNKISVKYTVEADRALRNP---RVQFTDTKLNTNTGVLTFSSSTCQELKLSVTDQIKNKLDPVVFLLNVSLVEPDV--------------PAQSSLQNLDVFPVLSSQQRVTEKAEINFQKECGADNKCSSNLQVKKEFANESQVPFSSNDKGQMMEYDNSVVKLTLLLEVSNLPEPGREAEDAHQAMLNLTIPPTLKYSGLRPQGIDIQC---TANVTVICDLGNPFKSNKQINFHFIFQT-----SITLYTDQIQTQLQLSTLS-------EQSDL----NPVSITLNVR----NNIAPSFTIDNSVENTFFSGKVMGESGMKTI--SDVGSPVKFVFKVSVSG-EPLGEMGTLFVVFDWPVEVLNGKWLLYLTE--------------------ILTTGTSEQRCVPDGQIVNPLNLTLSEKNSK---RNKRDLDV--NLPQTEA---ARTLLSPR---KESHLLDCSKQ-----TARCVTFSCPLTNMSTSAEITV--RARVWNTTM----LEDYANTFRVIVKGHATLMLVTDKPAIKMENKTLEFTVNIDPVPGEETPYNAPLWIYIVAGVAGILLLGIITLILWKCGFFKR 1010          
BLAST of Alpha-int-1 vs. Ensembl Cavefish
Match: itga8 (integrin subunit alpha 8 [Source:NCBI gene;Acc:103045927])

HSP 1 Score: 143.28 bits (360), Expect = 4.472e-34
Identity = 238/1073 (22.18%), Postives = 434/1073 (40.45%), Query Frame = 3
Query:  318 SYFGYSISSFIGQKEAYCL---VGAPRDEIDDESTNVNVNTGGVYRISFVNND---CSKVPMGSEGS------GHVSPGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD-----EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPM-------SMIDKVLLKT---SPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSF-------QNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDK----PCFG-DSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYL----NYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQG-------LKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSR------NFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISY 3356
            SYFGYS+  +   ++   L   VGAP+      S    V  G VY   + +++   C ++P     +      G   P  F    W G +V T      G  + C P +  +T     K   ++  +G C I   +      +  C   +     +G C     +  S D ++   + LG PGSF  +G +  A    +       +++ KV  +    + SD  +  Y LGY + +                 S + +V   P    N   G V V+++    + + +I + +G  + S FG ++AV D NGD + D++VGAP Y D    SK   ++G +Y++  + +  F   +        G +V G++G +IA LGDI+ D   D AVG P  G+D  G V+IY              N  H  +      M+  +++R           FG++L G  D+D N  PDLI+G + + ++VV R++ ++ ++  + L P   + E    + P+     PC   D C       AKV+G  I   + +   + + LD   +    KR+  + S     T  L          LN T+ +       R E    +   P+ V ++ S    +      +      + H  K + +  + I L    DCG D  C+ D++     LS+ +  T++   +   +  + I   N GE AY  +L+I  P  +++ G       L+ LNC  R+  D+  VV  C   NP V   N        ++ G  F +   R+ +   + +  +++    N+D  KSN   S++  L +     V   ++ G+ + ++       +  K  P++    + +GP  Q  + + N GPS L    L +  P +    E++LY ++ I+       PI               H N      +++P+ L              +    +   +   S+P +    V   ++   + ++C+N       + C+ + C +  L       V++++R WA+TF   +    ++ +++   +  + Y
Sbjct:   43 SYFGYSVDFYHPTQDRSALAVLVGAPKANTSQPSI---VEGGAVYYCPWPSSEPDSCRQIPFDKANNRMIKMNGTREPLEFKSHQWFGATVRT----HRGKVVACAPLYHWRTV----KMSSEMDPVGTCYIAVQNFSAYAEYSPCRTNNPDPEGQGFC----QAGFSVDFTKDGTLVLGGPGSFYWQGQVITAGVAEILNGYSLKAILRKVQGEKQTGAASDAYDDSY-LGYSVAVGEF-----------TGDSQQELVAGVPRGAQN--FGYVAVINS----TNLTFIQNFTGEQMASYFGYTVAVTDLNGDGLDDVLVGAPLYMDREFESKPR-EVGRVYLYLQEDALLFSPAIK-----LTGTHVFGRYGSAIAPLGDINQDGYLDVAVGAPFAGDDRGGRVFIY--------------NGQHSGLR-----MEASQVLRGAWASSGIPAGFGFTLRGDSDLDNNQYPDLIVGAFGAGKVVVYRARPVVTVDAQLLLTPRILNPEDKTCHLPNSDTMVPCLRVDVC-------AKVSG--IGIPDNVAVNMELQLDWLKQRGAVKRVLFLDSHQHHRTLQLLLGQRDHRRCLNHTIYL-------RDEGEFRDKLSPISVALNYSLDQRAPLQGQQLRPI---LDHYSKSFHHEQANILL----DCGDDNMCIPDLK-----LSAKMDHTELAIGDDNPLL-LTINAANQGEGAYEAELQIRFPLEVDYNGVERRREDLQILNCEHRMENDSQVVV--CDLGNPMVAGSN--------VSVGLRFSA---RRLEEADAHIGFELQVLSSNKDNPKSN---SVNLTLNVVARAEV---DIRGVSLPAQVVLPFPRWEPKEKPVRE---DDIGPQVQHIYELHNKGPSSLSGTVLEVGWPSRHRE-EHLLYAMQIITD-----GPIR-------------CHAN-----GTLNPMELET---------STLQDTPELLGFLRNSSSPTRRRRSVSSTQSYSSKTLNCSN-------IHCLMLKCIVGRLDRGQSAVVKVRSRLWAQTFLQRRNDQYLLNSTVAFQVTGMPY 966          
BLAST of Alpha-int-1 vs. Ensembl Cavefish
Match: itga2b (integrin alpha-IIb [Source:NCBI gene;Acc:103045206])

HSP 1 Score: 123.635 bits (309), Expect = 5.408e-28
Identity = 196/777 (25.23%), Postives = 302/777 (38.87%), Query Frame = 3
Query:  318 SYFGYSISSF-IGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRI---SFVNNDCSKVPMGSEGSGHVSPGYF--------NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIY-------------TGSTIRDISFLACSVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLA----------NFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSP-FINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQND-VFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGD----SCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQ-------GLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTL 2504
            SYFG+S+  F    K    +VGAPRD       NV  + GG   I   +     C ++     G  + + G           WLG     TV       L C P F      G  K E     +G C +               G+ + +    A +  D   C     +  S+D ++   V LG PG F  +G I  A           F P+  +  V    SP         LGY +          G SP ++    N++    S       + G  + L  K  L            + S FG+ +AV D N D   DI+VGAP + +    S++L ++G +Y++      K  Y +S   D    G    G+FG +IA LGD+D D  +D AVG P  G    G V+IY+G S      + P N+  V+ +P        +  +    FG+SL G  DIDGN  PDLI+G + + ++VV R+K ++     +   P          N  +K C  D    SC + + +   V+G KI   E+I+  + I LD KL+    +R  L+         +  +  S    T E+   L      + K  +   LI            S N ++  S+  MLH   G    +  I      DCG D  C+ D+++        L   D    E   +  +++   N GE AY  +L + +P    +Q       G   L C  +  +D  +V+ +C   NP    +     L+ ++
Sbjct:   45 SYFGFSVDFFEANNKNVSVVVGAPRD-------NVGASPGGSVFICPWTSTQGPCQRLAFDQTGDENFTFGDMLLMSHKSDQWLGA----TVRAYKSSILACAPLFHWNVVQG--KDEAMNTPVGNCQLLDTLTGNLANYAPCRGTAVEESYTRARNYQDRRYC----EAGFSSDVTKDGTVVLGAPGGFFFQGQIITAPLQKIMASGKTFSPIHYL--VGEAKSPERYHQYDVYLGYSVATGNF---SAGSSPDYVVGVPNDLNTIGS----VKIFSGSAVTLTAKKSLK--------GSQVASYFGHCVAVTDINSDGKDDILVGAPLFME-LLPSQKLREVGQVYVYL----QKEGYNISPAPDQTLTGTKTYGRFGSTIAPLGDLDHDGFNDVAVGAPGSGEG--GWVFIYMGQS----DGLNPHNM-QVIESP-------FQPPKPAAAFGFSLRGGTDIDGNGYPDLIVGAWGADKVVVYRTKTVVKTRPTLSFFPDF-------LNPDEKLCEADGTLVSC-FRIEMCISVSGYKI--PEEIVLNMEIQLD-KLKPTMARRTLLMEGHQ----PHSQFQLSLNRDTGEVCKNLTAYLVAEFKDKLSLILI------------SLNYSLANSSGAMLHEQSGIVGQTQIIL-----DCGEDNVCIPDLKLAAEADRQPLLIGD----ENPAL--LIVKAENRGEGAYETELHVRLPPRTHYQSVLSNKEGFTRLLCAPK--KDNGSVIVVCDLGNPMKAGQKLQAGLFFSM 728          
BLAST of Alpha-int-1 vs. Ensembl Cavefish
Match: itga6b (integrin alpha-6-like [Source:NCBI gene;Acc:103030335])

HSP 1 Score: 114.39 bits (285), Expect = 3.579e-25
Identity = 224/904 (24.78%), Postives = 368/904 (40.71%), Query Frame = 3
Query:  999 VVVTSSPHWKSNEYRGVVLVLDTKLDLSQIL---YIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDI-GAIYIFY---GQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLG---GSKV-PVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPC---------------FGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIR---VFIS-DLSSSLYK--------TDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQG--LKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSI-DYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPET-LGPPYQATFTISNLGPSPLEKIN---LTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHN--------VIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHR 3551
            VVV  +P      + G V++L  + + S  L   YI +  G L S+FG  LA+ D NGDK  D++VGAP Y +  +      DI GAIY++    G  ++  +  +    D          FG+S+ +LGDI+ D  +D A+G P   +   GSVYIY G   G K+ P QV++ ++LN  L                   FG+SLAG  D+D N  PDL IG  S + I V R++ ++ +E  V + P  K ++  K N  D  C               +    R   S++ +   +K+    ++ F  + + DT      Y+   +V    +   K ++ +    ++  +   G+              P+ VN+          S        F  L P  G    ++    F    CGSD  C S+++   +F S + +S  +K          I   ++ +I   V      G++AY   L  + P  L +     K  +  +    +     A C+  NPF   RN +   Y+ L TGG         N++    + ++++ T +      +     I    L L+G     P  LE        F+ ++     +  E+ +G      F + NLG  PL+      L I  P  T++ + +LY +K                    IS  G     C   ++ ++PL+L  I+ +   + R KR V       ET S+  K +    K K++   ++SC +         C+N  C +    L S   + +KAR W  TF              F +++ +  +   S  L   P N+            +F G +    S LP W I++  LLGL+LL L+I +L+KCGFF+R +
Sbjct:  221 VVVAGAPRVN---HSGAVVLLKKESETSPQLITEYILEGEG-LASSFGYDLALLDVNGDKWQDLVVGAPQYFEKNS------DIGGAIYVYINKNGNWANAVRTRIDGPKDSM--------FGLSVESLGDINLDGFNDVAIGAP-YEDGGMGSVYIYHGSDSGLKLKPAQVLKGKDLNIKL-------------------FGYSLAGNMDLDNNQYPDLAIGSLSDT-IAVFRARPVVNIEKTVTMTP--KELDLNKKNCGDSICLQVRTCYKYTSNSKDYSAPLRIKYSIEVESKRKKLGLPSRVTFSPHSNTDTD-----YESSGIVDLSKANEQKCVDKTIKLQDTIKDKLRGI--------------PIEVNV-----EILYPSARRKRDVAFSQLLPVLGSSQPAANEVNFVKEGCGSDNICNSNLKLQYIFCSREPNSDNFKPLPLVGDVPVISLSDQKEIALEVTVTNQNGDDAYETVLIGSFPGALSYSASRTKTPDKVVICVANQNGSQAECELGNPF--KRNSVVTFYIILGTGGISLDM----NEVA---VNLQLKTTSDQPPLSITKKANVIVQLLLSLSGVAK--PSQLE--------FTGQVKGESAMKTESEVGSQIDYEFRVINLG-KPLKSFGTAFLNIQWPKSTASNKWLLYLMK--------------------ISSTGVERIGCGRTQE-VNPLSL--IQES--SSARLKREVGK-----ETSSDDPKFSLFTDKRKSK---VLSCED------GANCVNFKCPLQG--LDSNAVIALKARLWNSTFL-----------EDFADMNYVDILVKASLSLDSAPKNVVLKNEDAQVRVTVFPGRKAAQYSGLPWWIILVAILLGLLLLALLIFLLYKCGFFKRSK 987          
BLAST of Alpha-int-1 vs. Ensembl Cavefish
Match: itga3a (integrin alpha-3 [Source:NCBI gene;Acc:103032002])

HSP 1 Score: 111.309 bits (277), Expect = 3.043e-24
Identity = 137/498 (27.51%), Postives = 222/498 (44.58%), Query Frame = 3
Query:  309 NVNSYFGYSISSFIGQKEA--YCLVGAPRDEIDDESTNVNVNTGGVYR--ISFVNNDCSKV------PMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSI------------YTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRG-VVLVLDTKL--DLSQILYIPDLSGH-LGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGG----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLP 1712
            N  S FG S++       A    LVGAP++    E T     TG ++   IS    DC +       P+  +G   +  G   WLG SV++   G  G  L C  R++ KT       +  L  IG+C I            Y      ++      +  EG C     +   +    +  V  G PG +  +GN F+    P    D  + K    DL+     +GY +          G+   + + + + VV+ +P    +E +G V+L  + K    +S++     L G  +GS FGNS+A+ D N D   ++IVGAPFY D     +R  + GA+Y+F  +       +  ++ D+F     +  FGM++A +GD++ D   DFAVG P     ++G VYI++G     SK P QVI  +++ +                  FQ FG+S++G  D+D N  PD+++G     ++V+LRS+ +I L+    + P
Sbjct:   53 NPGSLFGLSVALHQQTNPARYLLLVGAPKERA--EPTISANETGDMFTCPISTDPRDCRRSNLITSEPLDPDG---IVEGM--WLGVSVASQPQG--GRVLACGHRYIRKTG-----DKNILPMIGKCFIRGNDLNYEPDKDYQWQYRYEVCDPTTDLLQEGLC-----NMGISAVITQKDVIAGAPGCYNWQGNSFVIYRNPNDKYD--IQKIKFPDLQQGNIYMGYSV----------GKDSGVLNEAEDTVVSGAPR---DESKGSVILAKEIKKPDGVSELRTQVILRGQQVGSYFGNSIAIVDINNDGWKELIVGAPFYFD-----RRKEEGGAVYLFMNE-----NGSFQDKTDLFFTGPKQSGFGMAVAAIGDVNQDGFQDFAVGAP---YHSSGRVYIWMGSKDGLSKKPSQVIEGKDITN----------------GGFQTFGYSISGGLDVDDNKYPDMVVGSL-DDRVVLLRSRPVIHLKKSFTVTP 486          

HSP 2 Score: 53.9138 bits (128), Expect = 1.084e-6
Identity = 75/266 (28.20%), Postives = 119/266 (44.74%), Query Frame = 3
Query: 2757 LGPPYQATFTISNLGPSPLEKI---NLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQR 3545
            +G P +  FT++ L   PL  +    +    P++  N + +LY                   L ++    GT+   CR  E+ ++PLNL   ERN  Q  R +RS E    V      P   A++  +   R +  +SC   +SG G  +C    C + N+T  S   + ++AR W  T  L    DS     +   +  I+    +  D       +   V+  G ++M+    P+W I++  L G+ILL LIIL+LWKCGFF+R
Sbjct:  719 IGSPVEFNFTVT-LNGRPLGSLGFLQVGFEWPYEVENEKWLLY-------------------LAEIQVRSGTSVSFCRPAENIVNPLNLLVSERNSIQ--RRRRSDEGSAVVY-----PEAQAALNSQSMWRRRVQLSC---RSG-GGAKCQTFSCPLLNMT--STTVLMVRARLWNST-MLEDYRDSETRIEVLATLQLITDKPTIRMDNASSTFYV--EVVPAGQKEMLYEA-PLWIIIVSVLAGVILLGLIILLLWKCGFFRR 947          
BLAST of Alpha-int-1 vs. Ensembl Sea Lamprey
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 130.183 bits (326), Expect = 9.016e-31
Identity = 220/971 (22.66%), Postives = 408/971 (42.02%), Query Frame = 3
Query:  783 KVALGMPGSFLTEGNIFLANFGPM-------SMIDKV--LLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSK----VPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDK----PCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNP----DCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQG-------LKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSR------NFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIEDSNGH 3590
            +V LG PGSF  +G +  A    +       SM+  +    +TS +        LGY + +            F      + V      +++  Y G+       LD   +  + + SG  + S FG S+AV D NGDK+ D++VGAP + D  +  K L ++G +Y+F  + +  F+     +   F G  +  +FG ++A LGD+D D  +D AVG P  G +  G VYIY G        P QV+  +        P  S       M S  +FG++L G  D+D N  PDL++G + +S+ +V R++ ++ +E  + L P   ++E     +        CF  +  Y + +  K A   +S++E     + + LD   +    KR    +++ S   + +  +     +  ++   L +    + KL    P+ V+++ +    ++ ++          L P + +    SP  + +      DCGSD  CV  ++     LS+   +  +Y  ++  +  + +   N GE AY  +L + +P   ++ G       L  L C  +    T +VV  C   NP     N +  L  ++           ++ +   S +   +     N+   +SN +  +   L +  F  V   NL G+ +  +      N+    +P++    E +GP  Q  + + N+GPS +    + +S P + S+ + +LY L   ++      P S S++  +         N +L  +S D    N      K+N R+    E      ++KS         P+        ++C+ S       EC++I C +  L       ++IK+R WA+ F   +     I ++    ++ + Y       L      ++ +V +   +      +P+W I++  L GL+LL+L++  +WK GFF+R R  + +  E+   H
Sbjct:  199 RVVLGGPGSFYWQGQLITAPSEAVMKDPTSESMVRSIEGQKQTSSAPPSYDDSYLGYSVTVGE----------FTGDNQQDFVTGVPKGFRTLGYVGI-------LDGENMTSLYNFSGEQMASYFGFSVAVTDVNGDKLEDVLVGAPLFMDRGSDGK-LREVGRVYLFLQERTLSFR-----EPQRFTGEEMYSRFGSALAPLGDVDQDGFNDVAVGIPFGGENRQGLVYIYNGDKDGLKPAPSQVLESQ-------WPGTS-------MPS--SFGYALRGTVDVDKNGYPDLVVGAFGASKAIVYRARPVVTVEAELQLEPQIINLESKDCKQAGSTSSFACF--TVNYCVQVVGKGA---LSSTE---LNLELQLDRLKQKGTIKRALFATTQQSRYEQRITINKGAGPTCNKLTVYLRDETEFRDKLT---PIAVSLNYTLMEEATLASQG--------LRPIRNH---FSPDHIQKQAHILLDCGSDNICVPSLK-----LSALSDRKQLYIGDENSL-VLTVNSRNDGEGAYEAELHVVLPPEADYVGVVRNNESLAKLTCAYKTENLTRSVV--CDLGNPMRGGTNLLVGLRFSV-----------QRLEEAVSPIQFSLHIKSSNEKSPESNTETVV---LPVGVFAQV---NLVGVSIPDQIVLPIINWEPVENPVKE---EDIGPLVQHVYELRNIGPSRVGSAEMDLSWPLR-SDDDYLLYVLALNTEGPIKCVPDSSSKINPL---------NLKL-SNSHDAPGANETGNQHKENPRDIHRRELQRGEADSKS---------PR-------TLNCSTS-------ECLHIRCTVQTLESGHNAVLQIKSRLWAKAFMEKESQQHTIESAAHFFVNDMPYKIRPE-KLPSGAFQVTTSVAWANQDGNQ--PVPVWVIIVAVLAGLLLLSLLVFAMWKMGFFKRVRPPQEDNGEEQQLH 1043          
BLAST of Alpha-int-1 vs. Ensembl Sea Lamprey
Match: itga8 (integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220-48])

HSP 1 Score: 106.301 bits (264), Expect = 1.663e-23
Identity = 135/531 (25.42%), Postives = 234/531 (44.07%), Query Frame = 3
Query:  963 GRSPFINSFSNEVV---VTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGS----KVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLE-----NPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQG----LKGLN----------CTLRISEDTINVVALCQFPNPFVNNRN 2477
            G S  +  F+ + V   VT  P  K +   G VL+L+T  D+S ++ +      L S FG ++AV D N D + D++VGAP Y +   S  RL ++G +Y++  Q                 G +V G++G +I  +GD+D D  +D AVG P  G D TG V++Y G       +P Q +R R  +  L                  +FG++L G  D+D N  PDLI+G +   + +V R++ ++ +      +P+ L P ++S   T Y          SC + +    KV+G++I  +  +   V + LD   E    +R+    SKS      L            + + L +    + KL+   P++V+++ S     +S++  +      +L+ ++          L    DCG D  C+ D++     L+  L +T+++  +   +  + +   N GE AY  +L++ +P   ++ G     +GL           CTL+   +T  VV  C   NP     N
Sbjct:   35 GYSVAVGEFTGDSVQEFVTGVP--KGSSTFGYVLILNTT-DMSTLMNV--TGEQLASYFGYTVAVTDVNNDGLDDLLVGAPLYMERG-SQGRLEELGRVYLYLQQAPLSL-----GAAQTLSGRDVYGRYGSAITPVGDLDQDGYNDVAVGMPFGGEDGTGVVFVYNGRDTGLMAIPSQTLRGRWASQGLPA----------------SFGFALRGGTDLDSNGYPDLIVGAFGVDKAIVYRARPVVTVSAELTVSPMVLHPENRSCMVTGY------ATLQSC-FSVEFCLKVSGKRIPVT--VGMEVEVLLDKLKEKGAIRRVLFRDSKSPRFRTRLQMGRGLQEQCSTLTAYLRDESEFRDKLS---PIVVSLNYSLDGEYNSNHSTVVP----ILNHYQADHIQKQAYILL---DCGEDNICMPDLQ-----LAGYLERTELFMGDTSPL-TLTLNCSNHGEGAYEAELQVAVPPEGDYIGSTRSSEGLGTSDGNVFAPICTLKEENNTRLVV--CDLGNPMKAGTN 511          
BLAST of Alpha-int-1 vs. Ensembl Sea Lamprey
Match: ITGA6 (integrin subunit alpha 6 [Source:HGNC Symbol;Acc:HGNC:6142])

HSP 1 Score: 89.7373 bits (221), Expect = 2.439e-18
Identity = 168/747 (22.49%), Postives = 291/747 (38.96%), Query Frame = 3
Query:  438 VYRISFVNN--DCSKVPMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGA---CLXXXXXXXXXXXXEKIKVA----------LGMPGSFLTEGNIFLAN----FGPMSMIDKVLLKTSPSDLKNR-----GYN--LGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLD----TKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIG-AIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGL----VEPRFEQIKLNI---WQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISL--FRNPDCGSDYNCVSDIRV---FISDLSSSLYKT-------DIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRIS----EDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGG 2516
            VY+  F  N  DC +V   ++           W+G  V+    G  G  L C  R+ ++   G+ +  + +  IG+C + +    +D+        D G+   C     S       ++   A           G PG++  +G   +A     F    + D    +T     KN       YN  LG+ +   +     + R  F         V  +P      + G V+VL     + L   Q +Y  +L+    S+FG  + + D N D  LD++VGAP Y D      R  DIG A+Y++  Q     ++     N     +     FG+++AN+GDI+ D  +D AVG P    D +G V+IY GG               + + P+ S +    I+R+ + FG+S+ G  D+DGN+ PDL+IG   S +I +LR++ +I    P  L+ + K I+    N  +        +   S KAK A           +   I+L    E    +R Q + S+ S + +  N     + S   +  G        +  Q++ NI    +P+ + ++        +            L P    +  S   +   F    CG D  C S++ +   + S   +  YK         ++     +   + + I N G++A+   L + +P  + + G +       +      +    +A C+  NP    R +    YL L+T G
Sbjct:   82 VYQCPFTANTDDCQRVIFDNDADPTTESKQDQWMG--VTVKSQGPGGKVLACAHRYETRRFVGLPEETRGM--IGRCYVLS----QDLRMNEQDEMDGGSWQFCAGRPDSHEQFGVCQQGLDAGFTRDFHYIYFGAPGAYNWKGIAHVAQRNSTFYEQGIFDDGPYETGDERWKNEKLVPVAYNSYLGFSMDSGKSVMA-RNRLSF---------VAGAPRAN---HTGAVVVLKKDSLSSLTPEQTIYGEELA----SSFGYDVTLADLNNDGWLDLVVGAPQYFD------RREDIGGAVYVYMNQRGGFDEHNFIRLNGTKDSM-----FGLAVANIGDINQDGFEDIAVGAPY---DGSGKVFIYHGG--------------RMGINPKASQV----IVRTVEKFGYSITGGMDVDGNTYPDLLIGSL-SDKIALLRARPVI---TPNILVTSDKDIDINVKNCENDKRICIKVKACFSYKAKPAN----------YNPIINLTYTFEAEMDRRKQGLGSRVSFLNRGSNSPEEYVLSGSLVLMGQGREKCTEKTMQLQENIKDKLRPIPLQLTYEINQVVKTKRQASLS-----LQPVLDAQVPSRMKTEINFVKEGCGPDNICQSNLILKYNYCSREENEKYKALKSMSGQQVFSLSDQKDLALEVSISNTGDDAHEAHLIVNLPDAVSYGGFRKKTVPEEVQLVCVANANGSLADCELGNPL--KRGQAVSFYLILSTSG 750          
BLAST of Alpha-int-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001557.1 (pep scaffold:Pmarinus_7.0:GL480593:314407:372761:-1 gene:ENSPMAG00000001371.1 transcript:ENSPMAT00000001557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 1.284e-15
Identity = 127/476 (26.68%), Postives = 198/476 (41.60%), Query Frame = 3
Query:  372 LVGAPRDEIDDESTNVNVNTGGVYRISFVNN---DCSKVPMGSEGSGH--------VSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTI--RDISFLACSVT-------DEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYN--LGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGH-LGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNV-RGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSI 1727
            LVGAP+   D +     V+ G +++     N    C+++ +G  GS H        +      WLG S++   N  +G  L C  R+  K ++ V + +   L  G C I   S         + C          + G+C +G +         +  V LG PGSF   G + L N     +  +     S S+ +  GY+  LGY I              F +  S EVV  +       E      V   ++    +  I   SG  +GS FG++L   D N D + D++VGAP +     S+ R  D G ++++    +         + +   G+N     FG  IA LGDID D   D AVG P    +  G+VYIY G             + H         +  K I      FG S++G+ D+DGN  PD++IG ++S   V+ R++ +I +E  V +LP S +I
Sbjct:    2 LVGAPK--ADSDLLTETVHPGAIFKCRVQPNGEQSCTEMLLGPPGSRHNHQCGRTCLEERDNQWLGVSMARQ-NKPDGKILACAHRW--KNAFYVREWK---LPHGLCYIIPASLAPSESTHIIPCFKEHQKKYGEEHGSCQAGIAGLFL-----EDAVVLGAPGSFYWTGTVILHN-----LTTRANSFYSESERRAVGYSSYLGYSITAGH----------FTHPQSTEVVGGAPQRANVGE------VYLFRIQRGGLHIIRHFSGKKMGSYFGSALCAVDLNSDGLSDLLVGAPTH-----SASR--DEGRVHVYVNHGNGDLV-----EQEPLVGLNAYNAHFGAVIAALGDIDDDGFPDVAVGAPQ--EEEFGAVYIYHGSQN---------GITH----KHSQRIFGKSIESGISMFGQSISGQVDLDGNGYPDVVIGAFTSDVAVLFRTRPVITVEASV-VLPRSVNI 415          
BLAST of Alpha-int-1 vs. Ensembl Sea Lamprey
Match: ITGA6 (integrin subunit alpha 6 [Source:HGNC Symbol;Acc:HGNC:6142])

HSP 1 Score: 77.7962 bits (190), Expect = 1.042e-14
Identity = 76/229 (33.19%), Postives = 116/229 (50.66%), Query Frame = 3
Query: 1002 VVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGH-LGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVI-RPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLI 1682
            VV  +P      + G VL+L      + ++    L G  L S +G ++ + D NGD  +D++VGAP++ D    SK+ V  GA+Y++   ++D        +    +G    G FG++IA +GD+D D   D AVG P    + +G VYIY GG   P  VI +P  + H                 S   FG+SL+G  D+DGN  PDL++G   S Q+V+ RS+ +I
Sbjct:  218 VVAGAPR---AAHMGAVLLLAVNYSHNSLVPEVMLRGEGLASAYGYAVCLADLNGDGWMDLLVGAPYFFDQ---SKKSVG-GAVYVY---LNDNDGGGERKKRVRLEGTAGSG-FGLTIAAIGDVDLDGFQDVAVGAPF---EESGRVYIYSGG---PSGVITKPAQVWHA----------------SQPGFGYSLSGGLDVDGNLYPDLLVGSL-SDQVVLFRSRTVI 412          
BLAST of Alpha-int-1 vs. Ensembl Nematostella
Match: EDO48984 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHH6])

HSP 1 Score: 99.3673 bits (246), Expect = 6.561e-21
Identity = 74/203 (36.45%), Postives = 111/203 (54.68%), Query Frame = 3
Query: 1119 GSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGK-FGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGG----SKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLP 1712
            GS FG S+A  D NGD   D+++GAPFY     S+K   + G ++++    ++    T S   ++   +  +G  FG ++ANLGD+D D  +DFAVG P    + TG VYI+ G     S+   Q+I+P ++N  L T                 FG S+AGK D+DGN  PDL+IG Y+S  +V+LRS+ +I +   V + P
Sbjct:  323 GSGFGFSVAGVDVNGDGWTDVVIGAPFY-----STKNSPNEGRVFVY----TNNGDGTFSKTRELAPSIARKGAYFGHAVANLGDLDQDGYEDFAVGAPY--EEGTGVVYIFNGSETGVSQKAGQLIKPTDINQDLKT-----------------FGSSIAGKLDMDGNGYPDLLIGAYTSDSVVLLRSRPIIDINTDVNITP 497          
BLAST of Alpha-int-1 vs. Ensembl Nematostella
Match: EDO49372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG71])

HSP 1 Score: 69.707 bits (169), Expect = 6.659e-12
Identity = 71/236 (30.08%), Postives = 103/236 (43.64%), Query Frame = 3
Query:  996 EVVVTSSPHWKSNEYRGVVLVLDT----KLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFY--GQVSDKF-KYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLI 1682
            E ++ SSP  ++++ RG V+  D     ++ +S  L +P      GS FG S+   D N D + D++VGAP Y+          D G +Y++   G VS    KY V                                   VG P  G D  G+VYIY G         R R      VT   S M+D     + + FG+SL G  D+D NS PD+ +G YSS + V+LRS+ ++
Sbjct:  269 EQLIGSSP--RADDIRGRVMAFDVVGDEQIKVSFTLPLPP-DNQPGSAFGFSMCAVDLNNDGLSDLLVGAPRYSYDK-------DEGRVYVYVNNGLVSITIPKYVV-----------------------------------VGAPYGGPDRRGAVYIYHGTKDGIDTKYRQR------VT--ASDMNDP----ALKTFGYSLTGGLDMDDNSYPDVAVGAYSSDRAVLLRSRPIV 447          

HSP 2 Score: 51.2174 bits (121), Expect = 2.653e-6
Identity = 80/371 (21.56%), Postives = 138/371 (37.20%), Query Frame = 3
Query: 2193 DYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGEN-AYNVKLKITIPKVLEFQGL---KGLNCTLRISEDTINVVALCQFPNPFVNNRNK-IHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPE-TLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETF 3287
            D  CV D+ V  S   S  +K D+      Q+  V I + N  E+ AY  K+ +T P  L + G+   + + C   I+ D     A+C    PF     K    L+ T    G              S+  + +E T    D + S+NK S+   ++    + ++  +L     D   FSSK    + V  E  +GP  Q T  + N GP  ++   +T+S+P+K S  +          Q                       HG+    +   +PLN+      +  N      +E+   V   K           + + +  + +SC+N       V+C+   C +  L      ++ + +R W +T 
Sbjct:  610 DKVCVPDLSVSGSASFSGGFK-DLRIGISQQM-LVTITVENKAEDFAYPGKVLVTYPSFLGYVGVAAKQDVQCKRLITSDDFEQ-AVCLVGMPFQGKTKKTFDMLFATAGVKGNI------------SMFKVDLEATSPGADANPSDNKVSLQLAVKFEADLSISGASLP----DELVFSSKGKTSEEVRTERDIGPLVQQTIMVRNNGPGAVDGSEVTVSLPWKKSEEDLSYLLYLLSVQ----------------------VHGSAATCDVKTNPLNI-----KMSNNTDKPAVLESTSRVGANKRT---------RKEVKKGDQLSCDN-------VKCLLFTCRLGKLEQGEGAEIIMTSRLWQDTL 918          
BLAST of Alpha-int-1 vs. Ensembl Medaka
Match: itga8 (integrin subunit alpha 8 [Source:NCBI gene;Acc:101164748])

HSP 1 Score: 117.472 bits (293), Expect = 3.563e-26
Identity = 142/553 (25.68%), Postives = 234/553 (42.31%), Query Frame = 3
Query:  312 VNSYFGYSISSFIGQKEA---YCLVGAPRDEIDDESTNVNVNTGGVYRISF--VNNDCSKVPMGSEGS------GHVSPGYF---NWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTD-----EGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIF-------LANFGPMSMIDKV--LLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSG-HLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMS-----LKAKVAGRKISTSEKIIFRVYIDLD 1868
            V SYFGYS+  +    +      LVGAP+           V  G VY   +  V+  C ++P  +  +      G   P  F    W G SV T      G  + C P +  +T     K + +   +G C +   +      +  C   D     +G C     +  S D +++ ++ +G PGSF  +G +        L  +   +++ +V    KT+ SD  N    LGY +                   S + ++   P    N   G V ++++    + + YI + +G  + S FG S+AV D NGD   D++VGAP + +  T SK   ++G +Y++       F   V     +  G    G+FG +IA L D++ D  +D AVGCP  G+D+ G V I+ G   +  Q +    L+  L   + S         S   FG++L G  D+D N  PDLI+G + + ++ V RS+ ++ +E  + L P          N  D+ C        ++     + A V+G +I TS  +  R  + LD
Sbjct:   46 VGSYFGYSVDFYQATSDRNTISVLVGAPKANTSQPGI---VEAGSVYYCPWPGVSGTCRQIPFDNSNNRMIKVNGTREPLEFKSHQWFGASVRT----HKGKVVACAPLYHWRTV----KRDGEKDPVGTCYVAVQNFSAYAEYSPCRTNDPDPEGQGFC----QAGFSVDFTKEGRLVVGGPGSFYWQGQVMTTGIAEILNGYSLKAVLRQVPGEKKTAASDDMNDDSYLGYSVATGEF-----------TGDSEQELIAGVPRGAQN--FGYVAIINS----TNLTYIQNFTGTQMASYFGYSVAVTDLNGDGTDDVLVGAPLFMERETESKPR-EVGRVYLYLQLAPLTFSKPV-----ILTGTYTFGRFGTAIAPLEDVNQDGYNDVAVGCPFGGHDSGGRVLIFNGNKDILAQGL---TLSQELKAARTS-------SGSLPGFGFTLRGGQDLDNNQYPDLIVGAFGADEVSVYRSQAVVSVEATMTLTPKV-------LNPDDRQCLLPQTDIIVTCLKVEVCAGVSGVEIPTS--VDLRAELQLD 541          

HSP 2 Score: 73.9442 bits (180), Expect = 1.024e-12
Identity = 115/492 (23.37%), Postives = 204/492 (41.46%), Query Frame = 3
Query: 2181 DCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKG-------LNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLA-GFVHVAPENLEGIYVDSR------NFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRIS------QQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISH------NVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIED 3578
            +CG D  C+ D++     LS+++ +T++   +   +   +  + N GE AY  +L   IP   ++ G+         LNC  ++  ++  VV  C   NP V            L+ G   R    R    G  I   +++    N+D   SN        + L+   V  A  +L G+   S+      N+  K  P++    + +GP     + + N GPS + +  L +  P +  + EN+LY ++  +      + ++S NP+ +    Q+ +++ T             P  L  ++ +    +R+KRSV T E+      N                    C N       + C+ I C +  L       V I++R WA T FL + +D  I  S       +S++  +S   +  P  + H       ++  G  D+  + +P+W I+L  LLGL++L ++ L +WKCGFF R R    + I D
Sbjct:  635 NCGDDNVCIPDLQ-----LSATMDRTELVIGDDNLVMLTITAV-NQGEGAYETELFARIPPEADYIGVSRRVESVSMLNCDYKMINESRMVV--CDLGNPMVTGTE--------LSVG--LRFSVQRLEDSGPEI-HFELQIHSSNKDNSDSN-------LISLSLSIVARAELDLRGVSHPSQVVLPFPNWEPKEKPVKE---DDVGPQVTHIYELHNYGPSSIGEAELQVGWPSRFRD-ENLLYAMEIQTDGPISCRTNTSLNPLGL----QISALQDT-------------PELLGFLKNSSAPTHRHKRSVSTAESYSSKTLN--------------------CTN-------ISCLRIMCVVGRLDRGQSAVVRIRSRLWAHT-FLQRRNDPYILNST------VSFMV-ISVPYRSQPSTLPHRRTSMGTLVLWGTPDVSFA-VPLWVIILAILLGLLVLAILTLAMWKCGFFDRARPPADDDISD 1043          
BLAST of Alpha-int-1 vs. Ensembl Medaka
Match: itga3b (integrin subunit alpha 3 [Source:NCBI gene;Acc:101157734])

HSP 1 Score: 113.62 bits (283), Expect = 5.364e-25
Identity = 137/477 (28.72%), Postives = 224/477 (46.96%), Query Frame = 3
Query:  318 SYFGYSIS---SFIGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYR--ISFVNNDCSKVPMGSE-GSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDI-------SFLACS----VTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLD-TKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIM--RSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWL 1688
            S FG+S++     +G ++   LVGAP+++ +    +VN  TG VY   IS   +DCS++ + ++  S  +  G   WLG +V++    S G  L C  R+    + G   +E+Q   IG+C + +     D        S+  C+    +  EG C     +   +       V LG  GS+  +GN+ +    P           +  +L NR   +GY +               +       VVT +P + S   RG V++ + ++  +S +  IP     +GS FG+SLA  D N D   D+IVGAPFY +           GA+YIF  + +  F+  VS +  V KG    G FG ++A +GD++ D   DFAVG P      TG VYI++G  K               ++ + S M + + +   +FQ+FG+S+ G  D+DGNS PD+++G     +I ++R++ +I L
Sbjct:   39 SLFGFSVALHEQTVGSRQHLLLVGAPKEKANG-LKDVN-ETGAVYACPISTTFDDCSRMDLVTQPSSSEMVEGM--WLGVTVASQKGHSAGRVLMCGHRYAKIVTGG---TEEQRRMIGKCYVRSNDLTLDATDFWQTDSYEVCNPGYDMESEGQC-----NLGISGGIGYTDVYLGAVGSYTWQGNVHVIWRNPEPDNSWEANGKAFGELDNRNIYMGYSVL----------EEQKLLKQDQYTVVTGAPRFDS---RGSVILGEMSQAKISLMQLIP--GEQVGSYFGSSLAAADLNNDDWNDLIVGAPFYFERQNQIG-----GAVYIFMNE-NGSFQ-NVSTK--VLKGPAYSG-FGFAVAAIGDVNQDGFQDFAVGAP---FQETGRVYIWMGSKKG--------------ISDKYSQMIEGKSVGDGNFQSFGYSIDGGMDMDGNSYPDMVVGSL-DDRIALIRARPVIHL 460          
BLAST of Alpha-int-1 vs. Ensembl Medaka
Match: itga3b (integrin subunit alpha 3 [Source:NCBI gene;Acc:101157734])

HSP 1 Score: 113.235 bits (282), Expect = 8.816e-25
Identity = 137/477 (28.72%), Postives = 224/477 (46.96%), Query Frame = 3
Query:  318 SYFGYSIS---SFIGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYR--ISFVNNDCSKVPMGSE-GSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDI-------SFLACS----VTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLD-TKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIM--RSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWL 1688
            S FG+S++     +G ++   LVGAP+++ +    +VN  TG VY   IS   +DCS++ + ++  S  +  G   WLG +V++    S G  L C  R+    + G   +E+Q   IG+C + +     D        S+  C+    +  EG C     +   +       V LG  GS+  +GN+ +    P           +  +L NR   +GY +               +       VVT +P + S   RG V++ + ++  +S +  IP     +GS FG+SLA  D N D   D+IVGAPFY +           GA+YIF  + +  F+  VS +  V KG    G FG ++A +GD++ D   DFAVG P      TG VYI++G  K               ++ + S M + + +   +FQ+FG+S+ G  D+DGNS PD+++G     +I ++R++ +I L
Sbjct:   39 SLFGFSVALHEQTVGSRQHLLLVGAPKEKANG-LKDVN-ETGAVYACPISTTFDDCSRMDLVTQPSSSEMVEGM--WLGVTVASQKGHSAGRVLMCGHRYAKIVTGG---TEEQRRMIGKCYVRSNDLTLDATDFWQTDSYEVCNPGYDMESEGQC-----NLGISGGIGYTDVYLGAVGSYTWQGNVHVIWRNPEPDNSWEANGKAFGELDNRNIYMGYSVL----------EEQKLLKQDQYTVVTGAPRFDS---RGSVILGEMSQAKISLMQLIP--GEQVGSYFGSSLAAADLNNDDWNDLIVGAPFYFERQNQIG-----GAVYIFMNE-NGSFQ-NVSTK--VLKGPAYSG-FGFAVAAIGDVNQDGFQDFAVGAP---FQETGRVYIWMGSKKG--------------ISDKYSQMIEGKSVGDGNFQSFGYSIDGGMDMDGNSYPDMVVGSL-DDRIALIRARPVIHL 460          
BLAST of Alpha-int-1 vs. Ensembl Medaka
Match: itga3b (integrin subunit alpha 3 [Source:NCBI gene;Acc:101157734])

HSP 1 Score: 112.849 bits (281), Expect = 9.115e-25
Identity = 137/477 (28.72%), Postives = 224/477 (46.96%), Query Frame = 3
Query:  318 SYFGYSIS---SFIGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYR--ISFVNNDCSKVPMGSE-GSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDI-------SFLACS----VTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLD-TKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIM--RSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWL 1688
            S FG+S++     +G ++   LVGAP+++ +    +VN  TG VY   IS   +DCS++ + ++  S  +  G   WLG +V++    S G  L C  R+    + G   +E+Q   IG+C + +     D        S+  C+    +  EG C     +   +       V LG  GS+  +GN+ +    P           +  +L NR   +GY +               +       VVT +P + S   RG V++ + ++  +S +  IP     +GS FG+SLA  D N D   D+IVGAPFY +           GA+YIF  + +  F+  VS +  V KG    G FG ++A +GD++ D   DFAVG P      TG VYI++G  K               ++ + S M + + +   +FQ+FG+S+ G  D+DGNS PD+++G     +I ++R++ +I L
Sbjct:   39 SLFGFSVALHEQTVGSRQHLLLVGAPKEKANG-LKDVN-ETGAVYACPISTTFDDCSRMDLVTQPSSSEMVEGM--WLGVTVASQKGHSAGRVLMCGHRYAKIVTGG---TEEQRRMIGKCYVRSNDLTLDATDFWQTDSYEVCNPGYDMESEGQC-----NLGISGGIGYTDVYLGAVGSYTWQGNVHVIWRNPEPDNSWEANGKAFGELDNRNIYMGYSVL----------EEQKLLKQDQYTVVTGAPRFDS---RGSVILGEMSQAKISLMQLIP--GEQVGSYFGSSLAAADLNNDDWNDLIVGAPFYFERQNQIG-----GAVYIFMNE-NGSFQ-NVSTK--VLKGPAYSG-FGFAVAAIGDVNQDGFQDFAVGAP---FQETGRVYIWMGSKKG--------------ISDKYSQMIEGKSVGDGNFQSFGYSIDGGMDMDGNSYPDMVVGSL-DDRIALIRARPVIHL 460          
BLAST of Alpha-int-1 vs. Ensembl Medaka
Match: itga9 (integrin subunit alpha 9 [Source:NCBI gene;Acc:101161001])

HSP 1 Score: 105.916 bits (263), Expect = 1.535e-22
Identity = 175/753 (23.24%), Postives = 320/753 (42.50%), Query Frame = 3
Query:  315 NSYFGYSISSFIGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNN---DCSKVPMG-----SEGSGHVSPGYFN--WLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTI-RDISFLACSV-------TDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSD-LKNRGYN-LGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGH-LGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNV-RGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNE--PDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGL-----KGLNCTLRISEDTINVVALCQFPNPFVNNRNKIH 2486
            +S+FGYS+         + +VGAPR   +   ++   + G VY+    +N    C+++ +G      E  G    G  +  W+G S++   + ++G  L C  R+ +     V  + + +L  G C+I   S   R    + C          + G+C     + ++   +E++ V +G PGS+   G I + N    S         SP + + + GY+ LGY +                  FS+  VV  +    + ++ GV  V   K++ S ++     +G  +GS FG+SL   D N D + D++VGAP ++       +L D G + ++ G+ +      V  ++ V  G N     FG SIA +GDID D   D A+G P   +D  G+VYIY GG+    Q+   +             +  + +    Q FG S++G  D+DGN   D+ +G + +  +VVLRS+ +I ++  ++ LP S +I   + +E  P+  CF        ++  +  GR++    ++++ +  D D K +     R+  V S S I       S        + ++  V+   + +   I   +  ++                     +L   KG K      + F   +C SD +C +D+R+    L S ++          +   + I I N G++AY+  +     + + +        KG++C L +  D +    +C+   PF+  + K H
Sbjct:   46 SSFFGYSVLEHYHDNTRWVIVGAPR--ANSSYSSSVRSPGAVYKCRVHSNPERRCTEMDLGRGNKPRETCGKTCQGDRDDEWMGVSLARQ-DRADGKVLACAHRWKN-----VYYASEHILPHGYCAIIPPSLQGRTKPLIPCYEDHKQKYGEEHGSC----QAGIAGVFTEEL-VVMGAPGSYYWTGTIKVYNLTSDSFY-------SPRESIDSHGYSYLGYAVAAGH--------------FSSPNVVDIAA--GAPQHSGVGKVYIFKIEGSSLVKSFQATGKMMGSYFGSSLCAVDLNQDGLSDLLVGAPMHS-------QLRDEGQVSVYLGKGNG-----VMEEHAVLTGDNAFNAHFGESIAAIGDIDDDGYQDVAIGAPK-EDDYAGAVYIYHGGATGITQIYSMK-------------LSGRSLNPGLQMFGQSISGTVDMDGNGYSDVTVGAFMADSVVVLRSRPVITVDVSIF-LPVSINISLPQCHEGHPNLNCFN------ATVCLRFRGRQLPGQIELLYNLTADAD-KRQKSQPARVYFVQSGSQISQMSQQLSLDINREECQRYTAFVKKDVKDVFTAITFEVAYSLGRHALTGDPDQELPALTP---VLRWRKGNKIAVRNETWFEK-NCLSD-DCAADLRLHGKLLLSGMHVKAHLALGAVRNVSLNITISNAGDDAYDTNIHFNFSREVFYINFWQKEDKGISCAL-VDLDFL----VCRVGFPFMRAQTKYH 718          
BLAST of Alpha-int-1 vs. Planmine SMEST
Match: SMESG000022733.1 (SMESG000022733.1)

HSP 1 Score: 2165.58 bits (5610), Expect = 0.000e+0
Identity = 1145/1153 (99.31%), Postives = 1149/1153 (99.65%), Query Frame = 3
Query:  180 MEHCXXXXXXXXXXXXXXXKICSSDTFDNDIFLVGLSKLYLHSNVNSYFGYSISSFIGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNNDCSKVPMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYKAEIIEDSNGHNGYVSRCNYSYNPVHL 3638
            MEHCLLSILLLFNLLWNSLKICSSDTFDNDIFLVGLSKLYLHSNVNSYFGYSISSFIGQKEAYCLVGAPRDEIDDESTN NVNTGGVYRISFVNNDCSKVPMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLSGFSSSVSADDSEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPD+SGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDV KGVNVRGKFGMSIANLGDIDGDDIDDFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSS+ITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNISISYQPTSSSSNDNIEISNFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHV+PENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQA FTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQ+ISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIE VVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPIVLGALLGLILLTLIILMLWKCGFFQRHRQYKAEIIEDSNGHNGYVSRCNYSYNPVHL
Sbjct:    1 MEHCLLSILLLFNLLWNSLKICSSDTFDNDIFLVGLSKLYLHSNVNSYFGYSISSFIGQKEAYCLVGAPRDEIDDESTNGNVNTGGVYRISFVNNDCSKVPMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLSGFSSSVSADDSEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDMSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVLKGVNVRGKFGMSIANLGDIDGDDIDDFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSVITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNISISYQPTSSSSNDNIEISNFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVSPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQAAFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQIISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETIEKVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPIVLGALLGLILLTLIILMLWKCGFFQRHRQYKAEIIEDSNGHNGYVSRCNYSYNPVHL 1153          
BLAST of Alpha-int-1 vs. Planmine SMEST
Match: SMESG000018926.1 (SMESG000018926.1)

HSP 1 Score: 121.709 bits (304), Expect = 1.698e-27
Identity = 226/996 (22.69%), Postives = 414/996 (41.57%), Query Frame = 3
Query:  681 TIRDISFLACSVTDEGACLXXXXXXXXXXXXE--KIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKN---RGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDLSQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDAT-GSVYIYLGGS-----KVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNLIWLENPVWLLPTSKSIEWTKYNEPDKPCFG-DSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYKRLQLVS----------SKSSIITKYLNYSFSTLNSTVEIFSGLVEPRFEQIKLNIWQPLIVNIXXXXXXXXXXXXXXXXXXXFWMLHPFKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEKYQIRQVVIGIGNWG-ENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTINVVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKVEGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRIS--QQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNL---NAIERNLKQNYRNKRSVETIENVVETKS------NPVKSASIVP--KIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYK 3560
            T+  I F   S T    C+ GFS  + + +++   I++ +GMP          +  FG + +I+    K   S  +N   + YN GY + L                 SN     SSP   S++Y   V  +   L L+    IP       S+FG +L        K   +++GAPF+     S K + ++G +YIF     ++     S  +D   G      FG  +AN+GDI+GD   D A+  P   ND   G V +Y         + P Q+++ +   +  +                  FG ++ G  D+D N  PD+I+    S+ I +  S+ L           T+K I  T  N   +P +  D+    +SL          + E  +   YID++      F K+L+++S          ++  +IT+ +   F +       F+ +     + + L I  P+ +         +   N+        +L P   ++  ++ I + +   C + + C +DI    ++L        IY  +K   R + + I N+G      +  +IT  + L    +       +    T    A C+  N  ++        ++ ++    F  +K+    I  +   + VE   +  D + +NN   I+Y       + ++  + +   +DSRN S  ++  QRV  + +GP    TF I N+G + +  I + IS+P +T     ILY   +I    Q   G    +S +P   ++ GT    C LP + ++PL +      E +LK    +K  V+ + + +  +S      N   +A+ +P  K+     E + CN S        C +I C I  L    + +++I A  +A TFF  K+SD  +Y++I  +   I     +     + P +     IF  ++  ++   P+WPI++G ++G ++L ++I+  +KCGFF+R+++ +
Sbjct:  177 TLTSIEFCKLSATSYSTCMGGFSVDLMSMNNQVNGIEMLVGMPH---------MIPFGGVKIINNPFGKPIVSQPRNGLGKYYNFGYSVALT----------------SNSDGYVSSPL--SDQYGPNVTNIREDLQLTSPDNIP------FSSFGVTLTTLSIFKGKRYAVVIGAPFH-----SVKSIQNVGKVYIFCSSNKNR-----SAPSDFLHGKEKDEFFGYFLANIGDINGDGNQDLAISSPFLRNDEIKGFVALYTINENCEMKQTPYQILKSQKPKNAGI------------------FGIAITGGSDMDFNGWPDIIVSSTRSNSIEMYASRQLY----------TAKCIYSTDSNLEVQPLYMYDNITITLSL----------SLEDFLKNQYIDIN------FLKQLKVLSQVKINDNSQLNRFKLITEPITIEFDSATGISVTFTIMSLQNVKDMNLTI--PVTIGYRFVENCENRKCNN--------LLFPLINWEKCTTIIPI-KKYICSNIFICNADIA---AELVDRFGNEVIYGFDKSYHRTLELKIYNYGPTEGKGINFRITTFENLRINKISTTESNFKDLISTNQTKATCKLENYEIDANE-----FIAIDIDLYFIDFKDSSKMIYENNFVL-VELFSDVTDSNLTNNVAKINYIFIYEPNISLSASSKQDTVIDSRNRSQPMNLGQRVTIDIIGPRLSQTFIIDNIGKAVINNIVVRISVPLQTKENLYILYLFDKIRGVNQSQVG---WMSIVPH--AVVGTEKYPCSLPSEFVNPLKIIGFETHESHLKD--IDKTPVDGLLHFIRKRSANQPFINASANANKMPLGKMNRIPIESIECNRSGQALKLPICGDITCAIPFLPANKQARIQINAWLYAHTFFKKKISDLKVYSTISVDFTNIPKGVKLRFPSPVRPYSQFQQFIFNNLKLNIVHIKPLWPIIVGIVIGTLILAILIVAFYKCGFFKRNKRRR 1058          
BLAST of Alpha-int-1 vs. Planmine SMEST
Match: SMESG000021746.1 (SMESG000021746.1)

HSP 1 Score: 87.8113 bits (216), Expect = 4.083e-17
Identity = 79/312 (25.32%), Postives = 148/312 (47.44%), Query Frame = 3
Query: 2631 IDYFLRLAGFVHVAPENLEGIYVDSRNFSSKISPLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYFLKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIERNLKQNYRNKRSVETI--ENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKSGFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSIFGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPXXXXXXXXXXXXXXXXXXXWKCGFFQRHRQYK 3560
            ++Y +     + ++ +N +   +DSR     +  L RV  + LG     ++ I N GP  L+ + L    P+K    + ILY + +I    S    IS   LP + +  G     C + ++ ++PLN+ A +    + YR+KRS   +   N   ++++  +S   V         ++ CN S    G+  C  + C +  +   SE   + +A  + +TFF  ++    + T++  N+     +  V  +  I P+  S NV+F  ++      LP+WPI++  ++G+ LL +II++ + CGFF+R R  K
Sbjct:  703 MEYKVLFKPKLMISSKNTKENNIDSRIKPPYLEKLHRVSVQDLGTELSYSYLIENKGPE-LKNVTLKFLFPYKIQPDKYILYLMDKIRLSTSVKEEIS---LPSINNKNGLVKY-CNVAKEMLNPLNVIAHDYKKSETYRSKRSANELNFSNKSVSQNDRSQSEGNVALSSLGRTSLIKCNESNPNLGAPICGEVICRLDVIPNNSEFNFDFRAWVFTKTFFDARIPHLTVMTTLQANLELPKGLSVVKENQIIGPIFASQNVLFNKMKVDEDKPLPLWPIIVAIIIGIFLLVIIIIIAYYCGFFKRKRLRK 1009          

HSP 2 Score: 51.9878 bits (123), Expect = 3.189e-6
Identity = 56/220 (25.45%), Postives = 92/220 (41.82%), Query Frame = 3
Query: 1101 DLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGS-----KVPVQVIRPRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKN-----LIWLENPVWLLPTSKSIE 1730
            DL       FG S+   +  G+ +  +++GAP     + S + LV++GA+++     + K K T     DV  G N    FG +IA LGDID +  ++F VG P+   D  G +YI+         K P+QV + +                      F  FG +++  FD++ N  PD  +    S +  +    N       W+E     +   +S E
Sbjct:  282 DLKTQRYGGFGTSMDTVNLGGN-LYAVVIGAP-----YQSKQNLVNVGAVFL-----ACKGKPT-----DVIYGENAYDNFGYAIARLGDIDSNGSEEFVVGAPSLNLDKPGKIYIFKTTESCQIFKKPLQVYQSK----------------------FTGFGIAISRGFDVNFNGKPDFFVTSLGSQKPFLFVMPNQEKVTCTWIEPSTGFIINEQSFE 463          
BLAST of Alpha-int-1 vs. Planmine SMEST
Match: SMESG000034289.1 (SMESG000034289.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.278e-15
Identity = 149/585 (25.47%), Postives = 248/585 (42.39%), Query Frame = 3
Query:  279 VGLSKLYLHSNV---NSYFGYSISSFIGQKEA--YCLVGAPRDEIDDESTNVNVNTGGVYR--ISFVNNDCSKVPMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSY-------------GVNKSEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSP---HWKSNEYR---GVVLVLDTKLDLSQILYIPDLSGHL-GSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYG-QVSDKFKYTVSNQNDVFKGVNV-------RGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIR-PRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGK-FDIDGNSVPDLIIGDYSSSQIVVLRSKNLI--WLENPV----WLLPTS-KSIEWTKYNEPDKPC--FGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYK 1895
            + L+  Y+ SN     S+FG+S++ F  ++ +  Y L+GAP D + D     N  TG ++   ++    DC K  + +E S     GY            N   G+   C P+FL   +Y               N+ EQ  +    C     S  ++  +  C     GA L            E+ ++ L  P S+  +G +   NF             S + LK R  N  Y      +  G   R+P + S     +V  SP    + S   +   G V++   KL  + + Y+  + G + GS +G S+   D N D + +++VGAPF  ++          G +++++  ++S       +   DV K + +        G++G+S+ N+GDI+ D I D AVG P   ND TG+VYIYLG S    Q+I+  + +   +++P              + +G+S+ GK  D+D N+ PD I+G   S  +V +R++ +I  + EN V      LP S  S++    N  + PC     S  YY           ++T         ID + +L+ PF K
Sbjct:   23 IDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDS----NETTGALFSCPVTKETQDCKKF-VFTEHSNESLLGYV--------VDSNSHEGLIYTCAPKFLRSHTYVKYVEGACWEFNDMFNEVEQ--ISNQDCLESIKSESQNYEYRNCLT---GAALKSL---------ERKQLVLTAPYSYEGKGLLINNNFYSREN------SRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKS-----IVLGSPGISQYDSTRTQIKFGQVVI--GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNN---------GQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAP-FENDGTGAVYIYLGDSH---QIIKLSQKIEGQMISPD------------LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAATDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIHYYYP--------DLTTCPSYASSKTIDYEIELDMPFIK 534          
BLAST of Alpha-int-1 vs. Planmine SMEST
Match: SMESG000034289.1 (SMESG000034289.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.396e-15
Identity = 152/582 (26.12%), Postives = 252/582 (43.30%), Query Frame = 3
Query:  279 VGLSKLYLHSNV---NSYFGYSISSFIGQKEA--YCLVGAPRDEIDDESTNVNVNTGGVYR--ISFVNNDCSKVPMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNKSEQQLLGIGQCSIYTG--STIRDISFLAC--SVTDEGA------CLXXXXXXXXXXXXEKIKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYDIKLARLWYGPKGRSPFINSFSNEVVVTSSP---HWKSNEYR---GVVLVLDTKLDLSQILYIPDLSGHL-GSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKRLVDIGAIYIFYG-QVSDKFKYTVSNQNDVFKGVNV-------RGKFGMSIANLXXXXXXXXXXFAVGCPNCGNDATGSVYIYLGGSKVPVQVIR-PRNLNHVLVTPQCSYMDDKEIMRSFQNFGWSLAGK-FDIDGNSVPDLIIGDYSSSQIVVLRSKNLI--WLENPV----WLLPTS-KSIEWTKYNEPDKPC--FGDSCRYYMSLKAKVAGRKISTSEKIIFRVYIDLDTKLEHPFYK 1895
            + L+  Y+ SN     S+FG+S++ F  ++ +  Y L+GAP D + D     N  TG ++   ++    DC K  + +E S     GY            N   G+   C P+FL   +Y V   E      G C  +    + +  IS   C  S+  E        CL+G +        E+ ++ L  P S+  +G +   NF             S + LK R  N  Y      +  G   R+P + S     +V  SP    + S   +   G V++   KL  + + Y+  + G + GS +G S+   D N D + +++VGAPF  ++          G +++++  ++S       +   DV K + +        G++G+S+ N+GDI+ D I D AVG P   ND TG+VYIYLG S    Q+I+  + +   +++P              + +G+S+ GK  D+D N+ PD I+G   S  +V +R++ +I  + EN V      LP S  S++    N  + PC     S  YY           ++T         ID + +L+ PF K
Sbjct:   23 IDLNSPYIKSNFINNKSFFGFSLNIFTSKQNSIKYFLIGAPFDILKDS----NETTGALFSCPVTKETQDCKKF-VFTEHSNESLLGYV--------VDSNSHEGLIYTCAPKFLRSHTY-VKYVE------GACWEFNDMFNEVEQISNQDCLESIKSESQNYEYRNCLTGAALKSL----ERKQLVLTAPYSYEGKGLLINNNFYSREN------SRSSNYLKFRNSNSKYQYTGFSMAVGKIFRNPNVKS-----IVLGSPGISQYDSTRTQIKFGQVVI--GKLIENSLEYVGVIFGEVFGSGYGYSVLAMDLNNDGMDELVVGAPFTNNNN---------GQVFVYWNIEMSQSNIEHKTIPLDVEKRLLLTSMKKLSNGQYGISLENIGDINKDFIQDLAVGAP-FENDGTGAVYIYLGDSH---QIIKLSQKIEGQMISPD------------LRGYGFSIFGKNEDLDSNTYPDFIVGSVLSGHVVGMRTRPIIRVYAENMVAATDMQLPYSFDSLKKCNSNGQEMPCIKLSVSIHYYYP--------DLTTCPSYASSKTIDYEIELDMPFIK 534          
The following BLAST results are available for this feature:
BLAST of Alpha-int-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGAV1.935e-2323.24integrin subunit alpha V [Source:HGNC Symbol;Acc:H... [more]
ITGAV3.264e-2123.41integrin subunit alpha V [Source:HGNC Symbol;Acc:H... [more]
ITGA89.885e-2123.57integrin subunit alpha 8 [Source:HGNC Symbol;Acc:H... [more]
ITGA32.749e-2027.89integrin subunit alpha 3 [Source:HGNC Symbol;Acc:H... [more]
ITGA33.228e-2027.89integrin subunit alpha 3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ina-12.060e-1726.79Integrin alpha ina-1 [Source:UniProtKB/Swiss-Prot... [more]
pat-24.305e-1528.26Integrin alpha pat-2 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
if8.049e-2227.02gene:FBgn0001250 transcript:FBtr0301352[more]
mew4.588e-2127.11gene:FBgn0004456 transcript:FBtr0340190[more]
mew5.746e-2126.60gene:FBgn0004456 transcript:FBtr0073732[more]
mew2.490e-2026.82gene:FBgn0004456 transcript:FBtr0310647[more]
mew6.407e-1827.49gene:FBgn0004456 transcript:FBtr0330398[more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga3b5.723e-3224.01integrin, alpha 3b [Source:ZFIN;Acc:ZDB-GENE-05041... [more]
itga82.341e-3023.27integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
itgav5.147e-2422.92integrin, alpha V [Source:ZFIN;Acc:ZDB-GENE-060616... [more]
itga2b7.832e-2423.68integrin, alpha 2b [Source:ZFIN;Acc:ZDB-GENE-05103... [more]
itga3a4.482e-2128.46integrin, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-09080... [more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pycr18.192e-4224.17pyrroline-5-carboxylate reductase family, member 1... [more]
pycr13.710e-3224.52pyrroline-5-carboxylate reductase family, member 1... [more]
pycr11.127e-2924.55pyrroline-5-carboxylate reductase family, member 1... [more]
pycr11.384e-2924.55pyrroline-5-carboxylate reductase family, member 1... [more]
pycr13.186e-2923.03pyrroline-5-carboxylate reductase family, member 1... [more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Itga2b9.331e-2425.55integrin alpha 2b [Source:MGI Symbol;Acc:MGI:96601... [more]
Itga81.679e-2125.27integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442... [more]
Itga83.713e-2125.27integrin alpha 8 [Source:MGI Symbol;Acc:MGI:109442... [more]
Itga51.390e-2024.59integrin alpha 5 (fibronectin receptor alpha) [Sou... [more]
Itga34.425e-2027.18integrin alpha 3 [Source:MGI Symbol;Acc:MGI:96602][more]
back to top
BLAST of Alpha-int-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26009|ITA8_CHICK9.280e-3624.07Integrin alpha-8 OS=Gallus gallus OX=9031 GN=ITGA8... [more]
sp|P26008|ITAV_CHICK3.669e-3123.14Integrin alpha-V OS=Gallus gallus OX=9031 GN=ITGAV... [more]
sp|Q9QUM0|ITA2B_MOUSE6.527e-2325.55Integrin alpha-IIb OS=Mus musculus OX=10090 GN=Itg... [more]
sp|P06756|ITAV_HUMAN9.292e-2323.24Integrin alpha-V OS=Homo sapiens OX=9606 GN=ITGAV ... [more]
sp|Q06274|ITA5_XENLA2.091e-2223.51Integrin alpha-5 OS=Xenopus laevis OX=8355 GN=itga... [more]
back to top
BLAST of Alpha-int-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1P8CUY40.000e+0100.00Alpha-int-1 (Fragment) OS=Schmidtea mediterranea O... [more]
G7YUI60.000e+032.09Integrin alpha-5 OS=Clonorchis sinensis OX=79923 G... [more]
A0A4S2LXG90.000e+032.16Integrin_alpha2 domain-containing protein OS=Opist... [more]
A0A4E0RJF20.000e+032.51Integrin alpha-5 OS=Fasciola hepatica OX=6192 GN=D... [more]
A0A158R9990.000e+031.68Integrin_alpha2 domain-containing protein OS=Taeni... [more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga3b6.648e-3823.74integrin alpha-3-like [Source:NCBI gene;Acc:103040... [more]
itga84.472e-3422.18integrin subunit alpha 8 [Source:NCBI gene;Acc:103... [more]
itga2b5.408e-2825.23integrin alpha-IIb [Source:NCBI gene;Acc:103045206... [more]
itga6b3.579e-2524.78integrin alpha-6-like [Source:NCBI gene;Acc:103030... [more]
itga3a3.043e-2427.51integrin alpha-3 [Source:NCBI gene;Acc:103032002][more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga89.016e-3122.66integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
itga81.663e-2325.42integrin, alpha 8 [Source:ZFIN;Acc:ZDB-GENE-080220... [more]
ITGA62.439e-1822.49integrin subunit alpha 6 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000001557.11.284e-1526.68pep scaffold:Pmarinus_7.0:GL480593:314407:372761:-... [more]
ITGA61.042e-1433.19integrin subunit alpha 6 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-int-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO489846.561e-2136.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493726.659e-1230.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-int-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itga83.563e-2625.68integrin subunit alpha 8 [Source:NCBI gene;Acc:101... [more]
itga3b5.364e-2528.72integrin subunit alpha 3 [Source:NCBI gene;Acc:101... [more]
itga3b8.816e-2528.72integrin subunit alpha 3 [Source:NCBI gene;Acc:101... [more]
itga3b9.115e-2528.72integrin subunit alpha 3 [Source:NCBI gene;Acc:101... [more]
itga91.535e-2223.24integrin subunit alpha 9 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Alpha-int-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022733.10.000e+099.31SMESG000022733.1[more]
SMESG000018926.11.698e-2722.69SMESG000018926.1[more]
SMESG000021746.14.083e-1725.32SMESG000021746.1[more]
SMESG000034289.11.278e-1525.47SMESG000034289.1[more]
SMESG000034289.11.396e-1526.12SMESG000034289.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017880 ID=SMED30017880|Name=Alpha-int-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3694bp
CATAGATTAGCCAATATTTTCATTGAATAGTAAATCTAAAAGTTGTGCTG
TAGAAAAATCATGATGCACAAATTGAATTTGGATGCCTATAGATCGTGTT
TAAGCTGCTGATATTTTTCTTCAAATGGGAAATTTGAATCGTTGTGCCAT
AGAAAGTTAATTCGTTTTCTCACAGTATAATGGAACATTGTTTACTTTCA
ATTCTTTTACTATTCAATTTATTATGGAATTCTTTAAAAATATGCTCGTC
CGATACTTTTGACAATGATATTTTCTTGGTAGGATTATCTAAATTATATT
TGCATTCTAACGTGAACAGCTATTTTGGTTATTCAATTTCTTCTTTCATT
GGACAAAAGGAAGCTTATTGTTTAGTGGGAGCTCCTCGTGATGAAATAGA
TGATGAAAGTACGAATGTAAATGTAAATACCGGCGGAGTTTATCGGATAT
CATTTGTAAATAATGACTGCTCAAAAGTTCCGATGGGTTCCGAAGGTTCT
GGACATGTTTCGCCAGGATATTTTAACTGGCTTGGTGGTAGTGTATCTAC
CACTGTAAACGGCTCAAATGGAGTTCAGTTGGGATGCGATCCAAGGTTTT
TGTCAAAAACGTCTTATGGTGTCAATAAATCTGAACAGCAATTACTAGGT
ATTGGCCAGTGCAGTATTTATACAGGATCAACAATAAGGGATATATCATT
TCTAGCGTGCTCGGTGACTGATGAAGGAGCATGTTTGTCAGGTTTCAGTT
CAAGCGTCTCAGCTGATGACTCAGAGAAAATCAAGGTTGCTCTAGGAATG
CCTGGCAGTTTTCTCACAGAAGGAAATATTTTTCTGGCTAACTTTGGTCC
AATGAGTATGATTGACAAAGTGCTTCTAAAGACAAGTCCATCTGATTTGA
AAAACCGGGGTTATAATCTTGGTTATGACATAAAACTAGCACGATTGTGG
TATGGGCCAAAAGGTAGATCTCCATTTATCAATTCCTTTTCCAATGAAGT
CGTTGTTACATCAAGTCCTCATTGGAAATCCAACGAATATCGGGGAGTAG
TTTTGGTTCTTGATACTAAATTAGATTTAAGTCAAATTTTGTACATTCCT
GATTTGAGCGGTCACTTGGGCAGTAATTTTGGTAATAGTTTAGCAGTTGG
TGATTTCAATGGAGACAAAATACTTGATATTATTGTGGGAGCTCCATTTT
ATACTGACCATTGGACTTCATCTAAACGTTTAGTTGATATTGGTGCTATT
TACATATTTTACGGACAAGTTTCTGACAAGTTTAAGTACACCGTTTCAAA
CCAAAATGATGTTTTCAAGGGTGTAAATGTTCGGGGGAAATTTGGAATGA
GTATAGCTAACTTGGGGGATATTGATGGGGATGATATCGACGATTTTGCA
GTTGGATGCCCCAACTGTGGAAATGATGCTACTGGGTCCGTTTATATTTA
TTTGGGTGGTTCTAAAGTTCCAGTACAGGTAATAAGACCGAGGAATCTTA
ACCACGTTCTTGTAACCCCTCAGTGCAGTTACATGGATGACAAAGAAATT
ATGCGATCTTTTCAGAATTTTGGTTGGTCATTGGCTGGGAAATTTGATAT
AGATGGAAATTCTGTTCCTGATCTGATCATAGGAGATTACTCTAGTTCAC
AAATAGTTGTGCTACGATCGAAAAACCTTATTTGGTTAGAAAATCCTGTT
TGGTTGTTACCGACCTCAAAGTCAATTGAATGGACTAAATATAATGAGCC
AGACAAACCATGTTTTGGAGATAGTTGTAGATATTACATGTCATTAAAAG
CTAAAGTTGCTGGACGAAAAATTTCCACCAGCGAAAAAATCATTTTTCGT
GTTTATATAGATCTGGATACAAAATTAGAACATCCGTTTTATAAACGTCT
CCAACTCGTTTCATCAAAAAGTTCAATTATCACAAAATATTTAAACTATT
CTTTTTCTACATTGAATTCAACCGTGGAAATTTTCTCTGGGCTCGTTGAG
CCACGATTTGAACAGATTAAATTGAACATTTGGCAACCTCTAATTGTTAA
CATTTCGATTTCATATCAACCAACCTCGTCCAGTTCAAATGATAATATTG
AAATCTCAAATTTTTGGATGCTTCATCCTTTTAAAGGCTATAAATATTTC
TCAAGTCCTATCAGCCTTTTTCGGAACCCTGATTGTGGATCTGATTATAA
CTGCGTATCGGATATTCGTGTCTTTATCAGTGATTTGTCCTCAAGTCTTT
ATAAAACAGACATTTATTATAAAGAAAAATACCAAATACGTCAAGTGGTT
ATCGGTATCGGAAATTGGGGTGAAAACGCCTATAATGTTAAACTGAAAAT
TACCATTCCGAAAGTGCTGGAATTTCAAGGACTCAAAGGACTCAACTGCA
CTTTGAGGATTAGTGAAGACACCATCAATGTGGTTGCTCTGTGCCAATTC
CCTAATCCGTTTGTTAATAATCGTAACAAAATTCACAAACTCTATCTGAC
TCTCAATACCGGAGGTGCTTTTAGATCTTATAAAAACCGCAAAAACAAAA
TAGGATCTTCTATACTGACAATGAAAGTTGAAGGAACTTGCGAGAATCAA
GATTTCGATAAGTCAAATAATAAAGGTTCAATAGACTATTTTCTCAGATT
GGCCGGATTTGTTCACGTGGCTCCAGAAAATTTAGAGGGTATTTATGTTG
ATTCGAGAAATTTCTCTTCGAAAATCAGTCCCTTACAGAGAGTATATCCT
GAAACTTTAGGTCCTCCTTATCAGGCAACATTTACCATTTCTAATCTTGG
TCCTTCGCCGTTAGAAAAAATAAATCTTACAATCTCAATACCATTTAAAA
CTTCGAACGGGGAAAATATACTTTACTTTTTAAAAAGAATAAGCCAACAA
GATTCTAGTGGAAATCCGATATCTATATCCCAACTGCCTCAAGTAATTTC
AATTAAAGGAACAGCTCATGGGAATTGCAGGTTGCCTGAAGACTCCATCG
ACCCTTTAAATTTAAATGCAATCGAAAGAAATCTAAAACAAAATTACCGA
AACAAGAGGAGCGTTGAGACCATTGAAAATGTTGTTGAAACCAAATCGAA
TCCCGTGAAGTCTGCTTCCATCGTTCCGAAAATCAAAACTCGATATCAAG
AAATCGTCAGTTGTAATAATTCGAAATCGGGTTTTGGTTCCGTTGAATGC
ATTAATATTCACTGTGACATTTTCAATTTGACTTTGCAGTCAGAAATCAA
GGTGGAAATCAAAGCCAGATTTTGGGCGGAAACGTTTTTCTTATATAAAG
TATCTGATTCTGTGATTTATACCTCAATATTCGGAAACATTCATCCTATT
TCATATGTTTTTAACGTTTCGGGAGACCTGAAAATTTATCCTTTAAATAT
CAGTCACAATGTTATATTCAAAGGCATAGAAGATATGATGATTAGTACTT
TACCGATTTGGCCGATAGTACTCGGGGCCCTATTGGGGTTGATACTCCTT
ACACTCATTATATTAATGCTGTGGAAATGCGGTTTCTTTCAAAGACATAG
ACAATATAAAGCAGAGATCATTGAAGACTCAAACGGCCATAATGGCTACG
TTTCTAGATGCAATTATTCCTATAATCCAGTTCATTTATAGCATTATTCA
AGATGTGAAATGTATATAATAATAAATATTTATTAACAAAAAAA
back to top

protein sequence of SMED30017880-orf-1

>SMED30017880-orf-1 ID=SMED30017880-orf-1|Name=SMED30017880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1154bp
MEHCLLSILLLFNLLWNSLKICSSDTFDNDIFLVGLSKLYLHSNVNSYFG
YSISSFIGQKEAYCLVGAPRDEIDDESTNVNVNTGGVYRISFVNNDCSKV
PMGSEGSGHVSPGYFNWLGGSVSTTVNGSNGVQLGCDPRFLSKTSYGVNK
SEQQLLGIGQCSIYTGSTIRDISFLACSVTDEGACLSGFSSSVSADDSEK
IKVALGMPGSFLTEGNIFLANFGPMSMIDKVLLKTSPSDLKNRGYNLGYD
IKLARLWYGPKGRSPFINSFSNEVVVTSSPHWKSNEYRGVVLVLDTKLDL
SQILYIPDLSGHLGSNFGNSLAVGDFNGDKILDIIVGAPFYTDHWTSSKR
LVDIGAIYIFYGQVSDKFKYTVSNQNDVFKGVNVRGKFGMSIANLGDIDG
DDIDDFAVGCPNCGNDATGSVYIYLGGSKVPVQVIRPRNLNHVLVTPQCS
YMDDKEIMRSFQNFGWSLAGKFDIDGNSVPDLIIGDYSSSQIVVLRSKNL
IWLENPVWLLPTSKSIEWTKYNEPDKPCFGDSCRYYMSLKAKVAGRKIST
SEKIIFRVYIDLDTKLEHPFYKRLQLVSSKSSIITKYLNYSFSTLNSTVE
IFSGLVEPRFEQIKLNIWQPLIVNISISYQPTSSSSNDNIEISNFWMLHP
FKGYKYFSSPISLFRNPDCGSDYNCVSDIRVFISDLSSSLYKTDIYYKEK
YQIRQVVIGIGNWGENAYNVKLKITIPKVLEFQGLKGLNCTLRISEDTIN
VVALCQFPNPFVNNRNKIHKLYLTLNTGGAFRSYKNRKNKIGSSILTMKV
EGTCENQDFDKSNNKGSIDYFLRLAGFVHVAPENLEGIYVDSRNFSSKIS
PLQRVYPETLGPPYQATFTISNLGPSPLEKINLTISIPFKTSNGENILYF
LKRISQQDSSGNPISISQLPQVISIKGTAHGNCRLPEDSIDPLNLNAIER
NLKQNYRNKRSVETIENVVETKSNPVKSASIVPKIKTRYQEIVSCNNSKS
GFGSVECINIHCDIFNLTLQSEIKVEIKARFWAETFFLYKVSDSVIYTSI
FGNIHPISYVFNVSGDLKIYPLNISHNVIFKGIEDMMISTLPIWPIVLGA
LLGLILLTLIILMLWKCGFFQRHRQYKAEIIEDSNGHNGYVSRCNYSYNP
VHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028994Integrin_alpha_N
IPR000413Integrin_alpha
IPR013519Int_alpha_beta-p
IPR013649Integrin_alpha-2
IPR013517FG-GAP
IPR018184Integrin_alpha_C_CS
IPR032695Integrin_dom_sf
IPR001627Semap_dom
Vocabulary: cellular component
TermDefinition
GO:0008305integrin complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007229integrin-mediated signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000413Integrin alpha chainPRINTSPR01185INTEGRINAcoord: 310..330
score: 39.02
coord: 46..58
score: 39.4
coord: 1103..1122
score: 58.66
coord: 387..411
score: 49.66
IPR013519Integrin alpha beta-propellorSMARTSM00191int_alpha_rptcoord: 313..375
e-value: 5.4E-10
score: 49.2
coord: 384..436
e-value: 3.1E-10
score: 50.0
coord: 45..104
e-value: 2.7
score: 17.0
coord: 460..507
e-value: 1.5
score: 17.8
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 302..369
score: 9.994
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 374..433
score: 9.112
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 450..512
score: 7.208
IPR013519Integrin alpha beta-propellorPROSITEPS51470FG_GAPcoord: 35..99
score: 6.017
IPR013649Integrin alpha-2PFAMPF08441Integrin_alpha2coord: 668..1012
e-value: 2.1E-20
score: 73.1
NoneNo IPR availableGENE3DG3DSA:1.20.5.930coord: 1088..1133
e-value: 5.2E-14
score: 53.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.1530coord: 839..1071
e-value: 7.8E-25
score: 89.7
NoneNo IPR availablePANTHERPTHR23220INTEGRIN ALPHAcoord: 43..1132
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.707
NoneNo IPR availableSUPERFAMILYSSF69318Integrin alpha N-terminal domaincoord: 65..497
NoneNo IPR availableTMHMMTMhelixcoord: 1093..1115
IPR013517FG-GAP repeatPFAMPF01839FG-GAPcoord: 317..359
e-value: 7.9E-8
score: 32.3
IPR028994Integrin alpha, N-terminalGENE3DG3DSA:2.130.10.130coord: 36..500
e-value: 4.1E-77
score: 262.0
IPR018184Integrin alpha chain, C-terminal cytoplasmic region, conserved sitePROSITEPS00242INTEGRIN_ALPHAcoord: 1115..1122
IPR032695Integrin domain superfamilySUPERFAMILYSSF69179Integrin domainscoord: 855..1095
IPR032695Integrin domain superfamilySUPERFAMILYSSF69179Integrin domainscoord: 672..776