Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30017872
Length (bp)1153
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30017872) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30017872) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30017872) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30017872) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017872

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017872 dd_Smed_v4_9437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 58.151 bits (139), Expect = 9.120e-15
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP    +SE  ++F+ ++  +  QR +A +LL   F
Sbjct:  531 KLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIFVEARQRPSAEELLTHHF 648          

HSP 2 Score: 41.5874 bits (96), Expect = 9.120e-15
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TE++ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  476 GSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIK 518          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 58.151 bits (139), Expect = 9.269e-15
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP    +SE  ++F+ ++  +  QR +A +LL   F
Sbjct:  535 KLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIFVEARQRPSAEELLTHHF 652          

HSP 2 Score: 41.5874 bits (96), Expect = 9.269e-15
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TE++ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  480 GSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIK 522          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 58.151 bits (139), Expect = 9.269e-15
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP    +SE  ++F+ ++  +  QR +A +LL   F
Sbjct:  535 KLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIFVEARQRPSAEELLTHHF 652          

HSP 2 Score: 41.5874 bits (96), Expect = 9.269e-15
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TE++ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  480 GSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIK 522          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 58.151 bits (139), Expect = 9.511e-15
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP    +SE  ++F+ ++  +  QR +A +LL   F
Sbjct:  504 KLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIFVEARQRPSAEELLTHHF 621          

HSP 2 Score: 41.5874 bits (96), Expect = 9.511e-15
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TE++ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  449 GSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIK 491          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 58.151 bits (139), Expect = 9.990e-15
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP    +SE  ++F+ ++  +  QR +A +LL   F
Sbjct:  500 KLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIFVEARQRPSAEELLTHHF 617          

HSP 2 Score: 41.5874 bits (96), Expect = 9.990e-15
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TE++ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  445 GSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIK 487          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 56.6102 bits (135), Expect = 1.494e-11
Identity = 41/125 (32.80%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLD--QDQRSTAVQLLKLKFF 1114
            KL DFG C  L     +  K    +GTP   +PEV +T  +  P     D+ SLG   I M+   P Y + +       I+T  K D P   SM+   K+F+D  L+   + R +A QLL   F 
Sbjct:  380 KLTDFGFCAQL---SPEQRKRTTMVGTPYWMAPEV-VTRKQYGP---KVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL 497          

HSP 2 Score: 31.187 bits (69), Expect = 1.494e-11
Identity = 17/45 (37.78%), Postives = 26/45 (57.78%), Query Frame = 1
Query:  529 AHGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            A GSL D +   + +    I    +++L+ +EFLH   +IHRDIK
Sbjct:  324 AGGSLTDVVTECQ-MEDGIIAAVCREVLQALEFLHSRHVIHRDIK 367          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 56.6102 bits (135), Expect = 1.768e-11
Identity = 41/125 (32.80%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLD--QDQRSTAVQLLKLKFF 1114
            KL DFG C  L     +  K    +GTP   +PEV +T  +  P     D+ SLG   I M+   P Y + +       I+T  K D P   SM+   K+F+D  L+   + R +A QLL   F 
Sbjct:  426 KLTDFGFCAQL---SPEQRKRTTMVGTPYWMAPEV-VTRKQYGP---KVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL 543          

HSP 2 Score: 31.187 bits (69), Expect = 1.768e-11
Identity = 12/26 (46.15%), Postives = 18/26 (69.23%), Query Frame = 1
Query:  586 IIRYSKQILEGVEFLHGYSIIHRDIK 663
            I    +++L+ +EFLH   +IHRDIK
Sbjct:  388 IAAVCREVLQALEFLHSRHVIHRDIK 413          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 56.6102 bits (135), Expect = 1.796e-11
Identity = 41/125 (32.80%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLD--QDQRSTAVQLLKLKFF 1114
            KL DFG C  L     +  K    +GTP   +PEV +T  +  P     D+ SLG   I M+   P Y + +       I+T  K D P   SM+   K+F+D  L+   + R +A QLL   F 
Sbjct:  429 KLTDFGFCAQL---SPEQRKRTTMVGTPYWMAPEV-VTRKQYGP---KVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFL 546          

HSP 2 Score: 31.187 bits (69), Expect = 1.796e-11
Identity = 17/45 (37.78%), Postives = 26/45 (57.78%), Query Frame = 1
Query:  529 AHGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            A GSL D +   + +    I    +++L+ +EFLH   +IHRDIK
Sbjct:  373 AGGSLTDVVTECQ-MEDGIIAAVCREVLQALEFLHSRHVIHRDIK 416          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-2 (Caenorhabditis STE20-like kinase [Source:UniProtKB/TrEMBL;Acc:Q304D8])

HSP 1 Score: 51.6026 bits (122), Expect = 3.097e-10
Identity = 42/126 (33.33%), Postives = 52/126 (41.27%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEV--SLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKF 1111
            KL DFG+   L  T  K    I   GTP   +PEV   +  D        ADI SLG T I M   RP Y D H       I T         +  S E  +FI   L    ++R TA++L +  F
Sbjct:  169 KLADFGVAGQLTDTMAKRNTVI---GTPFWMAPEVIEEIGYD------TKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTF 285          

HSP 2 Score: 31.5722 bits (70), Expect = 3.097e-10
Identity = 18/48 (37.50%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  523 CAAHGSLEDEIE-RKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            C A GS+ D +  R++ L+ + I    +  L+G+++LH    IHRDIK
Sbjct:  110 CGA-GSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIK 156          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 51.2174 bits (121), Expect = 4.585e-10
Identity = 42/126 (33.33%), Postives = 52/126 (41.27%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEV--SLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKF 1111
            KL DFG+   L  T  K    I   GTP   +PEV   +  D        ADI SLG T I M   RP Y D H       I T         +  S E  +FI   L    ++R TA++L +  F
Sbjct:  169 KLADFGVAGQLTDTMAKRNTVI---GTPFWMAPEVIEEIGYD------TKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTF 285          

HSP 2 Score: 31.5722 bits (70), Expect = 4.585e-10
Identity = 18/48 (37.50%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  523 CAAHGSLEDEIE-RKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            C A GS+ D +  R++ L+ + I    +  L+G+++LH    IHRDIK
Sbjct:  110 CGA-GSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIK 156          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334540)

HSP 1 Score: 53.9138 bits (128), Expect = 2.290e-11
Identity = 36/125 (28.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFF 1114
            KL DFG C  +     + +K    +GTP   +PEV      G       D+ SLG   I M+   P Y + +       I+T  K ++ +   +S   ++F+D+ L  + D+R++A+ LLK  F 
Sbjct:  700 KLTDFGFCAQI---SPEQSKRTTMVGTPYWMAPEVVTRKQYGP----KVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 817          

HSP 2 Score: 33.8834 bits (76), Expect = 2.290e-11
Identity = 16/43 (37.21%), Postives = 25/43 (58.14%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSL D +  +  +    I    +++L+ +EFLH   +IHRDIK
Sbjct:  646 GSLTDVV-TETCMDEGQIAAVCREVLQALEFLHANQVIHRDIK 687          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334542)

HSP 1 Score: 53.9138 bits (128), Expect = 2.290e-11
Identity = 36/125 (28.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFF 1114
            KL DFG C  +     + +K    +GTP   +PEV      G       D+ SLG   I M+   P Y + +       I+T  K ++ +   +S   ++F+D+ L  + D+R++A+ LLK  F 
Sbjct:  700 KLTDFGFCAQI---SPEQSKRTTMVGTPYWMAPEVVTRKQYGP----KVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 817          

HSP 2 Score: 33.8834 bits (76), Expect = 2.290e-11
Identity = 16/43 (37.21%), Postives = 25/43 (58.14%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSL D +  +  +    I    +++L+ +EFLH   +IHRDIK
Sbjct:  646 GSLTDVV-TETCMDEGQIAAVCREVLQALEFLHANQVIHRDIK 687          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334543)

HSP 1 Score: 53.9138 bits (128), Expect = 2.290e-11
Identity = 36/125 (28.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFF 1114
            KL DFG C  +     + +K    +GTP   +PEV      G       D+ SLG   I M+   P Y + +       I+T  K ++ +   +S   ++F+D+ L  + D+R++A+ LLK  F 
Sbjct:  700 KLTDFGFCAQI---SPEQSKRTTMVGTPYWMAPEVVTRKQYGP----KVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 817          

HSP 2 Score: 33.8834 bits (76), Expect = 2.290e-11
Identity = 16/43 (37.21%), Postives = 25/43 (58.14%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSL D +  +  +    I    +++L+ +EFLH   +IHRDIK
Sbjct:  646 GSLTDVV-TETCMDEGQIAAVCREVLQALEFLHANQVIHRDIK 687          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334541)

HSP 1 Score: 53.9138 bits (128), Expect = 2.290e-11
Identity = 36/125 (28.80%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFF 1114
            KL DFG C  +     + +K    +GTP   +PEV      G       D+ SLG   I M+   P Y + +       I+T  K ++ +   +S   ++F+D+ L  + D+R++A+ LLK  F 
Sbjct:  700 KLTDFGFCAQI---SPEQSKRTTMVGTPYWMAPEVVTRKQYGP----KVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 817          

HSP 2 Score: 33.8834 bits (76), Expect = 2.290e-11
Identity = 16/43 (37.21%), Postives = 25/43 (58.14%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSL D +  +  +    I    +++L+ +EFLH   +IHRDIK
Sbjct:  646 GSLTDVV-TETCMDEGQIAAVCREVLQALEFLHANQVIHRDIK 687          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 53.9138 bits (128), Expect = 2.457e-11
Identity = 37/125 (29.60%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFF 1114
            KL DFG C  +     + +K    +GTP   +PEV +T  +  P     D+ SLG   I M+   P Y + +       I+T  K ++ +   +S   ++F+D+ L  + D+R++A+ LLK  F 
Sbjct:  564 KLTDFGFCAQI---SPEQSKRTTMVGTPYWMAPEV-VTRKQYGP---KVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFL 681          

HSP 2 Score: 33.4982 bits (75), Expect = 2.457e-11
Identity = 16/43 (37.21%), Postives = 25/43 (58.14%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSL D +  +  +    I    +++L+ +EFLH   +IHRDIK
Sbjct:  510 GSLTDVV-TETCMDEGQIAAVCREVLQALEFLHANQVIHRDIK 551          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 56.225 bits (134), Expect = 2.689e-15
Identity = 42/124 (33.87%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  R L   C   T   +  GTP   SPEV      G      ADI S+G TV+ M+T RP + ++   A   KI+T      LP    +S+  ++F+ ++  +  QR  A  LL+  F
Sbjct:  504 KLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGR----KADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPTLP--PHVSDHCRDFLKRIFVETKQRPAAEDLLRHTF 621          

HSP 2 Score: 44.669 bits (104), Expect = 2.689e-15
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  439 LSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIK 491          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 56.6102 bits (135), Expect = 2.756e-15
Identity = 42/124 (33.87%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  R L   C   T   +  GTP   SPEV      G      ADI S+G TV+ M+T RP + ++   A   KI+T      LP    +S+  ++F+ ++  +  QR  A  LL+  F
Sbjct:  496 KLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGR----KADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPTLP--PHVSDHCRDFLKRIFVETKQRPAAEDLLRHTF 613          

HSP 2 Score: 44.669 bits (104), Expect = 2.756e-15
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  431 LSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIK 483          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 53.9138 bits (128), Expect = 2.696e-14
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + ++   A   KI+T      LP    +SE  ++F+  +  +   R +A +LL+  F
Sbjct:  486 KLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPS--HISEHTRDFLRCIFVEAKYRPSAEELLRHPF 603          

HSP 2 Score: 43.8986 bits (102), Expect = 2.696e-14
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  431 GSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIK 473          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 53.9138 bits (128), Expect = 2.830e-14
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + ++   A   KI+T      LP    +SE  ++F+  +  +   R +A +LL+  F
Sbjct:  498 KLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPS--HISEHTRDFLRCIFVEAKYRPSAEELLRHPF 615          

HSP 2 Score: 43.8986 bits (102), Expect = 2.830e-14
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  443 GSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIK 485          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 53.9138 bits (128), Expect = 2.995e-14
Identity = 40/124 (32.26%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + ++   A   KI+T      LP    +SE  ++F+  +  +   R +A +LL+  F
Sbjct:  504 KLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPS--HISEHTRDFLRCIFVEAKYRPSAEELLRHPF 621          

HSP 2 Score: 43.8986 bits (102), Expect = 2.995e-14
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  449 GSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIK 491          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 61.2326 bits (147), Expect = 1.515e-16
Identity = 43/124 (34.68%), Postives = 63/124 (50.81%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP   + SE+ ++F+ ++L +  QR TA +L++  F
Sbjct:  507 KLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPP--NTSEQCRDFVKRILVEARQRPTAEELIRHPF 624          

HSP 2 Score: 45.0542 bits (105), Expect = 1.515e-16
Identity = 23/44 (52.27%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  452 GSVKDQLKAYGAL-TENVTRRYTRQILEGVSYLHSNMIVHRDIK 494          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 61.2326 bits (147), Expect = 1.619e-16
Identity = 43/124 (34.68%), Postives = 63/124 (50.81%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP   + SE+ ++F+ ++L +  QR TA +L++  F
Sbjct:  489 KLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPP--NTSEQCRDFVKRILVEARQRPTAEELIRHPF 606          

HSP 2 Score: 44.669 bits (104), Expect = 1.619e-16
Identity = 23/44 (52.27%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  434 GSVKDQLKAYGAL-TENVTRRYTRQILEGVSYLHSNMIVHRDIK 476          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 56.225 bits (134), Expect = 7.852e-16
Identity = 40/124 (32.26%), Postives = 64/124 (51.61%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + +   C   T   +  GTP   SPEV      G      AD+ S+  TV+ M+T +P + +Y   A   KI+T   K  LPD  ++S+  ++F+ ++  ++ +R TA +LL+  F
Sbjct:  496 KLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVISGEGYGR----KADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPTKPRLPD--TVSDACRDFMKQIFVEEKRRPTAEELLRHLF 613          

HSP 2 Score: 47.3654 bits (111), Expect = 7.852e-16
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TEN+ R Y++QIL+GV +LHG  I+HRDIK
Sbjct:  431 LSIFVEYMPGGSIKDQLKAYGAL-TENVTRRYTRQILQGVSYLHGNMIVHRDIK 483          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 56.225 bits (134), Expect = 8.313e-16
Identity = 40/124 (32.26%), Postives = 64/124 (51.61%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + +   C   T   +  GTP   SPEV      G      AD+ S+  TV+ M+T +P + +Y   A   KI+T   K  LPD  ++S+  ++F+ ++  ++ +R TA +LL+  F
Sbjct:  503 KLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVISGEGYGR----KADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPTKPRLPD--TVSDACRDFMKQIFVEEKRRPTAEELLRHLF 620          

HSP 2 Score: 47.3654 bits (111), Expect = 8.313e-16
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TEN+ R Y++QIL+GV +LHG  I+HRDIK
Sbjct:  438 LSIFVEYMPGGSIKDQLKAYGAL-TENVTRRYTRQILQGVSYLHGNMIVHRDIK 490          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 52.373 bits (124), Expect = 5.202e-13
Identity = 39/124 (31.45%), Postives = 61/124 (49.19%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKMLDQDQ-RSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      ADI S+G TV+ M+T +P + ++   A   KI+T      LP    +SE  ++F+ ++  + + R ++ +LL+  F
Sbjct:  481 KLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR----KADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLP--AHVSEHCRDFLKRIFVEAKVRPSSEELLRHTF 598          

HSP 2 Score: 41.9726 bits (97), Expect = 5.202e-13
Identity = 24/54 (44.44%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TE + R Y++QILEGV +LH   I+HRDIK
Sbjct:  416 LSIFMEYMPGGSIKDQLKAYGAL-TEFVTRKYTRQILEGVHYLHSNMIVHRDIK 468          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 58.151 bits (139), Expect = 8.251e-15
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP    +SE  ++F+ ++  +  QR +A +LL   F
Sbjct:  504 KLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIFVEARQRPSAEELLTHHF 621          

HSP 2 Score: 41.5874 bits (96), Expect = 8.251e-15
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TE++ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  449 GSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIK 491          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 48.1358 bits (113), Expect = 3.474e-13
Identity = 38/124 (30.65%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKMLDQDQ-RSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      ADI S+  TV+ M+T +P + ++   A   KI+T      LP    +S+  ++F+ ++  + + R +A +LL+  F
Sbjct:  498 KLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR----KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLP--PHVSDYTRDFLKRIFVEAKLRPSAEELLRHMF 615          

HSP 2 Score: 45.8246 bits (107), Expect = 3.474e-13
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  433 LSIFMEYMPGGSIKDQLKAYGAL-TENVTRKYTRQILEGVHYLHSNMIVHRDIK 485          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk10 (serine/threonine kinase 10 [Source:MGI Symbol;Acc:MGI:1099439])

HSP 1 Score: 55.4546 bits (132), Expect = 3.959e-12
Identity = 43/125 (34.40%), Postives = 65/125 (52.00%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSL-TSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQ--DQRSTAVQLLKLKF 1111
            +L DFG+    L+T   + K  + IGTP   +PEV L  + K AP    ADI SLG T+I M    P +++ +   V +KI+ +    L      S E ++F+   LD+  + R +A QLL+  F
Sbjct:  172 RLADFGVSAKNLKT---LQKRDSFIGTPYWMAPEVVLCETMKDAPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLQHPF 293          

HSP 2 Score: 35.039 bits (79), Expect = 3.959e-12
Identity = 17/37 (45.95%), Postives = 22/37 (59.46%), Query Frame = 1
Query:  553 IERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            +E  R L    I    +Q+LE + FLHG  IIHRD+K
Sbjct:  123 LELDRGLTEPQIQVVCRQMLEALNFLHGKRIIHRDLK 159          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 54.299 bits (129), Expect = 1.227e-11
Identity = 43/124 (34.68%), Postives = 55/124 (44.35%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKF 1111
            KL DFG+   L  T  K    I   GTP   +PEV    + G      ADI SLG T I M   +P Y D H       I T         +  S++  +F+ K L    +QR+TA QLL+  F
Sbjct:   91 KLADFGVAGQLTDTMAKRNTVI---GTPFWMAPEV--IQEIGY--NCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPF 207          

HSP 2 Score: 34.6538 bits (78), Expect = 1.227e-11
Identity = 21/57 (36.84%), Postives = 29/57 (50.88%), Query Frame = 1
Query:  496 NANLSVSTSCAAHGSLEDEIE-RKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            N +L +       GS+ D I  R + L  + I    K  L+G+E+LH    IHRDIK
Sbjct:   22 NTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIK 78          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 53.9138 bits (128), Expect = 1.664e-11
Identity = 43/124 (34.68%), Postives = 55/124 (44.35%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKF 1111
            KL DFG+   L  T  K    I   GTP   +PEV    + G      ADI SLG T I M   +P Y D H       I T         +  S++  +F+ K L    +QR+TA QLL+  F
Sbjct:  161 KLADFGVAGQLTDTMAKRNTVI---GTPFWMAPEV--IQEIGY--NCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPF 277          

HSP 2 Score: 34.6538 bits (78), Expect = 1.664e-11
Identity = 21/57 (36.84%), Postives = 29/57 (50.88%), Query Frame = 1
Query:  496 NANLSVSTSCAAHGSLEDEIE-RKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            N +L +       GS+ D I  R + L  + I    K  L+G+E+LH    IHRDIK
Sbjct:   92 NTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIK 148          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 4.106e-14
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP    +SE  ++F+ ++  +  QR +A +LL   F
Sbjct:  504 KLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIFVEARQRPSAEELLTHHF 621          

HSP 2 Score: 41.5874 bits (96), Expect = 4.106e-14
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TE++ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  449 GSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIK 491          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 4.915e-14
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T      LP    +SE  ++F+ ++  +  QR +A +LL   F
Sbjct:  504 KLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPS--HISEHGRDFLRRIFVEARQRPSAEELLTHHF 621          

HSP 2 Score: 41.5874 bits (96), Expect = 4.915e-14
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TE++ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  449 GSVKDQLKAYGAL-TESVTRKYTRQILEGMSYLHSNMIVHRDIK 491          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61083|M3K2_MOUSE (Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus OX=10090 GN=Map3k2 PE=1 SV=2)

HSP 1 Score: 48.521 bits (114), Expect = 8.296e-13
Identity = 38/124 (30.65%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKMLDQDQ-RSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      ADI S+  TV+ M+T +P + ++   A   KI+T      LP    +S+  ++F+ ++  + + R +A +LL+  F
Sbjct:  498 KLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR----KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLP--PHVSDYTRDFLKRIFVEAKLRPSAEELLRHMF 615          

HSP 2 Score: 46.9802 bits (110), Expect = 8.296e-13
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+    +  GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  433 LSIFMELSPGGSIKDQLKAYGAL-TENVTRKYTRQILEGVHYLHSNMIVHRDIK 485          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O22042|M3K3_ARATH (Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.117e-12
Identity = 42/125 (33.60%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYD-YHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQDQ--RSTAVQLLKLKF 1111
            +L DFG  + ++     V  A +  GTP   +PEV L +      + SADI S+G TVI M T +P + + Y   A  + I  TK    P  + +S E K+F+ K L ++   R +A +LL+  F
Sbjct:  211 RLADFGASKKVVELA-TVNGAKSMKGTPYWMAPEVILQTGH----SFSADIWSVGCTVIEMATGKPPWSEQYQQFAAVLHIGRTKA-HPPIPEDLSPEAKDFLMKCLHKEPSLRLSATELLQHPF 329          

HSP 2 Score: 40.4318 bits (93), Expect = 2.117e-12
Identity = 19/43 (44.19%), Postives = 27/43 (62.79%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GS+   +E+        II Y+KQ+L G+E+LH   I+HRDIK
Sbjct:  156 GSISSLLEKFGSFPEPVIIMYTKQLLLGLEYLHNNGIMHRDIK 198          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2U5|M3K2_HUMAN (Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2)

HSP 1 Score: 47.7506 bits (112), Expect = 2.915e-12
Identity = 38/124 (30.65%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKMLDQDQ-RSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      ADI S+  TV+ M+T +P + ++   A   KI+T      LP    +S+  ++F+ ++  + + R +A +LL+  F
Sbjct:  498 KLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR----KADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLP--PHVSDYTRDFLKRIFVEAKLRPSADELLRHMF 615          

HSP 2 Score: 45.8246 bits (107), Expect = 2.915e-12
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  433 LSIFMEYMPGGSIKDQLKAYGAL-TENVTRKYTRQILEGVHYLHSNMIVHRDIK 485          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1W3JF44 (mitogen-activated protein kinase kinase kinase 2-like OS=Ciona intestinalis OX=7719 GN=LOC100174992 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.588e-15
Identity = 44/125 (35.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKIST-TKKLDLPDSQSMSEEMKEFID-KMLDQDQRSTAVQLLKLKFF 1114
            KL DFG  + L        + +  +GTP   SPEV      G      ADI SL  TV+ M+T RP +Y++   A   KI T T    LP   ++S+E K+F+    +D++QR  A  L+  K+F
Sbjct:  513 KLGDFGAAKKLQTIVTSSGQTV--VGTPYWMSPEVIEGRGYGR----RADIWSLACTVVEMLTTRPPWYEFEAMAALFKIVTQTTSPQLPP--NVSQEAKDFLGVAFVDKEQRPYAADLMSHKWF 629          

HSP 2 Score: 49.6766 bits (117), Expect = 2.588e-15
Identity = 25/60 (41.67%), Postives = 38/60 (63.33%), Query Frame = 1
Query:  487 CV*NAN-LSVSTSCAAHGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            C   +N LS+     + GS++DEI+    L      +Y++QILEG+ +LHG+ I+HRDIK
Sbjct:  441 CTEESNTLSIFMELMSGGSVKDEIKAYGALTEPVTCKYARQILEGLIYLHGFQIVHRDIK 500          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: F6VUQ3 (Protein kinase domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 5.980e-15
Identity = 45/126 (35.71%), Postives = 63/126 (50.00%), Query Frame = 2
Query:  746 KLVDFGICRSLLR-TCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKIST-TKKLDLPDSQSMSEEMKEFID-KMLDQDQRSTAVQLLKLKFF 1114
            KL DFG  + L       V +   + GTP   SPEV      G      ADI SL  TV+ M+T RP +Y++   A   KI T T    LP   ++S+E K+F+    +D++QR  A  L+  K+F
Sbjct:  476 KLGDFGAAKKLQTIVTSSVIQNYFTPGTPYWMSPEVIEGRGYGR----RADIWSLACTVVEMLTTRPPWYEFEAMAALFKIVTQTTSPQLPP--NVSQEAKDFLGVAFVDKEQRPYAADLMSHKWF 595          

HSP 2 Score: 49.6766 bits (117), Expect = 5.980e-15
Identity = 25/60 (41.67%), Postives = 38/60 (63.33%), Query Frame = 1
Query:  487 CV*NAN-LSVSTSCAAHGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            C   +N LS+     + GS++DEI+    L      +Y++QILEG+ +LHG+ I+HRDIK
Sbjct:  404 CTEESNTLSIFMELMSGGSVKDEIKAYGALTEPVTCKYARQILEGLIYLHGFQIVHRDIK 463          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: F6XR36 (Protein kinase domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 9.380e-15
Identity = 45/126 (35.71%), Postives = 63/126 (50.00%), Query Frame = 2
Query:  746 KLVDFGICRSLLR-TCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKIST-TKKLDLPDSQSMSEEMKEFID-KMLDQDQRSTAVQLLKLKFF 1114
            KL DFG  + L       V +   + GTP   SPEV      G      ADI SL  TV+ M+T RP +Y++   A   KI T T    LP   ++S+E K+F+    +D++QR  A  L+  K+F
Sbjct:  491 KLGDFGAAKKLQTIVTSSVIQNYFTPGTPYWMSPEVIEGRGYGR----RADIWSLACTVVEMLTTRPPWYEFEAMAALFKIVTQTTSPQLPP--NVSQEAKDFLGVAFVDKEQRPYAADLMSHKWF 610          

HSP 2 Score: 49.6766 bits (117), Expect = 9.380e-15
Identity = 25/60 (41.67%), Postives = 38/60 (63.33%), Query Frame = 1
Query:  487 CV*NAN-LSVSTSCAAHGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            C   +N LS+     + GS++DEI+    L      +Y++QILEG+ +LHG+ I+HRDIK
Sbjct:  419 CTEESNTLSIFMELMSGGSVKDEIKAYGALTEPVTCKYARQILEGLIYLHGFQIVHRDIK 478          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A250WS04 (Protein kinase domain-containing protein OS=Chlamydomonas eustigma OX=1157962 GN=CEUSTIGMA_g1088.t1 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 6.220e-14
Identity = 45/131 (34.35%), Postives = 64/131 (48.85%), Query Frame = 2
Query:  746 KLVDFGICRSL--LRTCGKVTKAINSI-GTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLD-LPDSQSMSEEMKEFIDKMLDQ--DQRSTAVQLLKLKFFCE 1120
            KL DFG  + +  L T G       SI GTP   +PEV   +  G P    ADI SLG  VI M T RP + DY   A    I++T  +  LP  + MS + ++F+ +  ++    R  A +LLK  +  +
Sbjct:  289 KLADFGASKKIEDLATMGSAGSGAKSIRGTPYWMAPEVIKQTGHGRP----ADIWSLGCVVIEMATGRPPWSDYSPVAAMWHIASTGDMPTLPTLEIMSSQARDFLLQCFNRIPKDRPNATRLLKHPWLAD 415          

HSP 2 Score: 43.8986 bits (102), Expect = 6.220e-14
Identity = 23/46 (50.00%), Postives = 33/46 (71.74%), Query Frame = 1
Query:  529 AHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            A GS+   I++   L  EN++R Y+KQIL+G+E+LH   I+HRDIK
Sbjct:  232 AGGSIASLIDKFGPL-QENVVRVYTKQILKGLEYLHQRKIMHRDIK 276          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1A8JZC7 (Protein kinase domain-containing protein (Fragment) OS=Nothobranchius kuhntae OX=321403 GN=MAP3K2 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 6.295e-14
Identity = 41/123 (33.33%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  R L   C   T   +  GTP   SPEV      G      ADI S+G TV+ M+T RP + ++   A   KI+T     +  +  +S+  +EF+ ++  +  QR +A +LL+  F
Sbjct:  195 KLGDFGASRRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYGR----KADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPVLPAH-VSDHCREFLKRIFVEAKQRPSADELLRHIF 312          

HSP 2 Score: 48.521 bits (114), Expect = 6.295e-14
Identity = 26/55 (47.27%), Postives = 37/55 (67.27%), Query Frame = 1
Query:  502 NLSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
             LS+       GS++D+++    L TEN+ R Y++QILEGV +LHG  I+HRDIK
Sbjct:  129 TLSIFMEHMPGGSIKDQLKSYGAL-TENVTRRYTRQILEGVSYLHGNMIVHRDIK 182          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 59.6918 bits (143), Expect = 4.030e-16
Identity = 41/123 (33.33%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T     +  S + SE+ ++FI ++  +   R +A +LL+  F
Sbjct:  498 KLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHT-SEQTRDFIRRIFVEAKHRPSAEELLRHPF 615          

HSP 2 Score: 43.8986 bits (102), Expect = 4.030e-16
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  443 GSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIK 485          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 59.6918 bits (143), Expect = 4.030e-16
Identity = 41/123 (33.33%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T     +  S + SE+ ++FI ++  +   R +A +LL+  F
Sbjct:  498 KLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHT-SEQTRDFIRRIFVEAKHRPSAEELLRHPF 615          

HSP 2 Score: 43.8986 bits (102), Expect = 4.030e-16
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  443 GSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIK 485          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 59.6918 bits (143), Expect = 4.030e-16
Identity = 41/123 (33.33%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T     +  S + SE+ ++FI ++  +   R +A +LL+  F
Sbjct:  498 KLGDFGASKRLQTICMSSTGVRSVTGTPYWMSPEVISGDGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHT-SEQTRDFIRRIFVEAKHRPSAEELLRHPF 615          

HSP 2 Score: 43.8986 bits (102), Expect = 4.030e-16
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  443 GSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIK 485          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 54.6842 bits (130), Expect = 7.052e-15
Identity = 42/124 (33.87%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  R L   C   T   +  GTP   SPEV      G      ADI S+G TV+ M+T RP + ++   A   KI+T      LP    +S+  ++F+ ++  +  QR  A +LL+  F
Sbjct:  501 KLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGR----KADIWSVGCTVVEMLTLRPPWAEFEAMAAIFKIATQPTNPALP--AHVSDHCRDFLKRIFVETKQRPAAEELLRHIF 618          

HSP 2 Score: 44.669 bits (104), Expect = 7.052e-15
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  436 LSIFMEYMPGGSIKDQLKSYGAL-TENVTRKYTRQILEGVCYLHSNMIVHRDIK 488          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 52.373 bits (124), Expect = 1.849e-13
Identity = 39/124 (31.45%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + +   C   T      GTP   SPEV      G      AD+ S+  TV+ M+T +P + +Y   A   KI+T   K +LP+   +S+  ++F+ ++  ++  R TA  LL   F
Sbjct:  499 KLGDFGASKRIQTICMSGTGIKTVTGTPYWMSPEVINGEGYGR----KADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPNLPE--GVSDACRDFLRQVFVEEKWRPTAEGLLSHPF 616          

HSP 2 Score: 42.743 bits (99), Expect = 1.849e-13
Identity = 21/53 (39.62%), Postives = 33/53 (62.26%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L  +   RY++QIL+GV +LH   I+HRDIK
Sbjct:  434 LSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIK 486          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 52.7582 bits (125), Expect = 1.767e-16
Identity = 40/126 (31.75%), Postives = 60/126 (47.62%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTT---KKLDLPDSQSMSEEMKE-FIDKMLDQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C + T   +  GTP   SPEV      G      ADI S+G TV+ M+T +P + ++   A   KI+T     +L L  S+   + ++  F++  L    R +A  LL+  F
Sbjct:  501 KLGDFGASKRLQTICSQGTAMRSVTGTPYWMSPEVINGEGYGR----KADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTDPRLPLHASEHARDLLRRIFVEAKL----RPSAEDLLRHPF 618          

HSP 2 Score: 50.0618 bits (118), Expect = 1.767e-16
Identity = 27/54 (50.00%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D++ R     TEN+ R Y++QILEGV FLHG  I+HRDIK
Sbjct:  436 LSIFMEYMPGGSIKDQL-RAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIK 488          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 54.299 bits (129), Expect = 1.788e-12
Identity = 43/130 (33.08%), Postives = 63/130 (48.46%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSL-TSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQ--DQRSTAVQLLKLKFFCEFD 1126
            KL DFG+     RT   + +  + IGTP   +PEV +  + K AP    ADI SLG T+I +    P  ++ +   V +KI+      L      S E  +F+ K LD+  + R  A+QLL+  F    D
Sbjct:  169 KLADFGVSAKNTRT---LQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFISGVD 295          

HSP 2 Score: 34.6538 bits (78), Expect = 1.788e-12
Identity = 17/37 (45.95%), Postives = 24/37 (64.86%), Query Frame = 1
Query:  553 IERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            +E +R LA   I    KQ+LE + +LH + IIHRD+K
Sbjct:  120 LELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLK 156          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 55.0694 bits (131), Expect = 5.016e-12
Identity = 38/125 (30.40%), Postives = 61/125 (48.80%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQDQ--RSTAVQLLKLKFF 1114
            KL DFG C  + +   +VT+  + +GTP   +PEV      G       D+ SLG  VI M+   P Y++        +I       + + Q  S  ++ F+D+ML +D   R+TA++LL+  F 
Sbjct:  553 KLSDFGFCAQVSK---EVTRRKSLVGTPYWMAPEVISRLPYGP----EVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFL 670          

HSP 2 Score: 32.3426 bits (72), Expect = 5.016e-12
Identity = 16/43 (37.21%), Postives = 23/43 (53.49%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            G+L D +   R +  E I      +L  + +LHG  +IHRDIK
Sbjct:  499 GALTDIVTHTR-MNEEQIATVCVSVLRALAYLHGQGVIHRDIK 540          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008103.1 (pep scaffold:Pmarinus_7.0:GL476484:390774:392599:-1 gene:ENSPMAG00000007328.1 transcript:ENSPMAT00000008103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.634e-11
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQD--QRSTAVQLLKLKFF 1114
            KL DFG C  + +   +VT+  + +GTP   +PEV      G       DI SLG  V+ M+   P Y++        +I       + +SQ  + +++ F+D+ML +D  QR++AV+LL   F 
Sbjct:    3 KLSDFGFCAQVSK---EVTRRKSLVGTPYWMAPEVISRLPYGP----EVDIWSLGVMVMEMVDGEPPYFNEPPLQAMRRIRDNIPPKIKNSQGTTVQLRSFLDRMLVRDPTQRASAVELLGHPFL 120          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 48.1358 bits (113), Expect = 3.538e-9
Identity = 37/129 (28.68%), Postives = 60/129 (46.51%), Query Frame = 2
Query:  746 KLVDFGICR--SLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQD--QRSTAVQLLKLKFFCE 1120
            KL+DFG  +  +L  +C +     +  GT    +PEV      G      AD+ SLG T+  M   RP + D    A  + I     +     Q+ S+E +EF+++   +D  +R ++ +LL   F CE
Sbjct:  161 KLIDFGCAQRVALALSCHENGGLHSVHGTAYWMAPEVI----NGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELLSHPFICE 285          

HSP 2 Score: 29.6462 bits (65), Expect = 3.538e-9
Identity = 11/29 (37.93%), Postives = 20/29 (68.97%), Query Frame = 1
Query:  580 ENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            E++ R Y  Q+  G+ +LHG+ ++H D+K
Sbjct:  120 ESVCRSYIAQMTRGLAYLHGHGVMHGDVK 148          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 50.447 bits (119), Expect = 4.367e-12
Identity = 44/121 (36.36%), Postives = 65/121 (53.72%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQD--QRSTAVQLLK 1102
            KL DFG+  S +     +T A    GT N  +PE+    ++GA  +  +DI SLGATV+ M+T  P Y++  L   +I  +       P S S SE +K+F+ K   ++  +R TA QLLK
Sbjct:  161 KLADFGV--STIVNSSALTLA----GTLNWMAPEI--LGNRGA--STLSDIWSLGATVVEMLTKNPPYHN--LTDANIYYAVENDTYYPPS-SFSEPLKDFLSKCFVKNMYKRPTADQLLK 268          

HSP 2 Score: 36.5798 bits (83), Expect = 4.367e-12
Identity = 21/47 (44.68%), Postives = 28/47 (59.57%), Query Frame = 1
Query:  526 AAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
             A+GSL   I R     +EN  + Y  Q L G+++LHG  +IHRDIK
Sbjct:  102 CANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIK 148          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 50.0618 bits (118), Expect = 1.484e-10
Identity = 38/128 (29.69%), Postives = 59/128 (46.09%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFFCEF 1123
            KL DFG C  +     K T  +   GTP   +PEV    + G       DI SLG  +I MI   P Y +         I+T     L + +++S  +K+F+D  L  + + R++A +LL  ++  E 
Sbjct:  754 KLTDFGFCAQINELNLKRTTMV---GTPYWMAPEVVSRKEYGP----KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEI 874          

HSP 2 Score: 31.9574 bits (71), Expect = 1.484e-10
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  601 KQILEGVEFLHGYSIIHRDIK 663
            ++ L G+EFLH   ++HRDIK
Sbjct:  721 RETLSGLEFLHSKGVLHRDIK 741          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 44.2838 bits (103), Expect = 3.743e-10
Identity = 39/121 (32.23%), Postives = 54/121 (44.63%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKM--LDQDQRSTAVQLLK 1102
            K+ DFGI + L     K  K  +  G+    SPEV     K    T  ADI S G  VI M T +  + D+       KI T    ++P     + E K F+ K   LD   R +A++LL+
Sbjct:  594 KITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVV----KQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIP--SWATSEGKNFLRKAFELDYQYRPSALELLQ 708          

HSP 2 Score: 36.5798 bits (83), Expect = 3.743e-10
Identity = 20/52 (38.46%), Postives = 29/52 (55.77%), Query Frame = 1
Query:  508 SVSTSCAAHGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            SVS+    +G  E+ +          I  +++QIL GV +LH  +IIHRDIK
Sbjct:  540 SVSSMLNNYGPFEESL----------ITNFTRQILIGVAYLHKKNIIHRDIK 581          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 46.9802 bits (110), Expect = 1.867e-9
Identity = 37/125 (29.60%), Postives = 59/125 (47.20%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFF 1114
            K+ DFG C  L     K +K    +GTP   +PE+   + KG    V  D+ SLG  +I MI   P Y +         I+      L   +S+S++ K+F+D  L  + + R++  +LL  +F 
Sbjct:  522 KITDFGFCVELTE---KRSKRATMVGTPYWMAPEI--VNQKGYDEKV--DVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFL 639          

HSP 2 Score: 31.187 bits (69), Expect = 1.867e-9
Identity = 15/30 (50.00%), Postives = 20/30 (66.67%), Query Frame = 1
Query:  577 TENIIRY-SKQILEGVEFLHGYSIIHRDIK 663
             EN + Y  K+  +G++FLH   IIHRDIK
Sbjct:  480 NENQMAYIVKETCQGLKFLHNKKIIHRDIK 509          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 44.669 bits (104), Expect = 1.310e-8
Identity = 37/125 (29.60%), Postives = 53/125 (42.40%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFF 1114
            K+ DFG C    R   K +K    +GTP   +PEV    +         D+ SLG   I M+   P Y +         I+T     L   +S+S E+K F+   L  D   R++  +LL   FF
Sbjct:  708 KITDFGFC---ARLTDKRSKRATMVGTPYWMAPEVVKQREYDE----KIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFF 825          

HSP 2 Score: 30.8018 bits (68), Expect = 1.310e-8
Identity = 21/50 (42.00%), Postives = 26/50 (52.00%), Query Frame = 1
Query:  535 GSLEDEIERKRF------LATENIIRY-SKQILEGVEFLHGYSIIHRDIK 663
            GSL D IE            TE  I Y  ++  +G++FLH   IIHRDIK
Sbjct:  646 GSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIK 695          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 56.6102 bits (135), Expect = 2.057e-12
Identity = 43/124 (34.68%), Postives = 57/124 (45.97%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKF 1111
            KL DFG+   L  T  K    I   GTP   +PEV    + G      ADI SLG T + M   +P Y D H       I T       D    SE+ K+F+ K L  + ++R+TA +LL+  F
Sbjct:  158 KLADFGVAGQLTDTMAKRNTVI---GTPFWMAPEV--IQEVGY--DCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSF 274          

HSP 2 Score: 33.113 bits (74), Expect = 2.057e-12
Identity = 21/57 (36.84%), Postives = 30/57 (52.63%), Query Frame = 1
Query:  496 NANLSVSTSCAAHGSLEDEIE-RKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            N +L +       GS+ D ++ R + L  E I    K  L+G+E+LH    IHRDIK
Sbjct:   89 NTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIK 145          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 47.7506 bits (112), Expect = 5.325e-12
Identity = 40/125 (32.00%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTT-KKLDLPDSQSMSEEMKEFIDKMLDQDQRS--TAVQLLKLKF 1111
            KL DFG  + L +T    T   +  GTP   +PEV      G      AD+ S+G TV+ M+T +P + D+   A   KI+T   + +LP    +S +  EF+   L  + +S  +A +LL+  F
Sbjct:  144 KLADFGASKRL-QTIRSKTGFRSVHGTPYWMAPEVINGEGYGR----KADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPS--DLSVDAVEFVRSTLRMNSKSRPSADELLRFSF 261          

HSP 2 Score: 40.4318 bits (93), Expect = 5.325e-12
Identity = 20/44 (45.45%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  532 HGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            HG+L + + RK          YS+QILEG+ +LH   I+HRDIK
Sbjct:   98 HGALNESLTRK----------YSRQILEGILYLHTNRIVHRDIK 131          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 51.2174 bits (121), Expect = 1.194e-10
Identity = 37/125 (29.60%), Postives = 60/125 (48.00%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQD--QRSTAVQLLKLKFF 1114
            KL DFG C ++     +  K    +GTP   +PEV +T  +  P     D+ SLG   I M+   P Y + +       I+T    +L   + +S   K+F+ + L+ D  +RS+A +LL+  F 
Sbjct:  360 KLTDFGFCATI---TPEQNKRSTMVGTPYWMAPEV-VTRKQYGP---RVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVEKRSSARELLQHPFL 477          

HSP 2 Score: 32.3426 bits (72), Expect = 1.194e-10
Identity = 17/45 (37.78%), Postives = 25/45 (55.56%), Query Frame = 1
Query:  529 AHGSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            A GSL D +  +  +    I    ++ L+ +EFLH   +IHRDIK
Sbjct:  304 AGGSLTDVV-TETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIK 347          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 43.8986 bits (102), Expect = 2.026e-8
Identity = 41/125 (32.80%), Postives = 57/125 (45.60%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDK-GAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKF 1111
            KLVDFG+   L RT G+       IGTP   +PEV    ++  A      D+ S+G T I M  ++P   D H       I  +    L   +S S+    F++  L  D   R TA QLL+ +F
Sbjct:  163 KLVDFGVSAQLDRTIGRRN---TFIGTPYWMAPEVIACDEQPDATYDNRCDMWSIGITAIEMAESQPPLCDMHPMRALFLIPRSDPPKLKSKKSWSKRFHHFVNTCLIKDYQHRPTADQLLQHEF 284          

HSP 2 Score: 31.9574 bits (71), Expect = 2.026e-8
Identity = 20/49 (40.82%), Postives = 28/49 (57.14%), Query Frame = 1
Query:  523 CAAHGSLEDEIE--RKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            C A GS+ D ++  R + L  E I    +++L GV  LH   +IHRDIK
Sbjct:  103 CGA-GSVTDLVKTARNKALKEEWISYICREVLNGVSHLHMNHVIHRDIK 150          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 48.521 bits (114), Expect = 3.771e-8
Identity = 42/124 (33.87%), Postives = 56/124 (45.16%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKMLDQD--QRSTAVQLLKLKF 1111
            KL DFG+   L  T  K       +GTP   +PEV   S   +     ADI SLG T I +    P   D H   V   I      +L  + + S+  KEF+   L++D   R TA +LLK +F
Sbjct:  146 KLADFGVAGQLTDTLNKRN---TFVGTPFWMAPEVIKQSAYDS----KADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPEL--TGNFSKAFKEFVSLCLNKDPNDRPTAKELLKHRF 260          

HSP 2 Score: 26.5646 bits (57), Expect = 3.771e-8
Identity = 9/21 (42.86%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  601 KQILEGVEFLHGYSIIHRDIK 663
            +++L+G+++LH    +HRDIK
Sbjct:  113 REVLKGLDYLHTEKKLHRDIK 133          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 58.9214 bits (141), Expect = 2.221e-16
Identity = 43/124 (34.68%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  R L   C   T   +  GTP   SPEV      G      ADI S+G TV+ M+T RP + ++   A   KI+T     +LP    +S+  +EF+ ++  +  QR +A +LL+  F
Sbjct:  531 KLGDFGASRRLQTICLSGTGIKSVTGTPYWMSPEVISGEGYGR----KADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPELP--VHVSDHCREFLRRIFVETKQRPSADELLRHIF 648          

HSP 2 Score: 45.8246 bits (107), Expect = 2.221e-16
Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1
Query:  505 LSVSTSCAAHGSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            LS+       GS++D+++    L TEN+ R Y++QILEGV +LH   I+HRDIK
Sbjct:  466 LSIFMEHMPGGSIKDQLKSYGAL-TENVTRRYTRQILEGVSYLHSNMIVHRDIK 518          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 56.6102 bits (135), Expect = 3.618e-15
Identity = 41/123 (33.33%), Postives = 60/123 (48.78%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + L   C   T   +  GTP   SPEV      G      AD+ SLG TV+ M+T +P + +Y   A   KI+T     L  S + S++ ++FI  +  +   R +A +LL+  F
Sbjct:  495 KLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVISGEGYGR----KADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPLLPSHT-SDQARDFIHCIFVEAKHRPSAEELLRHPF 612          

HSP 2 Score: 43.8986 bits (102), Expect = 3.618e-15
Identity = 22/44 (50.00%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIR-YSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L TEN+ R Y++QILEG+ +LH   I+HRDIK
Sbjct:  440 GSVKDQLKAYGAL-TENVTRKYTRQILEGMSYLHSNMIVHRDIK 482          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 50.0618 bits (118), Expect = 6.058e-13
Identity = 39/124 (31.45%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + +   C   T   +  GTP   SPEV      G      AD+ S+  TV+ M+T +P + +Y   A   KI+T   K  LP+   +S+  ++F+ ++  ++  R TA  LL   F
Sbjct:  469 KLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEGYGR----KADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLPE--GVSDASRDFLRQVFVEEKWRPTADILLNHPF 586          

HSP 2 Score: 42.743 bits (99), Expect = 6.058e-13
Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L  +   RY++QIL+GV +LH   I+HRDIK
Sbjct:  414 GSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIK 456          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 50.0618 bits (118), Expect = 6.564e-13
Identity = 39/124 (31.45%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + +   C   T   +  GTP   SPEV      G      AD+ S+  TV+ M+T +P + +Y   A   KI+T   K  LP+   +S+  ++F+ ++  ++  R TA  LL   F
Sbjct:  499 KLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEGYGR----KADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLPE--GVSDASRDFLRQVFVEEKWRPTADILLNHPF 616          

HSP 2 Score: 43.1282 bits (100), Expect = 6.564e-13
Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L  +   RY++QIL+GV +LH   I+HRDIK
Sbjct:  444 GSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIK 486          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 50.0618 bits (118), Expect = 6.564e-13
Identity = 39/124 (31.45%), Postives = 60/124 (48.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTK-KLDLPDSQSMSEEMKEFIDKML-DQDQRSTAVQLLKLKF 1111
            KL DFG  + +   C   T   +  GTP   SPEV      G      AD+ S+  TV+ M+T +P + +Y   A   KI+T   K  LP+   +S+  ++F+ ++  ++  R TA  LL   F
Sbjct:  499 KLGDFGASKRIQTICMSGTGIKSVTGTPYWMSPEVINGEGYGR----KADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPTKPTLPE--GVSDASRDFLRQVFVEEKWRPTADILLNHPF 616          

HSP 2 Score: 43.1282 bits (100), Expect = 6.564e-13
Identity = 19/43 (44.19%), Postives = 30/43 (69.77%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GS++D+++    L  +   RY++QIL+GV +LH   I+HRDIK
Sbjct:  444 GSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIK 486          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 183.341 bits (464), Expect = 2.858e-63
Identity = 97/131 (74.05%), Postives = 105/131 (80.15%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFFCEFDQD 1132
            K+ DFG+ RSLLRTCG VTKA  +IGTPN T+PEV LTSD+G P TVSADI SLGATVINMIT RP Y   H  AV  KI+ TKKLDLPDSQSMS+EMKEFI+KML  D DQRSTA QLLKLK F EFDQD
Sbjct:  606 KITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCGCHPYAVVKKIADTKKLDLPDSQSMSKEMKEFIEKMLDPDPDQRSTAAQLLKLKLFSEFDQD 736          

HSP 2 Score: 78.1814 bits (191), Expect = 2.858e-63
Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSLEDEI+RKR LATENIIRYSKQILEG+EFLHG +IIHRDIK
Sbjct:  551 GSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIK 593          

HSP 3 Score: 74.3294 bits (181), Expect = 2.250e-19
Identity = 56/76 (73.68%), Postives = 64/76 (84.21%), Query Frame = 3
Query:  312 WHARAAISKLVKSLIKTKCDISTRDKFNLSLLDIALKHKNXXXXXXXXXXXXXXXXXMMCLKCKSFCKHKLCSTRI 539
            W   +   K+VKSLIKTKCDIS RDK NLS LDIA+K++NKELVELLKAEELEQQILMM LKCKSFC H+LC+T +
Sbjct:  391 WACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSL 466          

HSP 4 Score: 40.0466 bits (92), Expect = 2.250e-19
Identity = 19/25 (76.00%), Postives = 19/25 (76.00%), Query Frame = 1
Query:  211 SCLQWACKNGDLKKASPLLNGAAIE 285
             CL  ACKNGDLKK S  LNGAAIE
Sbjct:  355 PCLLRACKNGDLKKVSTYLNGAAIE 379          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 182.956 bits (463), Expect = 3.377e-63
Identity = 97/131 (74.05%), Postives = 105/131 (80.15%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFFCEFDQD 1132
            K+ DFG+ RSLLRTCG VTKA  +IGTPN T+PEV LTSD+G P TVSADI SLGATVINMIT RP Y   H  AV  KI+ TKKLDLPDSQSMS+EMKEFI+KML  D DQRSTA QLLKLK F EFDQD
Sbjct:  507 KITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCGCHPYAVVKKIADTKKLDLPDSQSMSKEMKEFIEKMLDPDPDQRSTAAQLLKLKLFSEFDQD 637          

HSP 2 Score: 78.5666 bits (192), Expect = 3.377e-63
Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSLEDEI+RKR LATENIIRYSKQILEG+EFLHG +IIHRDIK
Sbjct:  452 GSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIK 494          

HSP 3 Score: 74.7146 bits (182), Expect = 1.335e-19
Identity = 56/76 (73.68%), Postives = 64/76 (84.21%), Query Frame = 3
Query:  312 WHARAAISKLVKSLIKTKCDISTRDKFNLSLLDIALKHKNXXXXXXXXXXXXXXXXXMMCLKCKSFCKHKLCSTRI 539
            W   +   K+VKSLIKTKCDIS RDK NLS LDIA+K++NKELVELLKAEELEQQILMM LKCKSFC H+LC+T +
Sbjct:  292 WACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSL 367          

HSP 4 Score: 40.4318 bits (93), Expect = 1.335e-19
Identity = 19/25 (76.00%), Postives = 19/25 (76.00%), Query Frame = 1
Query:  211 SCLQWACKNGDLKKASPLLNGAAIE 285
             CL  ACKNGDLKK S  LNGAAIE
Sbjct:  256 PCLLRACKNGDLKKVSTYLNGAAIE 280          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 182.956 bits (463), Expect = 3.494e-63
Identity = 97/131 (74.05%), Postives = 105/131 (80.15%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFFCEFDQD 1132
            K+ DFG+ RSLLRTCG VTKA  +IGTPN T+PEV LTSD+G P TVSADI SLGATVINMIT RP Y   H  AV  KI+ TKKLDLPDSQSMS+EMKEFI+KML  D DQRSTA QLLKLK F EFDQD
Sbjct:  441 KITDFGVSRSLLRTCGNVTKAETTIGTPNFTAPEVFLTSDEGPPYTVSADIWSLGATVINMITGRPPYCGCHPYAVVKKIADTKKLDLPDSQSMSKEMKEFIEKMLDPDPDQRSTAAQLLKLKLFSEFDQD 571          

HSP 2 Score: 78.1814 bits (191), Expect = 3.494e-63
Identity = 38/43 (88.37%), Postives = 41/43 (95.35%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSLEDEI+RKR LATENIIRYSKQILEG+EFLHG +IIHRDIK
Sbjct:  386 GSLEDEIKRKRSLATENIIRYSKQILEGLEFLHGNNIIHRDIK 428          

HSP 3 Score: 74.7146 bits (182), Expect = 1.274e-19
Identity = 56/76 (73.68%), Postives = 64/76 (84.21%), Query Frame = 3
Query:  312 WHARAAISKLVKSLIKTKCDISTRDKFNLSLLDIALKHKNXXXXXXXXXXXXXXXXXMMCLKCKSFCKHKLCSTRI 539
            W   +   K+VKSLIKTKCDIS RDK NLS LDIA+K++NKELVELLKAEELEQQILMM LKCKSFC H+LC+T +
Sbjct:  226 WACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSL 301          

HSP 4 Score: 40.4318 bits (93), Expect = 1.274e-19
Identity = 19/25 (76.00%), Postives = 19/25 (76.00%), Query Frame = 1
Query:  211 SCLQWACKNGDLKKASPLLNGAAIE 285
             CL  ACKNGDLKK S  LNGAAIE
Sbjct:  190 PCLLRACKNGDLKKVSTYLNGAAIE 214          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000032703.1 (SMESG000032703.1)

HSP 1 Score: 171.4 bits (433), Expect = 1.195e-59
Identity = 89/131 (67.94%), Postives = 104/131 (79.39%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFFCEFDQD 1132
            KL DFGI RSL+RTCG++TKA+ +IGTPN T+PEV LTSD G P T SADI S+GATVINMIT RP YY  H  AV  +IST+KKL+LP+S+ MS+ MK FI++ML  D DQRSTA QLLKLKFF EFD D
Sbjct:  785 KLADFGISRSLMRTCGEITKAVTTIGTPNFTAPEVILTSDNGPPYTESADIWSMGATVINMITGRPPYYYCHPFAVINRISTSKKLELPESELMSDAMKGFIEEMLNPDPDQRSTAAQLLKLKFFSEFDFD 915          

HSP 2 Score: 78.1814 bits (191), Expect = 1.195e-59
Identity = 37/43 (86.05%), Postives = 41/43 (95.35%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            GSLEDEIE+KRF+AT+NIIRYSKQILEG+EFLHG  IIHRDIK
Sbjct:  730 GSLEDEIEKKRFIATKNIIRYSKQILEGLEFLHGNRIIHRDIK 772          

HSP 3 Score: 61.2326 bits (147), Expect = 6.032e-12
Identity = 48/80 (60.00%), Postives = 59/80 (73.75%), Query Frame = 3
Query:  312 WHARAAISKLVKSLIKTKCDISTRDKFNLSLLDIALKHKNXXXXXXXXXXXXXXXXXMMCLKCK-SFCKHKLCSTRITGR 548
            W   +   K+VKSLIKTKCDI+ +DK NL  LDIA+K +NKELVE+LK EELEQQI MM L+CK  FC H+LC T +  +
Sbjct:  569 WACESGNIKIVKSLIKTKCDITAKDKDNLRPLDIAIKKENKELVEILKEEELEQQISMMGLECKPPFCNHRLCKTSLKNK 648          

HSP 4 Score: 28.1054 bits (61), Expect = 6.032e-12
Identity = 13/20 (65.00%), Postives = 13/20 (65.00%), Query Frame = 1
Query:  226 ACKNGDLKKASPLLNGAAIE 285
            ACK GD KK S LLN   IE
Sbjct:  538 ACKTGDTKKVSRLLNSITIE 557          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000017196.1 (SMESG000017196.1)

HSP 1 Score: 141.739 bits (356), Expect = 1.834e-49
Identity = 79/128 (61.72%), Postives = 92/128 (71.88%), Query Frame = 2
Query:  746 KLVDFGICRSLLRTCGKVTKAINSIGTPNSTSPEVSLTSDKGAP*TVSADI*SLGATVINMITNRPSYYDYHLCAVSIKISTTKKLDLPDSQSMSEEMKEFIDKML--DQDQRSTAVQLLKLKFFCEF 1123
            KL DFGI RSLLRT G  T+     GT N  +PEV L SD GAP T SADI S+GATVINMIT +P YY+    A+  KI++TKKL+LP+SQ MSEEMKEFI++ML  D D+RSTA  LL LK F EF
Sbjct:  641 KLADFGISRSLLRTNGLATRPATIAGTLNFIAPEVILASDDGAPYTESADIWSMGATVINMITGKPPYYNSITPALIFKIASTKKLELPNSQLMSEEMKEFIEEMLNPDPDKRSTAKNLLTLKLFSEF 768          

HSP 2 Score: 73.9442 bits (180), Expect = 1.834e-49
Identity = 36/43 (83.72%), Postives = 39/43 (90.70%), Query Frame = 1
Query:  535 GSLEDEIERKRFLATENIIRYSKQILEGVEFLHGYSIIHRDIK 663
            G+LEDEI+RK FL  ENIIRYSKQILEG+EFLHG SIIHRDIK
Sbjct:  586 GTLEDEIKRKIFLTRENIIRYSKQILEGLEFLHGNSIIHRDIK 628          

HSP 3 Score: 44.2838 bits (103), Expect = 3.450e-9
Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = 3
Query:  312 WHARAAISKLVKSLIKTKCDISTRDKFNLSLLDIALKHKNXXXXXX----------------XXXXXXXXXXXMMCLKCKSFCKHKLCSTRI 539
            W   +   +LVK LIK+KC I+ +DK +LS LDIA ++ NKELV++                 + E++E+ I+ M LKC +FC H+LC T +
Sbjct:  410 WACESGNIELVKLLIKSKCKITIKDKSDLSPLDIARRNDNKELVQVIKDAILVQEPERELELERQEQVEKLIVAMGLKCTAFCDHRLCPTSL 501          

HSP 4 Score: 35.4242 bits (80), Expect = 3.450e-9
Identity = 15/25 (60.00%), Postives = 17/25 (68.00%), Query Frame = 1
Query:  211 SCLQWACKNGDLKKASPLLNGAAIE 285
             CL  AC NGDL+K S  LNG+ IE
Sbjct:  374 PCLLLACTNGDLEKVSKFLNGSTIE 398          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K39.120e-1533.87mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K39.269e-1533.87mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K39.269e-1533.87mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K39.511e-1533.87mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K39.990e-1533.87mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak-11.494e-1132.80Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-11.768e-1132.80Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-11.796e-1132.80Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
cst-23.097e-1033.33Caenorhabditis STE20-like kinase [Source:UniProtK... [more]
cst-14.585e-1033.33Serine/threonine-protein kinase cst-1 Serine/threo... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak2.290e-1128.80gene:FBgn0267698 transcript:FBtr0334540[more]
Pak2.290e-1128.80gene:FBgn0267698 transcript:FBtr0334542[more]
Pak2.290e-1128.80gene:FBgn0267698 transcript:FBtr0334543[more]
Pak2.290e-1128.80gene:FBgn0267698 transcript:FBtr0334541[more]
Pak2.457e-1129.60gene:FBgn0267698 transcript:FBtr0334539[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.689e-1533.87mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k22.756e-1533.87mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k32.696e-1432.26mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.830e-1432.26mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k32.995e-1432.26mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
samd81.515e-1634.68sterile alpha motif domain containing 8 [Source:Xe... [more]
samd81.619e-1634.68sterile alpha motif domain containing 8 [Source:Xe... [more]
dennd1a7.852e-1632.26DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
dennd1a8.313e-1632.26DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
MAP3K25.202e-1331.45mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k38.251e-1533.87mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k23.474e-1330.65mitogen-activated protein kinase kinase kinase 2 [... [more]
Stk103.959e-1234.40serine/threonine kinase 10 [Source:MGI Symbol;Acc:... [more]
Stk31.227e-1134.68serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk31.664e-1134.68serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99759|M3K3_HUMAN4.106e-1433.87Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q61084|M3K3_MOUSE4.915e-1433.87Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q61083|M3K2_MOUSE8.296e-1330.65Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|O22042|M3K3_ARATH2.117e-1233.60Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9Y2U5|M3K2_HUMAN2.915e-1230.65Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W3JF442.588e-1535.20mitogen-activated protein kinase kinase kinase 2-l... [more]
F6VUQ35.980e-1535.71Protein kinase domain-containing protein OS=Ciona ... [more]
F6XR369.380e-1535.71Protein kinase domain-containing protein OS=Ciona ... [more]
A0A250WS046.220e-1434.35Protein kinase domain-containing protein OS=Chlamy... [more]
A0A1A8JZC76.295e-1433.33Protein kinase domain-containing protein (Fragment... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k34.030e-1633.33mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.030e-1633.33mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k34.030e-1633.33mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k27.052e-1533.87mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k221.849e-1331.45mitogen-activated protein kinase kinase kinase 3-l... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k21.767e-1631.75mitogen-activated protein kinase kinase kinase 2 [... [more]
slka1.788e-1233.08STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
pak45.016e-1230.40p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
ENSPMAT00000008103.11.634e-1131.20pep scaffold:Pmarinus_7.0:GL476484:390774:392599:-... [more]
map3k193.538e-928.68mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC154.367e-1236.36Protein kinase of the Mitotic Exit Network; locali... [more]
STE201.484e-1029.69Cdc42p-activated signal transducing kinase; involv... [more]
STE113.743e-1032.23Signal transducing MEK kinase; involved in pheromo... [more]
SKM11.867e-929.60Member of the PAK family of serine/threonine prote... [more]
CLA41.310e-829.60Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428452.057e-1234.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414105.325e-1232.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336671.194e-1029.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409612.026e-832.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319343.771e-833.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.221e-1634.68mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k33.618e-1533.33mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k226.058e-1331.45mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k226.564e-1331.45mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k226.564e-1331.45mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017261.12.858e-6374.05SMESG000017261.1[more]
SMESG000017261.13.377e-6374.05SMESG000017261.1[more]
SMESG000017261.13.494e-6374.05SMESG000017261.1[more]
SMESG000032703.11.195e-5967.94SMESG000032703.1[more]
SMESG000017196.11.834e-4961.72SMESG000017196.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017872 ID=SMED30017872|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1153bp
ATTTCTATGCCCAACATAATTAATTAATTGATTTATTTTAATCCGATCAT
TCACCATCATTCATTTCACCTCAATTGTGCAGGGCCCCTTCACCCCTCCA
TATATAAATCCGATTGCAACATCCCGCCGATATTGAATGCTTTCATAGCT
CTCTATTCTCATATTTTCTTTATTTCTATTTTCCTATCAGTTTGATTTGT
CTGCATTCAGTCTTGCTTGCAGTGGGCCTGTAAAAATGGCGACCTGAAGA
AGGCTTCCCCGTTGCTAAATGGTGCCGCCATAGAATAAGGACCAAAGGCG
GCCAATTCATTTGGCATGCGAGAGCGGCAATATCAAAGTTGGTCAAATCA
TTGATTAAAACAAAATGCGATATCAGCACAAGAGATAAATTTAATTTGTC
CCTTCTGGACATCGCATTAAAGCATAAGAATAAGGAGCTCGTGGAGCTCC
TCAAGGCGGAGGAATTGGAACAACAAATTTTAATGATGTGTCTGAAATGC
AAATCTTTCTGTAAGCACAAGCTGTGCAGCACACGGATCACTGGAAGATG
AAATAGAAAGAAAGAGATTCCTAGCCACGGAAAATATCATAAGGTACAGC
AAGCAGATCCTTGAAGGCGTGGAATTCCTGCACGGATACAGCATCATTCA
TCGAGATATAAAGCGTAAATAAATGCCAATAATAATATTTAAATTGAAAT
TATTATTCAACGGCAAATATATTGATAATCTAATGAAATAATATAAAACT
AGTAGATTTTGGTATCTGTCGGTCATTATTGAGGACATGTGGCAAAGTAA
CTAAAGCTATCAATTCAATTGGAACTCCAAATTCTACATCTCCTGAGGTT
TCCCTAACTAGTGATAAAGGGGCACCCTAAACTGTATCAGCGGATATCTG
ATCGTTGGGGGCCACTGTTATCAATATGATAACTAACAGGCCGTCATATT
ATGATTATCATCTATGTGCTGTTTCAATAAAAATTTCCACAACTAAAAAG
CTTGATCTGCCGGACTCCCAATCGATGTCAGAGGAAATGAAAGAATTCAT
TGACAAAATGTTGGATCAGGATCAGAGATCAACTGCAGTACAATTATTAA
AATTGAAATTTTTTTGTGAATTCGATCAAGATTAAATAAATTTTTATGTT
TGA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0042803protein homodimerization activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0046777protein autophosphorylation
GO:2000401regulation of lymphocyte migration
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 1..69
e-value: 2.8E-8
score: 35.2
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 1..67