Neuronal acetylcholine receptor subunit alpha-6

Overview
NameNeuronal acetylcholine receptor subunit alpha-6
Smed IDSMED30017866
Length (bp)1659
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal acetylcholine receptor subunit alpha-6 (SMED30017866) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-6 (SMED30017866) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha-6 (SMED30017866) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-6 (SMED30017866) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: CHRNA6 (cholinergic receptor nicotinic alpha 6 subunit [Source:HGNC Symbol;Acc:HGNC:15963])

HSP 1 Score: 144.05 bits (362), Expect = 1.006e-36
Identity = 97/360 (26.94%), Postives = 179/360 (49.72%), Query Frame = 2
Query:  125 SRSMNYLFSVFVLSSIILRSFCN--VPQSYEEELLN-ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPW--QSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWE-IRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEY 1180
            S+   +L     L   +   F    V  + EE L + +    N  +RP     + ++PV V+    + Q+    +  + M  + W   +W+D +L W+  +Y  +  + +PA  +W PDI + N  N+   DF    +++  ++ +G ITW   AI   +CP+D+ FFPFD Q C L    W    ++  +LI    +GS VD N +  N   SEWE I A  +K     +     Y  I  S ++RR P+++ + ++IP   +S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y          + PT +  P +
Sbjct:    4 SKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRP---VENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYN--NAVG-DFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLI----IGSKVDMNDFWEN---SEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHY----------RTPTTHTMPRW 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: AC254952.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 143.28 bits (360), Expect = 2.697e-36
Identity = 82/285 (28.77%), Postives = 153/285 (53.68%), Query Frame = 2
Query:  260 NPCRSHCAN---PVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKR-KRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI 1099
            NP     AN   P+ V  + +++QI+   Q  + ++ + W  + W+D+ L+WN  +Y  +  V  P   +W PDI + N  + +   F     + + V S G   +L   I   +C +DVR+FPFDVQ C L    W      + +   Q+  A  + Y+PN    EW++  +  KR +R+       Y  +  ++ +RR+ LY+ + +LIP  ++S LA L+F L  D+G+++S+ ++++LS+T+++++V+   P +  S+P+I  Y    + ++ L+ V+ VI
Sbjct:   38 NPLERPVANDSQPLTVYFSLSLLQIMDVDQKRQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADER---FDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL---QMQEADISGYIPN---GEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVI 313          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: AC254952.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 143.28 bits (360), Expect = 2.697e-36
Identity = 82/285 (28.77%), Postives = 153/285 (53.68%), Query Frame = 2
Query:  260 NPCRSHCAN---PVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKR-KRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI 1099
            NP     AN   P+ V  + +++QI+   Q  + ++ + W  + W+D+ L+WN  +Y  +  V  P   +W PDI + N  + +   F     + + V S G   +L   I   +C +DVR+FPFDVQ C L    W      + +   Q+  A  + Y+PN    EW++  +  KR +R+       Y  +  ++ +RR+ LY+ + +LIP  ++S LA L+F L  D+G+++S+ ++++LS+T+++++V+   P +  S+P+I  Y    + ++ L+ V+ VI
Sbjct:   38 NPLERPVANDSQPLTVYFSLSLLQIMDVDQKRQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADER---FDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL---QMQEADISGYIPN---GEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVI 313          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: CHRNB3 (cholinergic receptor nicotinic beta 3 subunit [Source:HGNC Symbol;Acc:HGNC:1963])

HSP 1 Score: 141.354 bits (355), Expect = 5.326e-36
Identity = 106/406 (26.11%), Postives = 190/406 (46.80%), Query Frame = 2
Query:  182 SFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNV--------SEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLA--VINNKVR----YFKVSPESKS---RKQPT---------GYRCPEYNNDSPIIQ---LQNSKNRMNDANHKINKKFNADYNFSKSYANNSVR 1309
             F ++ ++ +  L ++ +     VRP     H  + + V     + Q++   +  + M+ + W    W+D++L WN + YG ++++ +P++ +WLPDI +    + +   F     +++ V+S+G + W   A    +C +DV FFPFD Q C +    W              G+ VD   L N NV         EWEI       K  R D   +Y +I  S  LRR PL++ + ++IP   LS L  L+F L  D G++LS++ S+++S+T++++++    P S + +P+IG YLL  +  ++L+ ++   VIN   R    Y  ++P  K    +K P           Y  PE     P+++   L+  K +      K+   F      S  Y +  V+
Sbjct:   21 GFNSIAENEDALLRHLFQGYQKWVRP---VLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGR---FEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYD-----------GTMVD-LILINENVDRKDFFDNGEWEILNAK-GMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPEKEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVK 407          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 141.739 bits (356), Expect = 8.743e-36
Identity = 81/285 (28.42%), Postives = 153/285 (53.68%), Query Frame = 2
Query:  260 NPCRSHCAN---PVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKR-KRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI 1099
            NP     AN   P+ V  + +++QI+   +  + ++ + W  + W+D+ L+WN  +Y  +  V  P   +W PDI + N  + +   F     + + V S G   +L   I   +C +DVR+FPFDVQ C L    W      + +   Q+  A  + Y+PN    EW++  +  KR +R+       Y  +  ++ +RR+ LY+ + +LIP  ++S LA L+F L  D+G+++S+ ++++LS+T+++++V+   P +  S+P+I  Y    + ++ L+ V+ VI
Sbjct:   38 NPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADER---FDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL---QMQEADISGYIPN---GEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVI 313          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: lgc-4 (Ligand-gated ion channel 4 [Source:UniProtKB/Swiss-Prot;Acc:P54245])

HSP 1 Score: 149.828 bits (377), Expect = 1.894e-38
Identity = 86/285 (30.18%), Postives = 153/285 (53.68%), Query Frame = 2
Query:  263 PCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD----NSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVIN 1102
            PC  H + P NV   + + QI+   +  + ++   W  I W D RL WN   +  + A+ IP   +W PDI ++N  N+    ++++  + + V SDG +TWL  A+   +CP+ VR++PFD Q C L    W        I    LG   D    +SY+ NS     ++ AV  +   + SD N  +  I + IH+ R+PL++V   ++P  ++S +A L F +  +TG+++++ ++ +LSM +Y+  ++ + P +   +P+IG+Y +  L ++ LAT + VI 
Sbjct:  130 PCIHH-SQPTNVTFGFLLNQIVEMDERNQALTTRSWLNINWMDPRLSWNESLWSEIKAIYIPHARIWKPDIILVN--NAIREYYASLVSTDVMVTSDGNVTWLFSALFRSSCPIRVRYYPFDDQQCDLKFASWSHD-----ITEINLGLNTDKGDLSSYMNNSEFDLVDMTAVR-EVVTFPSDTNSDWPIIVIRIHMHRRPLFYVFNHIVPCVLISSMAVLGFLMPPETGEKINMIITTLLSMGVYLQSITESIPPTSEGVPLIGMYYVSSLLMVCLATCVNVIT 405          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6583461:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 136.732 bits (343), Expect = 4.480e-34
Identity = 82/303 (27.06%), Postives = 160/303 (52.81%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQM-LIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKV 1126
            ++L   N +VRP+    H   P+NV   +++ QI+   +  + ++ + W  + W D +L W+   Y N+  + IP+  +W PDI + N  N+      ++  + + V+  G I W   AI   +CPLDV+ +PFD QTC L    W     ++ L+   + G   +  Y+ N+  S   IRA   K +   S     Y +I V + + R+ +++V  +++P  ++S +A + F +  D+G+++++ ++ +LS T+++++V+   P +  +LP+IGIY    + L++L T + V    + +  V
Sbjct:    6 DLLYDYNNEVRPS---VHSKEPINVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYN--NADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQGDLTN--YITNTEWSLIGIRAE--KNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGV 299          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6581927:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 136.732 bits (343), Expect = 5.559e-34
Identity = 82/303 (27.06%), Postives = 160/303 (52.81%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQM-LIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKV 1126
            ++L   N +VRP+    H   P+NV   +++ QI+   +  + ++ + W  + W D +L W+   Y N+  + IP+  +W PDI + N  N+      ++  + + V+  G I W   AI   +CPLDV+ +PFD QTC L    W     ++ L+   + G   +  Y+ N+  S   IRA   K +   S     Y +I V + + R+ +++V  +++P  ++S +A + F +  D+G+++++ ++ +LS T+++++V+   P +  +LP+IGIY    + L++L T + V    + +  V
Sbjct:   37 DLLYDYNNEVRPS---VHSKEPINVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYN--NADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQGDLTN--YITNTEWSLIGIRAE--KNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGV 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6583461:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 136.346 bits (342), Expect = 6.354e-34
Identity = 82/303 (27.06%), Postives = 160/303 (52.81%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQM-LIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKV 1126
            ++L   N +VRP+    H   P+NV   +++ QI+   +  + ++ + W  + W D +L W+   Y N+  + IP+  +W PDI + N  N+      ++  + + V+  G I W   AI   +CPLDV+ +PFD QTC L    W     ++ L+   + G   +  Y+ N+  S   IRA   K +   S     Y +I V + + R+ +++V  +++P  ++S +A + F +  D+G+++++ ++ +LS T+++++V+   P +  +LP+IGIY    + L++L T + V    + +  V
Sbjct:    6 DLLYDYNNEVRPS---VHSKEPINVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYN--NADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQGDLTN--YITNTEWSLIGIRAE--KNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGV 299          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6581927:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 136.346 bits (342), Expect = 7.951e-34
Identity = 82/303 (27.06%), Postives = 160/303 (52.81%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQM-LIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKV 1126
            ++L   N +VRP+    H   P+NV   +++ QI+   +  + ++ + W  + W D +L W+   Y N+  + IP+  +W PDI + N  N+      ++  + + V+  G I W   AI   +CPLDV+ +PFD QTC L    W     ++ L+   + G   +  Y+ N+  S   IRA   K +   S     Y +I V + + R+ +++V  +++P  ++S +A + F +  D+G+++++ ++ +LS T+++++V+   P +  +LP+IGIY    + L++L T + V    + +  V
Sbjct:   37 DLLYDYNNEVRPS---VHSKEPINVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYN--NADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQGDLTN--YITNTEWSLIGIRAE--KNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGV 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084639)

HSP 1 Score: 141.739 bits (356), Expect = 1.034e-35
Identity = 85/313 (27.16%), Postives = 166/313 (53.04%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDN---------SYLPNSNVSEWEIRAVHFKR-KRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVS 1129
            ++L   N  +RP    S+  + V V +   + Q++  +  ++ ++ + W    W D++ +W+  +YG +  + +P++ +WLPDI + N   + + ++     ++  +   G++ W   AI   +C +DVR+FPFD QTC++    W     Q+ +      +  DN          Y P+    EW+I  V  +R ++Y       Y  I  +I LRR+ L++ V ++IP   +S L+ L+F L  D+G+++++ +S++LS TM+ +++S   P +  +LP++G YLL  + L+ L+ V+ +I   + Y K S
Sbjct:   51 DLLSNYNRLIRP---VSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYN---NADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSV---EWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPS 354          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084640)

HSP 1 Score: 141.739 bits (356), Expect = 1.034e-35
Identity = 85/313 (27.16%), Postives = 166/313 (53.04%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDN---------SYLPNSNVSEWEIRAVHFKR-KRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVS 1129
            ++L   N  +RP    S+  + V V +   + Q++  +  ++ ++ + W    W D++ +W+  +YG +  + +P++ +WLPDI + N   + + ++     ++  +   G++ W   AI   +C +DVR+FPFD QTC++    W     Q+ +      +  DN          Y P+    EW+I  V  +R ++Y       Y  I  +I LRR+ L++ V ++IP   +S L+ L+F L  D+G+++++ +S++LS TM+ +++S   P +  +LP++G YLL  + L+ L+ V+ +I   + Y K S
Sbjct:   51 DLLSNYNRLIRP---VSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYN---NADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSV---EWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPS 354          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0334916)

HSP 1 Score: 129.028 bits (323), Expect = 2.088e-31
Identity = 80/306 (26.14%), Postives = 167/306 (54.58%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSY----LPNSNVS-EWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATV--LAVINNKVR 1114
            ++L   N  +RP     + ++ + V +   + Q++  +   + M+ + W    W+D +L+WN + YG ++ + +P++ +WLPDI +    N+ + ++     ++  +   G++ W   AI    C +DV +FPFD QTC++    W      + +   +  +  DN      L +  +S EW+I R    + +++ S     Y  I  ++ LRR+ L++ V ++IP   +S L+ L+F L  D+G+++S+ +S++LS+T++ ++++   P +  ++P++G YLL  + L++L+ V  +AV+N   R
Sbjct:   31 DLLSNYNRLIRP---VGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLY---NNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFR 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0084619)

HSP 1 Score: 129.028 bits (323), Expect = 2.088e-31
Identity = 80/306 (26.14%), Postives = 167/306 (54.58%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSY----LPNSNVS-EWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATV--LAVINNKVR 1114
            ++L   N  +RP     + ++ + V +   + Q++  +   + M+ + W    W+D +L+WN + YG ++ + +P++ +WLPDI +    N+ + ++     ++  +   G++ W   AI    C +DV +FPFD QTC++    W      + +   +  +  DN      L +  +S EW+I R    + +++ S     Y  I  ++ LRR+ L++ V ++IP   +S L+ L+F L  D+G+++S+ +S++LS+T++ ++++   P +  ++P++G YLL  + L++L+ V  +AV+N   R
Sbjct:   31 DLLSNYNRLIRP---VGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLY---NNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFR 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0330310)

HSP 1 Score: 128.257 bits (321), Expect = 3.800e-31
Identity = 80/306 (26.14%), Postives = 167/306 (54.58%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSY----LPNSNVS-EWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATV--LAVINNKVR 1114
            ++L   N  +RP     + ++ + V +   + Q++  +   + M+ + W    W+D +L+WN + YG ++ + +P++ +WLPDI +    N+ + ++     ++  +   G++ W   AI    C +DV +FPFD QTC++    W      + +   +  +  DN      L +  +S EW+I R    + +++ S     Y  I  ++ LRR+ L++ V ++IP   +S L+ L+F L  D+G+++S+ +S++LS+T++ ++++   P +  ++P++G YLL  + L++L+ V  +AV+N   R
Sbjct:   31 DLLSNYNRLIRP---VGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLY---NNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFR 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: chrne (cholinergic receptor, nicotinic, epsilon [Source:ZFIN;Acc:ZDB-GENE-040808-32])

HSP 1 Score: 145.591 bits (366), Expect = 2.454e-37
Identity = 97/346 (28.03%), Postives = 181/346 (52.31%), Query Frame = 2
Query:  209 EEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVI--TPWQSSDKQMLIHPYQLGSAVD------NSYLPNSNVSEWEIR---AVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL--EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSL--ATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPII 1201
            EE  L   + +N      P R H    V V +   +  +++ ++ EET++ + W  I W D RL WN+ +Y ++  + +P   +WLPDI + N  + K FD +  A   IS  SDG + WL  AI   TC +++ +FPFD Q C LV     + +++  +++   + G  ++       ++  N    EW I+   A     +RY  D ++ YQ +  +I ++R+PL++V+ +++P S++S L  L + L  +  G +L+V++S++L+ T++++++S   P +  S+P+IG YL+  + + +L     + V+N  +R       S+S K       P Y   +P +
Sbjct:   28 EESQLIADKFKNYSKNIRPAR-HADEKVKVQVKLTLTNLISLNEKEETLTTNVWIEIQWHDYRLAWNTSEYHDIEQIRVPYYTVWLPDIVLENNIDGK-FDVAYYANVLIS--SDGSMYWLPPAIYRSTCAIEITYFPFDWQNCTLVFRSQTYSANEIDIVLAEDENGKPIEWVDIDPEAFTEN---GEWAIKHRPARKLTNQRYSPD-DLEYQEVYYNIIIQRKPLFYVINIILPCSLISSLVVLAYFLPAKAGGQKLTVSISVLLAQTVFLILISQKIPETSLSVPLIGKYLIFVMSMTTLIVTNCIIVLNYSLRSPSTHNMSQSIKHIFLEVVPRYLGMAPFV 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: chrne (cholinergic receptor, nicotinic, epsilon [Source:ZFIN;Acc:ZDB-GENE-040808-32])

HSP 1 Score: 145.591 bits (366), Expect = 2.454e-37
Identity = 97/346 (28.03%), Postives = 181/346 (52.31%), Query Frame = 2
Query:  209 EEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVI--TPWQSSDKQMLIHPYQLGSAVD------NSYLPNSNVSEWEIR---AVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL--EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSL--ATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPII 1201
            EE  L   + +N      P R H    V V +   +  +++ ++ EET++ + W  I W D RL WN+ +Y ++  + +P   +WLPDI + N  + K FD +  A   IS  SDG + WL  AI   TC +++ +FPFD Q C LV     + +++  +++   + G  ++       ++  N    EW I+   A     +RY  D ++ YQ +  +I ++R+PL++V+ +++P S++S L  L + L  +  G +L+V++S++L+ T++++++S   P +  S+P+IG YL+  + + +L     + V+N  +R       S+S K       P Y   +P +
Sbjct:   28 EESQLIADKFKNYSKNIRPAR-HADEKVKVQVKLTLTNLISLNEKEETLTTNVWIEIQWHDYRLAWNTSEYHDIEQIRVPYYTVWLPDIVLENNIDGK-FDVAYYANVLIS--SDGSMYWLPPAIYRSTCAIEITYFPFDWQNCTLVFRSQTYSANEIDIVLAEDENGKPIEWVDIDPEAFTEN---GEWAIKHRPARKLTNQRYSPD-DLEYQEVYYNIIIQRKPLFYVINIILPCSLISSLVVLAYFLPAKAGGQKLTVSISVLLAQTVFLILISQKIPETSLSVPLIGKYLIFVMSMTTLIVTNCIIVLNYSLRSPSTHNMSQSIKHIFLEVVPRYLGMAPFV 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 140.584 bits (353), Expect = 8.030e-36
Identity = 100/381 (26.25%), Postives = 183/381 (48.03%), Query Frame = 2
Query:  143 LFSVF--VLSSIILRSFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI------NNKVRYFKVSPESKS------------RKQPTGYRCPEYNNDSPIIQLQNSKN 1222
            LF++F  + ++   R F ++ +  +  L ++ +     VRP     H  + V V     + Q++   +  + M+ + W    W D +L WN E YG +  + +P++ +WLPDI +    + +   F     ++  V  +G ITW   A     C +DV FFPFD Q C +    W + D  M +    +   VD S   ++   EWEI +     K  R D + +Y YI  S  L+R PL++ + ++IP   LS L  L+F L  D G+++S++ S+++S+T++++++    P S + +P+IG YLL  +  ++L+ ++ V        +   Y  +SP  ++            R     Y  P+    SP ++ ++ K 
Sbjct:    8 LFTLFTSIFATTPAREFVSLAEREDALLRDLFQGYQRWVRPI---LHANHTVKVRFGLKISQLVDVDEKNQLMTTNVWLYEEWLDYKLRWNPENYGGITFIRVPSESIWLPDIVLYENADGR---FEGSIMTKAIVRYNGLITWTPPASYKSACTMDVTFFPFDRQNCSMKFGSW-TYDGNM-VELVLVNHQVDRSDFFDNG--EWEILSAT-GHKGSRRDGHYSYPYITYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRTLFLQRLPDLLCMRGNTDRYHYPQMEPQSPDLKPRSKKG 377          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: CR847523.3 (neuronal acetylcholine receptor subunit alpha-10-like [Source:NCBI gene;Acc:101882637])

HSP 1 Score: 140.969 bits (354), Expect = 9.000e-36
Identity = 84/290 (28.97%), Postives = 161/290 (55.52%), Query Frame = 2
Query:  284 NPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPN--SNVSEWEIRAVHFKRKR-YRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESK 1141
            N +NV +   + QI+   +  + ++   W   VW D  L WN+  Y  L+ + IP+  +W PD+ + N  + +   FS+  ++ + +  DG+I W   AI   +C +DV FFPFDVQ C L    W  +  QM +H     +A+D++ L +   NV EWE++ +  K+        +  Y  I  ++HL+R+  +++  +LIP  M+S LA L F L  D+G+++S+ ++++L++T++ ++V+ + P S  ++P+IG Y +  + +++ +T L +    + +    PE++
Sbjct:   40 NIINVTLQITLSQIIDMDERNQILTTYLWIRQVWFDAYLTWNTTDYDGLDTIRIPSSYVWRPDVVLYNNADDQ---FSSSMETNVVIRHDGQIMWDQPAITKSSCKVDVSFFPFDVQHCRLTFGSWTHNGNQMDLH-----NALDSADLADFVENV-EWEVQGMPAKKNVILYGCCSDPYPDITYTLHLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ENVPLIGKYYIATMTMITASTALTIFIMNIHH--CGPEAQ 317          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: chrna6 (cholinergic receptor, nicotinic, alpha 6 [Source:ZFIN;Acc:ZDB-GENE-090312-91])

HSP 1 Score: 138.658 bits (348), Expect = 6.692e-35
Identity = 79/281 (28.11%), Postives = 152/281 (54.09%), Query Frame = 2
Query:  281 ANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWE-IRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            ++PV V    ++ Q++   +  + M  + W   +W+D +L+W+  ++  +  + +P+  +W PDI + N  N+   DF    +++  ++ DG ITW+  AI   +CP+D+ +FPFD Q C +    W     +  I    +GS V+      S   EWE I A  +K     +     Y  I  S ++RR PL++ + ++IP  ++S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P+IG YLL  +  ++L+ V+ V    V Y
Sbjct:   35 SDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWSPAEFDGIEFIRVPSNKIWRPDIVLYN--NAVG-DFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAK--IDLVLIGSKVNLKDFWESG--EWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHY 308          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 154.836 bits (390), Expect = 7.936e-41
Identity = 106/372 (28.49%), Postives = 190/372 (51.08%), Query Frame = 2
Query:  185 FCNVPQSY----EEELLN-ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNND------SPIIQLQNSKNRMNDANHKINKK 1258
            FC  P S     EE+L   +L + N  +RP     + ++PV V+    + Q++   +  + +  + W   +W+D +L+WN ++Y  +  + IPA  +W PDI + N  N+   DF    +S+  V+ +G ITW   AI   +CP+D+ FFPFD Q C +    W S DK   I    +GS VD   +  N   SEWEI  A  FK     +     Y  I  S ++RR P+++ + +++P   LS L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y          + PT ++ P +  D        ++ ++ +  + N    K N+K
Sbjct:   10 FCVAPGSLQCETEEKLFQKLLARYNQHIRP---VENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYN--NAVG-DFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSW-SYDKAK-IDLAIIGSKVDMKDFWEN---SEWEIVDASGFKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHY----------RTPTTHKMPMWVKDVFLKRLPKLLMMKKTVEKKNRPCSKRNRK 360          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 154.836 bits (390), Expect = 8.661e-41
Identity = 106/372 (28.49%), Postives = 190/372 (51.08%), Query Frame = 2
Query:  185 FCNVPQSY----EEELLN-ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNND------SPIIQLQNSKNRMNDANHKINKK 1258
            FC  P S     EE+L   +L + N  +RP     + ++PV V+    + Q++   +  + +  + W   +W+D +L+WN ++Y  +  + IPA  +W PDI + N  N+   DF    +S+  V+ +G ITW   AI   +CP+D+ FFPFD Q C +    W S DK   I    +GS VD   +  N   SEWEI  A  FK     +     Y  I  S ++RR P+++ + +++P   LS L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y          + PT ++ P +  D        ++ ++ +  + N    K N+K
Sbjct:   15 FCVAPGSLQCETEEKLFQKLLARYNQHIRP---VENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYN--NAVG-DFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSW-SYDKAK-IDLAIIGSKVDMKDFWEN---SEWEIVDASGFKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHY----------RTPTTHKMPMWVKDVFLKRLPKLLMMKKTVEKKNRPCSKRNRK 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 154.451 bits (389), Expect = 1.384e-40
Identity = 106/372 (28.49%), Postives = 190/372 (51.08%), Query Frame = 2
Query:  185 FCNVPQSY----EEELLN-ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNND------SPIIQLQNSKNRMNDANHKINKK 1258
            FC  P S     EE+L   +L + N  +RP     + ++PV V+    + Q++   +  + +  + W   +W+D +L+WN ++Y  +  + IPA  +W PDI + N  N+   DF    +S+  V+ +G ITW   AI   +CP+D+ FFPFD Q C +    W S DK   I    +GS VD   +  N   SEWEI  A  FK     +     Y  I  S ++RR P+++ + +++P   LS L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y          + PT ++ P +  D        ++ ++ +  + N    K N+K
Sbjct:   22 FCVAPGSLQCETEEKLFQKLLARYNQHIRP---VENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYN--NAVG-DFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSW-SYDKAK-IDLAIIGSKVDMKDFWEN---SEWEIVDASGFKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHY----------RTPTTHKMPMWVKDVFLKRLPKLLMMKKTVEKKNRPCSKRNRK 372          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 152.91 bits (385), Expect = 3.140e-40
Identity = 107/377 (28.38%), Postives = 193/377 (51.19%), Query Frame = 2
Query:  161 LSSIILRSFCNVPQSYEEELL--NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNND------SPIIQLQNSKNRMNDANHKINKK 1258
            ++S I+RS     Q   EE L   +L + N  +RP     + ++PV V+    + Q++   +  + +  + W   +W+D +L+WN ++Y  +  + IPA  +W PDI + N  N+   DF    +S+  V+ +G ITW   AI   +CP+D+ FFPFD Q C +    W S DK   I    +GS VD   +  N   SEWEI  A  FK     +     Y  I  S ++RR P+++ + +++P   LS L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y          + PT ++ P +  D        ++ ++ +  + N    K N+K
Sbjct:    3 IASQIIRSL----QCETEEKLFQKLLARYNQHIRP---VENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYN--NAVG-DFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSW-SYDKAK-IDLAIIGSKVDMKDFWEN---SEWEIVDASGFKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHY----------RTPTTHKMPMWVKDVFLKRLPKLLMMKKTVEKKNRPCSKRNRK 354          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 152.525 bits (384), Expect = 6.103e-40
Identity = 102/360 (28.33%), Postives = 186/360 (51.67%), Query Frame = 2
Query:  209 EEELLN-ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNND------SPIIQLQNSKNRMNDANHKINKK 1258
            EE+L   +L + N  +RP     + ++PV V+    + Q++   +  + +  + W   +W+D +L+WN ++Y  +  + IPA  +W PDI + N  N+   DF    +S+  V+ +G ITW   AI   +CP+D+ FFPFD Q C +    W S DK   I    +GS VD   +  N   SEWEI  A  FK     +     Y  I  S ++RR P+++ + +++P   LS L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y          + PT ++ P +  D        ++ ++ +  + N    K N+K
Sbjct:   21 EEKLFQKLLARYNQHIRP---VENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYN--NAVG-DFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSW-SYDKAK-IDLAIIGSKVDMKDFWEN---SEWEIVDASGFKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHY----------RTPTTHKMPMWVKDVFLKRLPKLLMMKKTVEKKNRPCSKRNRK 359          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 149.058 bits (375), Expect = 1.346e-38
Identity = 91/309 (29.45%), Postives = 165/309 (53.40%), Query Frame = 2
Query:  209 EEELLN-ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPW--QSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            EE+L + +    N  +RP     + ++PV V+    + Q+    +  + M  + W   +W D RL W+  +Y  +  + +PA ++W PDI + N  N+   DF    +++  ++ DG ITW   AI   +CP+D+ FFPFD Q C L    W    ++  +LI    +GS VD N +  N   SEWEI  A  +K     +     Y  I  S ++RR P+++ + ++IP   +S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y
Sbjct:   34 EEQLFHRLFAHYNRFIRP---VENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYN--NAVG-DFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLI----IGSKVDMNDFWEN---SEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHY 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna7 (cholinergic receptor, nicotinic, alpha polypeptide 7 [Source:MGI Symbol;Acc:MGI:99779])

HSP 1 Score: 142.124 bits (357), Expect = 3.766e-36
Identity = 83/298 (27.85%), Postives = 159/298 (53.36%), Query Frame = 2
Query:  260 NPCRSHCAN---PVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKR-KRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPES 1138
            NP     AN   P+ V  + +++QI+   +  + ++ + W  + W+D+ L+WN  +Y  +  V  P   +W PDI + N  + +   F     + + V + G   +L   I   +C +DVR+FPFDVQ C L    W      + +   Q+  A  +SY+PN    EW++  +  KR +++       Y  +  ++ +RR+ LY+ + +LIP  ++S LA L+F L  D+G+++S+ ++++LS+T+++++V+   P +  S+P+I  Y    + ++ L+ V+ VI   +RY    P+ 
Sbjct:   38 NPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADER---FDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDL---QMQEADISSYIPN---GEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVI--VLRYHHHDPDG 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 139.043 bits (349), Expect = 3.034e-35
Identity = 84/299 (28.09%), Postives = 160/299 (53.51%), Query Frame = 2
Query:  227 ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWE-IRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            +    N  +RP    SH   PV +    ++ Q++   +  + M  + W   +W+D +L+W    Y  +  + +PA+ +W PDI +    N+ + DF    +++  ++  G +TW+  AI   +C +DV +FPFD Q C +    W S DK   I    +GS+++      S   EW  I+A  +K +   +     YQ I  S+++RR PL++ + ++IP  ++S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P+IG YLL  +  ++L+ V+ V    V Y
Sbjct:   36 LFEDYNEIIRPVANVSH---PVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLY---NNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW-SYDKAK-IDLVLIGSSMNLKDYWESG--EWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHY 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 139.043 bits (349), Expect = 5.064e-35
Identity = 84/299 (28.09%), Postives = 160/299 (53.51%), Query Frame = 2
Query:  227 ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWE-IRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            +    N  +RP    SH   PV +    ++ Q++   +  + M  + W   +W+D +L+W    Y  +  + +PA+ +W PDI +    N+ + DF    +++  ++  G +TW+  AI   +C +DV +FPFD Q C +    W S DK   I    +GS+++      S   EW  I+A  +K +   +     YQ I  S+++RR PL++ + ++IP  ++S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P+IG YLL  +  ++L+ V+ V    V Y
Sbjct:   36 LFEDYNEIIRPVANVSH---PVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLY---NNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW-SYDKAK-IDLVLIGSSMNLKDYWESG--EWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHY 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 138.658 bits (348), Expect = 6.417e-35
Identity = 84/299 (28.09%), Postives = 160/299 (53.51%), Query Frame = 2
Query:  227 ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWE-IRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            +    N  +RP    SH   PV +    ++ Q++   +  + M  + W   +W+D +L+W    Y  +  + +PA+ +W PDI +    N+ + DF    +++  ++  G +TW+  AI   +C +DV +FPFD Q C +    W S DK   I    +GS+++      S   EW  I+A  +K +   +     YQ I  S+++RR PL++ + ++IP  ++S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P+IG YLL  +  ++L+ V+ V    V Y
Sbjct:   41 LFEDYNEIIRPVANVSH---PVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLY---NNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW-SYDKAK-IDLVLIGSSMNLKDYWESG--EWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHY 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|A8XNX8|LGC4_CAEBR (Ligand-gated ion channel 4 OS=Caenorhabditis briggsae OX=6238 GN=lgc-4 PE=3 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 2.372e-38
Identity = 87/285 (30.53%), Postives = 155/285 (54.39%), Query Frame = 2
Query:  263 PCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD----NSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVIN 1102
            PC  H + P NV   + + QI+   +  + ++   W  I W D RL WN   + ++ A+ IP   +W PDI ++N  N+    ++++  + + V SDG +TWL  A+   +CP+ VR++PFD Q C L    W        I    LG   D    +SY+ NS     ++ AV  +  R+ SD N  +  I + IH+ R+PL++V   ++P  ++S +A L F +  +TG+++++ ++ +LSM +Y+  ++ + P +   +P+IG+Y +  L ++ LAT + VI 
Sbjct:  132 PCIHH-SQPTNVTFGFLLNQIVEMDERNQALTTRSWLNINWMDPRLSWNESLWSDIKAIYIPHARIWKPDIILVN--NAIREYYASLVSTDVMVTSDGNVTWLFSALFRSSCPIRVRYYPFDDQQCDLKFASWSHD-----ITEINLGLNTDKGDLSSYMNNSEFDLVDMTAVR-EVVRFPSDTNSDWPTIVIRIHMHRRPLFYVFNHIVPCVLISSMAVLGFLMPPETGEKINMIITTLLSMGVYLQSITESIPPTSEGVPLIGMYYVSSLLMVCLATCVNVIT 407          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|Q9R0W9|ACHA6_MOUSE (Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2)

HSP 1 Score: 149.058 bits (375), Expect = 9.413e-38
Identity = 91/309 (29.45%), Postives = 165/309 (53.40%), Query Frame = 2
Query:  209 EEELLN-ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPW--QSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            EE+L + +    N  +RP     + ++PV V+    + Q+    +  + M  + W   +W D RL W+  +Y  +  + +PA ++W PDI + N  N+   DF    +++  ++ DG ITW   AI   +CP+D+ FFPFD Q C L    W    ++  +LI    +GS VD N +  N   SEWEI  A  +K     +     Y  I  S ++RR P+++ + ++IP   +S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y
Sbjct:   34 EEQLFHRLFAHYNRFIRP---VENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYN--NAVG-DFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLI----IGSKVDMNDFWEN---SEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHY 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|P43143|ACHA6_RAT (Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 9.648e-38
Identity = 93/309 (30.10%), Postives = 165/309 (53.40%), Query Frame = 2
Query:  209 EEELLNILRKR-NLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPW--QSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEI-RAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            EE+L + L    N  +RP     + ++PV V+    + Q+    +  + M  + W   VW D RL W+  +Y  +  + +PA ++W PDI + N  N+   DF    +++  ++ DG ITW   AI   +CP+D+ FFPFD Q C L    W    ++  +LI    +GS VD N +  N   SEWEI  A  +K     +     Y  I  S ++RR P+++ + ++IP   +S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P++G YLL  +  ++L+ V+ V    + Y
Sbjct:   34 EEQLFHTLFAHYNRFIRP---VENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHVWKDYRLCWDPTEYDGIETLRVPADNIWKPDIVLYN--NAVG-DFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLI----IGSKVDMNDFWEN---SEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHY 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|P54245|LGC4_CAEEL (Ligand-gated ion channel 4 OS=Caenorhabditis elegans OX=6239 GN=lgc-4 PE=3 SV=3)

HSP 1 Score: 149.828 bits (377), Expect = 2.410e-37
Identity = 86/285 (30.18%), Postives = 153/285 (53.68%), Query Frame = 2
Query:  263 PCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD----NSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVIN 1102
            PC  H + P NV   + + QI+   +  + ++   W  I W D RL WN   +  + A+ IP   +W PDI ++N  N+    ++++  + + V SDG +TWL  A+   +CP+ VR++PFD Q C L    W        I    LG   D    +SY+ NS     ++ AV  +   + SD N  +  I + IH+ R+PL++V   ++P  ++S +A L F +  +TG+++++ ++ +LSM +Y+  ++ + P +   +P+IG+Y +  L ++ LAT + VI 
Sbjct:  130 PCIHH-SQPTNVTFGFLLNQIVEMDERNQALTTRSWLNINWMDPRLSWNESLWSEIKAIYIPHARIWKPDIILVN--NAIREYYASLVSTDVMVTSDGNVTWLFSALFRSSCPIRVRYYPFDDQQCDLKFASWSHD-----ITEINLGLNTDKGDLSSYMNNSEFDLVDMTAVR-EVVTFPSDTNSDWPIIVIRIHMHRRPLFYVFNHIVPCVLISSMAVLGFLMPPETGEKINMIITTLLSMGVYLQSITESIPPTSEGVPLIGMYYVSSLLMVCLATCVNVIT 405          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|P13908|ACHN2_CARAU (Neuronal acetylcholine receptor subunit non-alpha-2 OS=Carassius auratus OX=7957 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.625e-36
Identity = 106/381 (27.82%), Postives = 186/381 (48.82%), Query Frame = 2
Query:  143 LFSVF--VLSSIILRSFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLA--VINNKVR----YFKVSPESKS------------RKQPTGYRCPEYNNDSPIIQLQNSKN 1222
            LF++F  +++    R F ++ +  +  L  + +     VRP     H  + V V     + Q++   +  + M+ + W    W D +L WN E YG + ++ +P++ +WLPDI +    + +   F     ++  V  +G ITW   A     C +DV FFPFD Q C +    W + D  M +    +   VD S   ++   EWEI +     K  R D +++Y YI  S  L+R PL++ + ++IP   LS L  L+F L  D G+++S++ S+++S+T++++++    P S + +P+IG YLL  +  ++L+ ++   VIN   R    Y  +SP  +S            R     Y  PE    SP ++ +N K 
Sbjct:    8 LFTLFTSIIAITPAREFVSLAEREDALLRELFQGYQRWVRP---VQHANHSVKVRFGLKISQLVDVDEKNQLMTTNVWLWQEWLDYKLRWNPENYGGITSIRVPSESIWLPDIVLYENADGR---FEGSLMTKAIVRYNGMITWTPPASYKSACTMDVTFFPFDRQNCSMKFGSW-TYDGNM-VKLVLINQQVDRSDFFDNG--EWEILSAT-GVKGSRQDSHLSYPYITYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTIFVINVHHRSSATYHPMSPWVRSLFLQRLPHLLCMRGNTDRYHYPELEPHSPDLKPRNKKG 377          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: A0A183W0X7 (Neur_chan_LBD domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS6383 PE=3 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 7.128e-151
Identity = 208/302 (68.87%), Postives = 263/302 (87.09%), Query Frame = 2
Query:  209 EEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKV 1111
            EE+L+  +L + +L VRPN   +   NPV+V+ITYNV+QIL FSQ+EET+SISGWFT+ W+D RL WN E++ ++  VS+PA ++W+PD+G+MN K S +FDFS   + R++V  DG +TWLHGA+LDVTCPLDV FFPFD QTC+L++ PWQS ++Q+L+HP+  GSAVDNSYLPNSNVSEWEI++VHF RK+YRSDLNVTYQY+ ++IHL+RQPLYF+VLVL+PFSMLS LACLIFTL+DTGDRLSVALSLVLSMTMYVVIVS+NAPRSMR+LPV+GI+LLDQLGLLS+AT+LAV+NNK+
Sbjct:   32 EEKLVAQLLSRGSLTVRPNGHMNQSTNPVHVDITYNVVQILGFSQSEETLSISGWFTLRWNDPRLTWNPEEFSDIQEVSLPATNLWIPDVGVMNGKASTDFDFSAGVRGRVTVNKDGSVTWLHGAVLDVTCPLDVSFFPFDYQTCFLILVPWQSGEQQLLLHPFTHGSAVDNSYLPNSNVSEWEIQSVHFVRKKYRSDLNVTYQYVSIAIHLKRQPLYFIVLVLVPFSMLSALACLIFTLDDTGDRLSVALSLVLSMTMYVVIVSTNAPRSMRTLPVLGIFLLDQLGLLSIATILAVMNNKL 333          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: A0A4E0RUV1 (Neuronal acetylcholine receptor subunit alpha-6 OS=Fasciola hepatica OX=6192 GN=D915_003262 PE=3 SV=1)

HSP 1 Score: 459.914 bits (1182), Expect = 7.154e-150
Identity = 211/302 (69.87%), Postives = 261/302 (86.42%), Query Frame = 2
Query:  209 EEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKV 1111
            EE L+  +L +R+L VRPN   +  +NPV+VNITYNV+QILAFSQAEET+SISGWFTI W+D RL W+   + N+  V++P+  +W+PD+G+MN K+S +FDFS   + R++V  +G +TW+HGA+LD TCPLDV FFPFD QTC+L++TPWQSS++Q+L+ P+  GSAVDNSYLPNSNVSEWEI++VHF  K+YRSDLNVTYQY+ + IHL+RQPLYFVVLVL+PFSMLS LACLIFTL+DTGDRLSVALSLVLSMTMYVVIVSSNAPRSMR+LPV+GI+LLDQLGLLS+ATVLAVINNK+
Sbjct:   95 EERLVAQLLHRRSLVVRPNGHNNQSSNPVHVNITYNVVQILAFSQAEETLSISGWFTIKWTDPRLSWDPHAFDNIREVNVPSSKLWIPDVGVMNGKSSTDFDFSAGVRGRLTVNWEGEVTWMHGAVLDTTCPLDVSFFPFDYQTCFLILTPWQSSEQQLLLRPFSHGSAVDNSYLPNSNVSEWEIQSVHFSSKKYRSDLNVTYQYVSIGIHLKRQPLYFVVLVLVPFSMLSALACLIFTLDDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRTLPVLGIFLLDQLGLLSVATVLAVINNKL 396          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: A0A504YDR0 (Putative nachr subunit OS=Fasciola gigantica OX=46835 GN=FGIG_03463 PE=3 SV=1)

HSP 1 Score: 459.529 bits (1181), Expect = 1.181e-149
Identity = 211/302 (69.87%), Postives = 261/302 (86.42%), Query Frame = 2
Query:  209 EEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKV 1111
            EE L+  +L +R+L VRPN   +  +NPV+VNITYNV+QILAFSQAEET+SISGWFTI W+D RL W+   + N+  V++P+  +W+PD+G+MN K+S +FDFS   + R++V  +G +TW+HGA+LD TCPLDV FFPFD QTC+L++TPWQSS++Q+L+ P+  GSAVDNSYLPNSNVSEWEI++VHF  K+YRSDLNVTYQY+ + IHL+RQPLYFVVLVL+PFSMLS LACLIFTL+DTGDRLSVALSLVLSMTMYVVIVSSNAPRSMR+LPV+GI+LLDQLGLLS+ATVLAVINNK+
Sbjct:   95 EERLVAQLLHRRSLVVRPNGHNNQSSNPVHVNITYNVVQILAFSQAEETLSISGWFTIKWTDPRLSWDPHAFDNIREVNVPSSKLWIPDVGVMNGKSSTDFDFSAGVRGRLTVNWEGEVTWMHGAVLDTTCPLDVSFFPFDYQTCFLILTPWQSSEQQLLLRPFSHGSAVDNSYLPNSNVSEWEIQSVHFSSKKYRSDLNVTYQYVSIGIHLKRQPLYFVVLVLVPFSMLSALACLIFTLDDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRTLPVLGIFLLDQLGLLSVATVLAVINNKL 396          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: A0A4S2MMC4 (Neur_chan_LBD domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000207 PE=3 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 1.212e-148
Identity = 209/304 (68.75%), Postives = 261/304 (85.86%), Query Frame = 2
Query:  203 SYEEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKV 1111
            S EE+L+  +L + +L VRPN   +   +PV V+ITYNVIQILAFSQAEETMSISGWFTI W D RL W+ +++ ++  V++P+  +W+PD+G+MN K+S +FDFS   + R+++ S G +TWLHGA+LD TCPLDV FFPFD QTC+L++TPWQS+++Q+L+ P+  GSAVDNSYLPNSNVSEWEI++VHF  ++YRSDLNVTYQY+ + IHLRRQPLYFVVLVL+PFSMLS LACLIFTL+DTGDRLSVALSLVLSMTMYVVIVS+NAPRSMR+LPV+GI+LLDQLGLLS+ATVLAVINNK+
Sbjct:   13 SAEEKLVAQLLNRGSLTVRPNGHNNKTTSPVFVDITYNVIQILAFSQAEETMSISGWFTIKWRDPRLTWDPQEFSDIAEVNVPSGQLWIPDVGVMNGKSSTDFDFSAGVRGRLTLSSQGEVTWLHGAVLDTTCPLDVAFFPFDYQTCFLILTPWQSNEQQLLLRPFTHGSAVDNSYLPNSNVSEWEIQSVHFSSRKYRSDLNVTYQYVSIGIHLRRQPLYFVVLVLVPFSMLSALACLIFTLDDTGDRLSVALSLVLSMTMYVVIVSTNAPRSMRTLPVLGIFLLDQLGLLSIATVLAVINNKL 316          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: A0A4Z2CP49 (Neuronal acetylcholine receptor subunit alpha-6 isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_008662 PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.072e-148
Identity = 206/302 (68.21%), Postives = 261/302 (86.42%), Query Frame = 2
Query:  209 EEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKV 1111
            EE+L+  +L + +L VRPN   +   NPV+VNITYNV+QIL FSQ+EET+SISGWFT+ W+D RL WN E++  +  VS+P  ++W+PD+G+MN K S +FDFS   + R++V +DG +TWLHGA+LDVTCPLDV FFPFD QTC+L++ PWQS ++Q+L+ P+  GSAVDNSYLPNSNVSEWEI++VHF RK+YRSD+NVTYQY+ ++IHL+RQPLYF+VLVL+PFSMLS LACLIFTL+DTGDRLSVALSLVLSMTMYVVIVS+NAPRSMR+LPV+GI+LLDQLGLLS+AT+LAV+NNK+
Sbjct:   89 EEKLVAQLLNRGSLTVRPNGYMNQSTNPVHVNITYNVVQILGFSQSEETLSISGWFTMRWTDPRLTWNPEEFSEIQEVSLPTTNLWIPDVGVMNGKASTDFDFSAGVRGRVTVNNDGSVTWLHGAVLDVTCPLDVSFFPFDYQTCFLILVPWQSGEQQLLLQPFTHGSAVDNSYLPNSNVSEWEIQSVHFVRKKYRSDMNVTYQYVSIAIHLKRQPLYFIVLVLVPFSMLSALACLIFTLDDTGDRLSVALSLVLSMTMYVVIVSTNAPRSMRTLPVLGIFLLDQLGLLSIATILAVMNNKL 390          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: chrne (acetylcholine receptor subunit gamma-like [Source:NCBI gene;Acc:103030399])

HSP 1 Score: 141.354 bits (355), Expect = 8.491e-36
Identity = 92/347 (26.51%), Postives = 181/347 (52.16%), Query Frame = 2
Query:  209 EEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVI--TPWQSSDKQMLI-------HPYQLGSAVDNSYLPNSNVSEWEIR---AVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL--EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSL--ATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPII 1201
            EE  L   + +N      P R H  + V V +   +  +++ ++ EET++ + W  I W+D RL WN+  Y +++ + +P   +WLPDI + N  + K FD +  A   + + SDG + WL  AI   TC +++ +FPFD Q C LV     + +++  M++        P +       ++  N    EW I+   A      RY  D ++ YQ +  ++ ++R+PL++++ +++P +++S L  L + L  +  G +L+V++S++L+ T+++++VS   P +  S+P+IG YL+  + + +L     + V+N  +R       S++ K       P +   +P++
Sbjct:   28 EESKLIADKFKNYNKNIRPAR-HTEDKVQVQVKLTLTNLISLNEKEETLTTNVWIEIQWNDYRLAWNTSDYHDISLIRVPYNTVWLPDIVLENNIDGK-FDVAYYAN--VLIYSDGSMYWLPPAIYRSTCAIEITYFPFDWQNCTLVFRSQTYSANEIDMILAIDGDTQKPIEWVDIDPEAFTEN---GEWAIKHRPARKLTNTRYSPD-DLEYQEVYFNLIIQRKPLFYIINIILPCALISSLVVLAYFLPAQAGGQKLTVSISVLLAQTVFLILVSQKVPETSLSVPLIGKYLIFVMSVTTLIVTNCIVVLNFSLRSPNTHTMSRTLKHIFLEVVPRFLGMAPLV 366          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 138.658 bits (348), Expect = 2.743e-35
Identity = 104/403 (25.81%), Postives = 188/403 (46.65%), Query Frame = 2
Query:  182 SFCNVPQSY------EEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI------NNKVRYFKVSPESKS------------RKQPTGYRCPEYNNDSPIIQLQNSKNRMNDA-NHKINKKFNADYNFSKSYANNSVR 1309
            S    P+ Y      E+ LL N+ R     VRP     H  + + V     + Q++   +  + M+ + W    W+D +L W+ E YG + ++ +P++++WLPDI +    + +   F     ++  V+ DG ITW   A    +C +DV FFPFD Q C +    W + D  M +    +   VD     ++   EWEI     +R   R D   +Y ++  S  L+R PL++ + ++IP   LS L  L+F L  D G++LS++ S+++S+T++++++    P S + +P+IG YLL  +  ++ + ++ V        +   Y  ++P  KS                  YR P+    SP ++    + +   A    + ++ N  +      A +SVR
Sbjct:    3 SLSPAPEEYVSLAELEDTLLRNVFRGYQKWVRPV---FHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGR---FEGSLMTKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW-TYDGTM-VDLALVDQHVDRKDFFDNG--EWEILDATGRRGS-RRDGIYSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMHGHTDRYRYPDMELHSPELKRGMKRGQQRSACGVGVKEEENQAWMSMLEKATSSVR 394          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: chrnb3a (cholinergic receptor, nicotinic, beta polypeptide 3a [Source:ZFIN;Acc:ZDB-GENE-040108-1])

HSP 1 Score: 138.658 bits (348), Expect = 3.030e-35
Identity = 105/410 (25.61%), Postives = 190/410 (46.34%), Query Frame = 2
Query:  161 LSSIILRSFCNVPQSY------EEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI------NNKVRYFKVSPESKS------------RKQPTGYRCPEYNNDSPIIQLQNSKNRMNDA-NHKINKKFNADYNFSKSYANNSVR 1309
            L    + S    P+ Y      E+ LL N+ R     VRP     H  + + V     + Q++   +  + M+ + W    W+D +L W+ E YG + ++ +P++++WLPDI +    + +   F     ++  V+ DG ITW   A    +C +DV FFPFD Q C +    W + D  M +    +   VD     ++   EWEI      R+  R D   +Y ++  S  L+R PL++ + ++IP   LS L  L+F L  D G++LS++ S+++S+T++++++    P S + +P+IG YLL  +  ++ + ++ V        +   Y  ++P  KS                  YR P+    SP ++    + +   A    + ++ N  +      A +SVR
Sbjct:   10 LLCFFMFSLSPAPEEYVSLAELEDTLLRNVFRGYQKWVRPV---FHANDTIAVRFGLKISQLVDVDEKNQLMTTNVWLWQEWTDYKLRWDPEDYGGITSIRVPSENIWLPDIVLYENADGR---FEGSLMTKAIVKYDGTITWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW-TYDGTM-VDLALVDQHVDRKDFFDNG--EWEILDAT-GRRGSRRDGIYSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTFSIIVTVFVINVHHRSSATYHPMAPWVKSLFLQRLPRLLCMHGHTDRYRYPDMELHSPELKRGMKRGQQRSACGVGVKEEENQAWMSMLEKATSSVR 408          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 137.887 bits (346), Expect = 5.329e-35
Identity = 93/359 (25.91%), Postives = 169/359 (47.08%), Query Frame = 2
Query:  182 SFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPW--QSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI------NNKVRYFKVSPESKS------------RKQPTGYRCPEYNNDSP 1195
             F ++ +  +  L ++ +     VRP     H  N V V     + Q++   +  + M+ + W    W D +L WN E YG +  + +P++ +WLPDI +    + +   F     ++  ++ +G +TW   A     C +DV FFPFD Q C +    W    +   M++  YQ+       +  N    EWEI +     K  R D  ++Y ++  S  L+R PL++ + ++IP   LS L  L+F L  D G+++S++ S+++S+T++++++    P S + +P+IG YLL  +  ++L+ ++ V        +   Y  +SP  +S            R     Y  PE    SP
Sbjct:   26 EFVSLAEREDALLRDLFQGYQRWVRPT---QHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLYENADGR---FEGSLMTKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDMVLMNYQVDR---RDFFDN---GEWEILSAT-GMKGNRRDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQRLPHLLCMRGHTDRYHYPELEPQSP 371          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:103031723])

HSP 1 Score: 137.887 bits (346), Expect = 6.474e-35
Identity = 93/359 (25.91%), Postives = 169/359 (47.08%), Query Frame = 2
Query:  182 SFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPW--QSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI------NNKVRYFKVSPESKS------------RKQPTGYRCPEYNNDSP 1195
             F ++ +  +  L ++ +     VRP     H  N V V     + Q++   +  + M+ + W    W D +L WN E YG +  + +P++ +WLPDI +    + +   F     ++  ++ +G +TW   A     C +DV FFPFD Q C +    W    +   M++  YQ+       +  N    EWEI +     K  R D  ++Y ++  S  L+R PL++ + ++IP   LS L  L+F L  D G+++S++ S+++S+T++++++    P S + +P+IG YLL  +  ++L+ ++ V        +   Y  +SP  +S            R     Y  PE    SP
Sbjct:   26 EFVSLAEREDALLRDLFQGYQRWVRPT---QHSNNTVRVRFGLKISQLVDVDEKNQLMTTNVWLWQEWIDYKLRWNPEDYGGITFIRVPSESIWLPDIVLYENADGR---FEGSLMTKAIIKYNGAVTWTPPASYKSACTMDVTFFPFDRQNCSMKFGSWTYDGTMVDMVLMNYQVDR---RDFFDN---GEWEILSAT-GMKGNRRDGTLSYPFVTYSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKVSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQRLPHLLCMRGHTDRYHYPELEPQSP 371          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 143.665 bits (361), Expect = 1.077e-37
Identity = 95/310 (30.65%), Postives = 157/310 (50.65%), Query Frame = 2
Query:  188 CNVPQSYEEELLNILRKRNLK-----VRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVD-NSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAV 1096
              VP     EL + L KR LK     VRP       ++ V V     + Q++   +  + M+ + W    W D  L WN + YG +N++ +PA  +WLPDI + +  + + F+ S + ++   V+ DGRI W   AI   +C +DV FFPFD Q C +    W       L+    + S VD   Y  N    EWE        K  R D +  Y YI  S  +RR PL++ + +++P   LS L   +F L  D G+++S+  S+++S+T++++++    P S + +P+IG YLL  +  ++L+ ++ V
Sbjct:   24 AQVPSLSLAELEDRLLKRMLKDYQKWVRP---VDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGR-FEGSIVTKA--VVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGT--LVDLIMVNSDVDRGEYFDN---GEWEFLNAT-GNKGVRLDGHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITV 321          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 130.954 bits (328), Expect = 4.944e-33
Identity = 81/321 (25.23%), Postives = 165/321 (51.40%), Query Frame = 2
Query:  281 ANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAV-HFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPIIQLQNSKNRMNDA 1237
            ++PV V    ++ Q++   +  + M+ + W    W+D + +WN  ++  +  + +P+  +W PDI +    N+ + DF    +++  ++ DG + W+  AI   +C +DV +FPFD Q C +    W     +  I    +G+ ++      S   EW I  V  +K     +     Y  I  S+++RR PL++ + ++IP  ++S L  L+F L  D G+++++++S++LS+T+++++++   P +   +P+IG YLL  +  ++L+ V+ +    V Y   +PE+ +   P   R    +    I+ LQ  K  +  A
Sbjct:   30 SDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLY---NNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAK--IDLVLVGTKINLKDFWESG--EWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHY--RTPEAHT--MPNWVRRVFLDTLPKIMLLQPPKGSVGTA 339          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 112.849 bits (281), Expect = 5.686e-27
Identity = 78/307 (25.41%), Postives = 157/307 (51.14%), Query Frame = 2
Query:  209 EEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSA--------VDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI 1099
            EE LL ++   +  K    P R+     V V +   + Q+++    +  M++S   ++ W D RL W+   Y NL ++ +  + +WLPDI + N  N  NFDF       + V+  G + W+  +I   +C + V++FPFD Q C +V   +     ++ +  Y L           +D S  P S   EW+I+  H   ++  +  +  YQ I   + + R+PL++++ +++P  +++  A   F L  D G+++ + +S++L++T+++++++   P +   +PVI  YL+  + +++   +L VI
Sbjct:   24 EENLLKDLFVVQQYKTLVRPARTATGR-VTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSN-NNDGNFDFGLYVH--VLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLE-YALDEHRQEIRHIIIDESTFPVSG--EWQIK--HKPSRKNTNPRDPLYQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVI 321          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 108.997 bits (271), Expect = 2.012e-25
Identity = 72/258 (27.91%), Postives = 138/258 (53.49%), Query Frame = 2
Query:  338 QAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVH----FKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAV 1096
            +  + M+ + W    W D +L+W+  +Y N+ ++ +P++ +W+PDI +    N+ + DF+    ++  +   GR+ W   AI   +C +DV FFPFD Q C +    W     ++ +    +  A D          EW I  VH    +  K+Y     V Y  I  S  +RR PL++ + ++IP  ++S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P+IG YLL  +  ++L+ V+ V
Sbjct:   15 EKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLY---NNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL----VSMARDVDLKDYWESGEWAI--VHAVGTYNTKKYDCCPQV-YPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITV 262          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 8.340e-24
Identity = 68/240 (28.33%), Postives = 124/240 (51.67%), Query Frame = 2
Query:  452 QDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSS----DKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKR-YRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQ 1153
              +W PDI + N  + +   F     + + V   G    L   +L  TC +DVR+FPFDVQ C L    W       D QML        A  + Y+ N    EW++  +  KR   Y       Y  +  ++ +RR+ LY+ + +L+P  ++S L+ L+F L  D+G+++S+ ++++LS+T+++++V+   P +  S+P+IG Y    + +++ + V+ VI   ++Y   +P+ K   Q
Sbjct:   14 HQIWTPDILLYNSADER---FDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQML-------EADTSGYIANG---EWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVI--VLQYHHHNPDGKKMPQ 238          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO32053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW63])

HSP 1 Score: 129.413 bits (324), Expect = 1.720e-33
Identity = 77/277 (27.80%), Postives = 150/277 (54.15%), Query Frame = 2
Query:  284 NPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKR--KRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQL--GLLSLATVLAVI 1099
            +PV + +   + Q++  ++ ++ ++I+ W    W D+ L+WN + +G + +++I    +W PD+ + N  + +    +    + + V  DG  TWL  AI+   C +DVRFFPFDVQ+C L    W     ++ IH  Q  S +D      S+  EW ++    +R  K Y       Y  +  +I LRR+ +++V  +++P  +++ L+   F L  ++G+R+S  ++++L+M++Y+++V+ N PRS   +P++  + +  +    LSLA    VI
Sbjct:   24 DPVQLKLGIMLRQVIDLNERDQILTINVWIRQYWKDHLLKWNPDDFGGIKSINIAPDRVWKPDVLLYNRTDLRFGSLNNKIDTNVIVNHDGSTTWLAPAIIKSECKIDVRFFPFDVQSCELTFGSWTHDGLKIDIHLKQ-ESGIDTENF--SDNREWFLKGTSGRRDVKMYIC-CPEPYPTVTYTIILRRRAMFYVFNMVLPTGVIALLSLFSFYLPPNSGERVSFVITVLLAMSVYLIMVTENIPRST-DIPLVSKFFMASMIQIALSLAATCVVI 295          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO37425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX0])

HSP 1 Score: 126.331 bits (316), Expect = 1.585e-32
Identity = 78/302 (25.83%), Postives = 154/302 (50.99%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFST-IAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRK--RYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLE-DTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            ++L + + ++RP     + + PVNV +   +  ++   + ++ ++   W    W + R++W+ + +G +  V++   D+W PDI + N    + FD       + + V  +G   W    I    C + V+ FPFD+Q C L    WQ    ++ +H  +    +DN+ + N    EW++  V   R    Y    +V Y  I   + LRR+ L+++  ++IP  +++ LA   F +  + G+R+S  ++++LSMT+++++V+ + P +  +LP I +Y    + L++LA V   I  KV Y
Sbjct:    8 DLLSRTSTRIRP---VENTSRPVNVTMDMTLSNVIDIDEKQQILTSCVWMRQEWINERMQWDPKLFGGIKDVTLHTSDIWQPDIVLYN-NVFEEFDGRLDHVSTLVRVYYNGSTHWNAPFIFKTLCKIQVKNFPFDLQECTLKFGSWQYDSSEIDLHYVKTEGKLDNTRVRNG---EWDVIRVKITRNALSYPCCPDVVYPDITFIVQLRRRSLFYIFNLIIPNFLIALLAFFSFYIPIECGERISFVITVLLSMTVFLLLVAESIPPTSEALPAIALYYTSSMILVALALVATGITLKVNY 302          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO49734 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFJ5])

HSP 1 Score: 126.331 bits (316), Expect = 2.359e-32
Identity = 84/313 (26.84%), Postives = 160/313 (51.12%), Query Frame = 2
Query:  200 QSYEEELLNIL---RKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQ--SRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPW--QSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVT-YQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIY---LLDQLGLLSLATVLAVIN 1102
            QSY++ LL  L     R++    N       NPV V     + +I A  +    +    +    W +  L WN+ ++G +N + +    +W+PDI + N  + KN D +   Q  ++I +++DG + WL  A+    CP+D+R+FPFD Q+C L    W   +S  +M I       A +   +      EWEI  +  K+KR +       Y+ + +++ L R+P Y+++ ++ P S+++ +  L F L  ++G+R+S+ ++++++M+++  + S+  P S  +  ++G+Y    +  +G L LA    VIN
Sbjct:    3 QSYQQILLRYLFTNYDRDIHPGGN-------NPVVVTFGAKLGRIAAVDEKNNVVLAHWYLKQKWVNPSLSWNASEFGGVNTLHVEPDRLWVPDIVLYNNADPKN-DLAGGFQYKTKIEMQADGTMIWLAPAMFHSACPMDIRYFPFDEQSCDLQFASWMYDTSKLEMKI------DANETKVMDTFTNKEWEIPKLTIKKKRIKYTCCPNPYEDVTITMSLVRRPYYYIMNMIFPCSLIACMTYLTFILPAESGERISLCITVLMAMSIFQELTSNKLPPSSETFFLLGVYYTVTISAIG-LGLAATCIVIN 300          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO46124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR86])

HSP 1 Score: 128.642 bits (322), Expect = 4.882e-32
Identity = 79/301 (26.25%), Postives = 153/301 (50.83%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKR------YRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIY---LLDQLGLLSLATVLAV 1096
            +I ++  L     P ++H + P+ V       Q++      + M+   W    WS+ RL W+  KYG   +V++    +WLPDI + N  NS          +++ + + G I W    ++   C +D+ +FPFD Q C LV   W  + + + +   Q    + + Y PN    +WE+     KR        Y   ++VTY     ++H+RR+PL+FV+ +++P  +L+ L+   F+L   +G+R+++ ++L+L +T+Y++I + N P++    P+I  +   +L ++ +  LAT + +
Sbjct:   37 DITKEYELNKEILPIKNH-SQPIKVIFDIAFAQLVELDSKNQIMTSYIWVRQFWSNTRLRWDPSKYGGQTSVNLSPHLIWLPDIVLYNNINSNTIGEMFKFDTKVVLHNTGAIEWYAPTLVKSICKIDITYFPFDKQNCSLVFGSWTYTSEFLSLDIKQKEPDL-SKYTPN---GQWEMMHAEVKRNVVKYSCCYWPYIDVTY-----TVHIRRRPLFFVLNLILPCILLATLSVFSFSLPPGSGERIALVITLLLGLTVYMLIFTENIPKTSEVTPLINKFFNVVLFEVAICLLATSITL 327          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO36173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF7])

HSP 1 Score: 123.25 bits (308), Expect = 2.289e-31
Identity = 76/291 (26.12%), Postives = 147/291 (50.52%), Query Frame = 2
Query:  275 HCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMN---VKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPY-QLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVT-----YQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLE-DTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            H + P+NV+    + +++  +   + +    W T  W +  L WN  +YG ++++ +   D+W+PD  + N   V +     F T     + VESDG  TW+  A    +C LDV FFPFD Q C +V   W    + + +    QL S  D+ +  N    +W++  +  +++    D N T     +  I  S  L R PLY V+ V++P  +++ L  + F +  + G+R+ + ++++L+M++Y+ +V+ + P +  ++P++GIY +  +  +  A V   +  +  Y
Sbjct:   28 HPSLPLNVSFNMQLSKLVDLNTKSQILQTDVWITQKWVNPFLTWNVSEYGGVHSIHVSPLDVWVPDTVLYNRCVVLSGSVEKFKT----DVVVESDGLCTWMSPATFKSSCVLDVTFFPFDTQVCSMVFGSWTYDTRLLRLELMAQLHSNADH-FTVN---GDWKVENISLRQR----DTNYTCCAHPFSDIVFSFALERLPLYHVIYVVLPCVIIAALTLVCFYVPVECGERIGLCITILLAMSVYLFVVAQSLPENSNTIPLLGIYYMATMCQVGAAIVATAVVLRCHY 306          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: chrnb3b (neuronal acetylcholine receptor subunit non-alpha-2 [Source:NCBI gene;Acc:101162690])

HSP 1 Score: 142.124 bits (357), Expect = 2.513e-36
Identity = 98/368 (26.63%), Postives = 179/368 (48.64%), Query Frame = 2
Query:  179 RSFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVI------NNKVRYFKVSPESKS------------RKQPTGYRCPEYNNDSPIIQLQNSKNR 1225
            + F ++ +  ++ L N+ +     VRP        + V V     + Q++   +  + M+ + W    W D +L WN +KYG + ++ +P++++WLPDI +    + K   F     ++  V+ +G +TW+  A     C +DV FFPFD Q C +    W + D  M +    + S VD     ++   EWEI +     K  R D    Y +I  S  L+R PL++ + ++IP   LS L  L+F L  D G++LS++ S+++S+T++++++    P S + +P+IG YLL  +  ++L+ ++ V        +   Y  +SP  +S            R     Y  PE   +SP ++ ++   R
Sbjct:   25 KRFVSLAEMEDDLLKNLFQGYQRWVRPI---QRPNDTVRVRFGLKISQLVDVDEKNQLMTTNVWLRQEWIDYKLRWNPDKYGGITSIRVPSENIWLPDIVLYENADGK---FEGSLMTKAIVKFNGAVTWMPPASYKSACTMDVTFFPFDRQNCSMKFGSW-TYDGNM-VDLVLMDSQVDRKDFFDNG--EWEILSAT-GAKGNRKDGLYFYPFITCSFILKRLPLFYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSSATYHPMSPWVRSLFLQKLPRLLCMRGHADRYHYPELAPESPALKSRSGGRR 381          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: ENSORLT00000017941.2 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:101168601])

HSP 1 Score: 139.813 bits (351), Expect = 1.619e-35
Identity = 83/300 (27.67%), Postives = 158/300 (52.67%), Query Frame = 2
Query:  224 NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWE-IRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
             + R+ N  +RP     + ++PV V    ++ Q++   +  + M  + W   +W+D +L W   ++  +  + +P+  +W PDI + N  N+   DF    +++  ++ DG ITW+  AI   +CP+D+ +FPFD Q C +    W     +  I    +GS V+      S   EWE I A  +K     +     Y  I  S ++RR PL++ + ++IP  ++S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P+IG YLL  +  ++L+ V+ V    V Y
Sbjct:   35 KLFRRYNQFIRP---VENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLRWTPAEFDGIEFIRVPSNKIWRPDIVLYN--NAVG-DFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAK--IDLVLIGSKVNLKDFWESG--EWEIIDAPGYKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHY 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: chrna6 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:101162933])

HSP 1 Score: 140.584 bits (353), Expect = 3.196e-35
Identity = 81/281 (28.83%), Postives = 151/281 (53.74%), Query Frame = 2
Query:  281 ANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWE-IRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRY 1117
            ++PV V    ++ Q++   +  + M  + W   VW+D +L+W   +Y  +  + +P+  +W PDI + N  N+   DF    +++  ++ DG ITW+  AI   +CP+D+ +FPFD Q C +    W     +  I    +GS V+      S   EWE I A  +K     +     Y  I  S ++RR PL++ + ++IP  ++S L  L+F L  D G+++++ +S++LS+T+++++++   P +   +P+IG YLL  +  ++L+ V+ V    V Y
Sbjct:   85 SDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHVWNDYKLKWTPAEYDGIEFIRVPSNRIWRPDIVLYN--NAVG-DFLVADKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAK--IDLVLIGSKVNLKDFWESG--EWEIIDAPGYKHDIKYNCCEEIYTDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHY 358          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: ENSORLT00000016544.2 (neuronal acetylcholine receptor subunit alpha-10-like [Source:NCBI gene;Acc:101157879])

HSP 1 Score: 139.813 bits (351), Expect = 3.493e-35
Identity = 91/309 (29.45%), Postives = 167/309 (54.05%), Query Frame = 2
Query:  182 SFCNVPQS-YEEELLN-ILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKR-YRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL-EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAV 1096
            S C+  Q  + ++LLN +       +RP        N +NV +   + QI+   +  + ++   W   VW D  L W  E Y  L+ + IP+  +W PDI + N   S N +FS+  ++ + + +DG++ W   AI   +C +DV FFPFDVQ C+L    W  +  QM +    L SA  + ++PN    EWE+  +  K+        +  Y  I  +++L+R+  +++  +LIP  M+S LA L F L  D+G+++S+ ++++L++T++ ++V+ + P S  S+P+IG Y +  + +++ +T L +
Sbjct:   19 SVCSAAQGRFAQKLLNDLFSNYTSALRP---VEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWMDAFLSWRKEDYDGLDTIRIPSSLVWRPDIVLYN---SANDEFSSSMETNVVLRNDGQVMWDQPAITKSSCSVDVAFFPFDVQQCHLTFGSWTHNGNQMDLF-NALDSADLSDFVPN---VEWEVLGMPAKKNVILYGCCSDPYPDITFTLNLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPPS-ESVPLIGKYYIATMTMVTASTALTI 316          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: chrne (acetylcholine receptor subunit gamma [Source:NCBI gene;Acc:101166241])

HSP 1 Score: 136.346 bits (342), Expect = 4.681e-34
Identity = 96/365 (26.30%), Postives = 181/365 (49.59%), Query Frame = 2
Query:  209 EEELL-NILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYL---PNSNVSEWEIRAVHFKRK-----RYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTL--EDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATV--LAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPIIQLQNSKNRMNDANHKINKKFN 1264
            E +L+ ++ R  N  +RP     H  + V V I   +  +++ ++ EET++ + W  I W+D RL WN+ +Y  +  + +P   +WLPDI + N  + K FD +  A   IS  ++G + WL  AI   TC +++ +FPFD Q C L       S K++ +        V   ++   P +     E   VH   +     RY  D ++ YQ I  ++ ++R+PL++++ V++P S++S L  L + L  +  G +L+V++S++L+ T+++ +++   P +  ++P+IG YL+  + + +L     + V+N  +R       S S K       P +   SP++        +N    +    F 
Sbjct:   29 ESQLIGDLFRNYNKNIRP---VEHPEDKVQVMIKLTLTNLISLNEKEETLTTNVWIEIQWTDYRLVWNTSQYYGIKTIRVPYNTVWLPDIVLENNIDGK-FDVAYYANVLIS--NEGWMYWLPPAIYRSTCAIEITYFPFDYQNCTLAFRSQTYSAKEVDLVLATGDEDVTIEWVDIDPEAFTENGEWAIVHRPARKVINTRYSPD-DLEYQEIIFNLVIQRKPLFYIINVILPCSLISSLVVLAYFLPAQAGGQKLTVSISVLLAQTVFLFLIAQKTPETSLAVPLIGKYLIFVMCVTTLIATNQIVVLNFSLRSPSTHTMSYSIKHLCLEMVPRFLGMSPLVDDSEVTAEVNGIRERRRSSFG 386          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000043840.1 (SMESG000043840.1)

HSP 1 Score: 927.546 bits (2396), Expect = 0.000e+0
Identity = 471/471 (100.00%), Postives = 471/471 (100.00%), Query Frame = 2
Query:  134 MNYLFSVFVLSSIILRSFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPIIQLQNSKNRMNDANHKINKKFNADYNFSKSYANNSVRVNFNVAXXXXXXXXXXXXXXXXDFLPLYQPRGVNIYKDLADRFDKIEMVTYLIISFINGVFCLIVVPSYFQDVNLNPPD 1546
            MNYLFSVFVLSSIILRSFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPIIQLQNSKNRMNDANHKINKKFNADYNFSKSYANNSVRVNFNVANSLSRNSSPSTSLSSTDFLPLYQPRGVNIYKDLADRFDKIEMVTYLIISFINGVFCLIVVPSYFQDVNLNPPD
Sbjct:    1 MNYLFSVFVLSSIILRSFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPIIQLQNSKNRMNDANHKINKKFNADYNFSKSYANNSVRVNFNVANSLSRNSSPSTSLSSTDFLPLYQPRGVNIYKDLADRFDKIEMVTYLIISFINGVFCLIVVPSYFQDVNLNPPD 471          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000052669.1 (SMESG000052669.1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 299/493 (60.65%), Postives = 368/493 (74.65%), Query Frame = 2
Query:  128 RSMNYLFSVFVLSSIILRSFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYNNDSPIIQLQNSKNRMNDA-NHKINKKF-------------------NADYNFSKSYANNSVRVNFNVAXXXXXXXXXXXXXXXXDFLPLYQPRGVNIYKDLADRFDKIEMVTYLIISFINGVFCLIVVPSYFQDVNLNPPD 1546
            + +++ F + ++ S+  +    +   +EE L+  +   NL +RP  C  HC+ PV VNITYNVIQILAFSQ+EET+SISGWFT+VW D RL+WN   YGNL+++SI A+DMWLPDIG+MNVK+SKNFDFSTIAQSRISV+  G +TWLHGA+LDVTCPLDV FFPFD QTCYLVI PWQSS+KQ++I+P Q GSAVDNSYLPNSNVSEW+I A+ F  K+YRSDLNV+YQYIRVSIHL+RQPLYFVVLVLIPFSMLSGLACLIFTL+DTGDRLSVALSLVLSMTMYVVIVSSNAPRSMR LPVIGIYLLDQLGLLSLATVLAVINNK+RY K  P++KS+     YRCP++  DSPI++L+  +   N++  +K +K F                   N D   S S+ N  + +N++               SS  ++  Y      +Y++LAD+ DK +MV YL ISFING+FCL+++P YFQ+  LNPPD
Sbjct:   16 QRISFFFQLLLVVSVFFKETTQI--GFEEGLIKRIENINLHIRPPVCEDHCSKPVKVNITYNVIQILAFSQSEETLSISGWFTVVWKDLRLQWNQAVYGNLSSISILAKDMWLPDIGVMNVKHSKNFDFSTIAQSRISVDYTGVVTWLHGAVLDVTCPLDVSFFPFDYQTCYLVINPWQSSEKQIIIYPVQRGSAVDNSYLPNSNVSEWQIEAIDFTPKKYRSDLNVSYQYIRVSIHLKRQPLYFVVLVLIPFSMLSGLACLIFTLDDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRRLPVIGIYLLDQLGLLSLATVLAVINNKIRYLKSLPKTKSKSH--QYRCPDFTVDSPIMELRKYRMSCNNSFGYKNSKNFRFSIKSSFKSSKENLSKPNNVDNEISGSFPN--IPLNYS-------------EFSSEKYIRKY------VYRELADKLDKFQMVIYLFISFINGIFCLLIMPRYFQNSTLNPPD 483          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000077071.1 (SMESG000077071.1)

HSP 1 Score: 475.322 bits (1222), Expect = 4.108e-165
Identity = 243/433 (56.12%), Postives = 302/433 (69.75%), Query Frame = 2
Query:  245 LKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVR-------YFKVSPESKSRKQPTGYRCPEYNNDSPIIQLQNSKNRMNDANHKINKKFNADYNFSKSYANNSVRVNFNVAXXXXXXXXXXXXXXXXDFLPLYQPRGVNIYKDLADRFDKIEMVTYLIISFINGVFCLIVVPSYFQ 1522
            L VRPN CR HC NPV VNITYNVIQILAFSQAEET+ ISGWFT+ W D RL WN + YG+++ VS+ ++++W PD+G+MN K S++FDFS I QSRISV+  G I WLHGAILDVTCPLDVR+FPFD QTCYL++TPWQSS KQM+I P Q GSAVDNSYLPNSNVSEWEI  V F +K Y S ++  YQ+I +SI L+RQPLYF+VLVL+PFSMLSGLACLIFTL DTGDRL+VALSLVLSMTMYVVIVS+NAPRSMR+LPV+G+YLL+QLGLLS+AT+LAV+NNK+R           +P    R  P  YRC +  N+SPI  L+  K  +   N+ +  +            N  ++V+ + +                             Y  LAD+ D IE+  YLI+S +N + CL+++P   Q
Sbjct:    9 LTVRPNACRVHCNNPVIVNITYNVIQILAFSQAEETLKISGWFTVEWMDFRLRWNPKYYGDIDTVSLNSKNLWRPDVGVMNGKASEDFDFSNIPQSRISVKHTGNIYWLHGAILDVTCPLDVRYFPFDKQTCYLILTPWQSSIKQMVIEPVQHGSAVDNSYLPNSNVSEWEIVDVKFSKKTYESQISEVYQFISISISLKRQPLYFIVLVLVPFSMLSGLACLIFTLSDTGDRLTVALSLVLSMTMYVVIVSTNAPRSMRTLPVLGVYLLNQLGLLSVATILAVVNNKLRDNNRYSDMISTNPNEIYRG-PMNYRCYDQCNESPIKSLR--KQSIIACNYAMRHRATVCLP-----GNGGLKVSNSAS-----------------------------YIRLADKMDHIELTIYLILSLLNAIVCLLIMPRVSQ 404          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000077071.1 (SMESG000077071.1)

HSP 1 Score: 475.322 bits (1222), Expect = 5.029e-165
Identity = 243/433 (56.12%), Postives = 302/433 (69.75%), Query Frame = 2
Query:  245 LKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVR-------YFKVSPESKSRKQPTGYRCPEYNNDSPIIQLQNSKNRMNDANHKINKKFNADYNFSKSYANNSVRVNFNVAXXXXXXXXXXXXXXXXDFLPLYQPRGVNIYKDLADRFDKIEMVTYLIISFINGVFCLIVVPSYFQ 1522
            L VRPN CR HC NPV VNITYNVIQILAFSQAEET+ ISGWFT+ W D RL WN + YG+++ VS+ ++++W PD+G+MN K S++FDFS I QSRISV+  G I WLHGAILDVTCPLDVR+FPFD QTCYL++TPWQSS KQM+I P Q GSAVDNSYLPNSNVSEWEI  V F +K Y S ++  YQ+I +SI L+RQPLYF+VLVL+PFSMLSGLACLIFTL DTGDRL+VALSLVLSMTMYVVIVS+NAPRSMR+LPV+G+YLL+QLGLLS+AT+LAV+NNK+R           +P    R  P  YRC +  N+SPI  L+  K  +   N+ +  +            N  ++V+ + +                             Y  LAD+ D IE+  YLI+S +N + CL+++P   Q
Sbjct:    7 LTVRPNACRVHCNNPVIVNITYNVIQILAFSQAEETLKISGWFTVEWMDFRLRWNPKYYGDIDTVSLNSKNLWRPDVGVMNGKASEDFDFSNIPQSRISVKHTGNIYWLHGAILDVTCPLDVRYFPFDKQTCYLILTPWQSSIKQMVIEPVQHGSAVDNSYLPNSNVSEWEIVDVKFSKKTYESQISEVYQFISISISLKRQPLYFIVLVLVPFSMLSGLACLIFTLSDTGDRLTVALSLVLSMTMYVVIVSTNAPRSMRTLPVLGVYLLNQLGLLSVATILAVVNNKLRDNNRYSDMISTNPNEIYRG-PMNYRCYDQCNESPIKSLR--KQSIIACNYAMRHRATVCLP-----GNGGLKVSNSAS-----------------------------YIRLADKMDHIELTIYLILSLLNAIVCLLIMPRVSQ 402          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000061997.1 (SMESG000061997.1)

HSP 1 Score: 452.595 bits (1163), Expect = 1.167e-154
Identity = 246/476 (51.68%), Postives = 315/476 (66.18%), Query Frame = 2
Query:  209 EEELLNILRKRN-LKVRPNPCRSHCANPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLNAVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAILDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLPNSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIPFSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLPVIGIYLLDQLGLLSLATVLAVINNKVR-YFKVS---PESKSRKQPTGYRCPE------YNNDSPIIQLQNSKNRMNDANHKINKKF--NADYNFSKSYANNSVRVNFNVAXXXXXXXXXXXXXXXXD-------------------FLPLYQP--------RGVNIYKDLADRFDKIEMVTYLIISFINGVFCLIVVPSY 1516
            EE+L+  L KR+ LKVRP  C   C   V VNITYNVIQILAFSQAEET SISGWFT+ W D RL W+ ++ GN+  V +P++ +WLPD+G+MN +N+K+FDFS  +QSR+SV  DG +TW+HG ILDV+CPLDV +FPFD QTCY+++TPWQS  KQ+L+ P Q GS VDNSYLPNSN+SEW I  V F  K Y S +N+TYQYI +SI ++RQPLYF++LVL+PFSMLSGLACLIFTL+D+GDRL+VALSLVLSMTMYVVIVSSNAPRSMR+LPV+ IYLL+QLGLLS++TVLAV+N K+R  +++S      ++R    GY   E      Y +DSP+  L+ +       N K    F  NA+ N   + A NS R   N+        S     +  D                   F  L+          R    YK LA++ D+ E+  YL IS IN + CL+++P Y
Sbjct:   35 EEKLITQLMKRHSLKVRPTAC-FQCTGAVIVNITYNVIQILAFSQAEETFSISGWFTLTWQDYRLNWSPKRNGNITQVFLPSEKLWLPDVGVMNGRNNKDFDFSAQSQSRMSVSHDGHVTWMHGVILDVSCPLDVSYFPFDSQTCYIILTPWQSHVKQILMVPVQHGSTVDNSYLPNSNISEWIILYVKFNYKTYVSQINITYQYISISIRVQRQPLYFIILVLVPFSMLSGLACLIFTLDDSGDRLTVALSLVLSMTMYVVIVSSNAPRSMRNLPVLCIYLLNQLGLLSVSTVLAVVNQKLREKYRLSFWQDYQQARTIFNGYYLEESPLMTDYCSDSPLATLKRAWQSQRYKNTKTETIFNSNAEDNLKSTQAYNSHRFK-NIVKENDNPKSQPIKTNKDDRKHPPKSSFDDEGNKKRPFFNELFDSDQNHKGNIRQQRYYKKLANKLDRWELAIYLFISLINAIICLVLMPHY 508          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA61.006e-3626.94cholinergic receptor nicotinic alpha 6 subunit [So... [more]
AC254952.12.697e-3628.77cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC254952.12.697e-3628.77cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNB35.326e-3626.11cholinergic receptor nicotinic beta 3 subunit [Sou... [more]
CHRNA78.743e-3628.42cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgc-41.894e-3830.18Ligand-gated ion channel 4 [Source:UniProtKB/Swis... [more]
acr-214.480e-3427.06pep chromosome:WBcel235:III:6583461:6586549:1 gene... [more]
acr-215.559e-3427.06pep chromosome:WBcel235:III:6581927:6586549:1 gene... [more]
acr-216.354e-3427.06pep chromosome:WBcel235:III:6583461:6586549:1 gene... [more]
acr-217.951e-3427.06pep chromosome:WBcel235:III:6581927:6586549:1 gene... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha21.034e-3527.16gene:FBgn0000039 transcript:FBtr0084639[more]
nAChRalpha21.034e-3527.16gene:FBgn0000039 transcript:FBtr0084640[more]
nAChRalpha12.088e-3126.14gene:FBgn0000036 transcript:FBtr0334916[more]
nAChRalpha12.088e-3126.14gene:FBgn0000036 transcript:FBtr0084619[more]
nAChRalpha13.800e-3126.14gene:FBgn0000036 transcript:FBtr0330310[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrne2.454e-3728.03cholinergic receptor, nicotinic, epsilon [Source:Z... [more]
chrne2.454e-3728.03cholinergic receptor, nicotinic, epsilon [Source:Z... [more]
chrnb3b8.030e-3626.25cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
CR847523.39.000e-3628.97neuronal acetylcholine receptor subunit alpha-10-l... [more]
chrna66.692e-3528.11cholinergic receptor, nicotinic, alpha 6 [Source:Z... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncaph7.936e-4128.49non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph8.661e-4128.49non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph1.384e-4028.49non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph3.140e-4028.38non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph6.103e-4028.33non-SMC condensin I complex subunit H [Source:Xenb... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna61.346e-3829.45cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna73.766e-3627.85cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna33.034e-3528.09cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna35.064e-3528.09cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna36.417e-3528.09cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8XNX8|LGC4_CAEBR2.372e-3830.53Ligand-gated ion channel 4 OS=Caenorhabditis brigg... [more]
sp|Q9R0W9|ACHA6_MOUSE9.413e-3829.45Neuronal acetylcholine receptor subunit alpha-6 OS... [more]
sp|P43143|ACHA6_RAT9.648e-3830.10Neuronal acetylcholine receptor subunit alpha-6 OS... [more]
sp|P54245|LGC4_CAEEL2.410e-3730.18Ligand-gated ion channel 4 OS=Caenorhabditis elega... [more]
sp|P13908|ACHN2_CARAU1.625e-3627.82Neuronal acetylcholine receptor subunit non-alpha-... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183W0X77.128e-15168.87Neur_chan_LBD domain-containing protein OS=Trichob... [more]
A0A4E0RUV17.154e-15069.87Neuronal acetylcholine receptor subunit alpha-6 OS... [more]
A0A504YDR01.181e-14969.87Putative nachr subunit OS=Fasciola gigantica OX=46... [more]
A0A4S2MMC41.212e-14868.75Neur_chan_LBD domain-containing protein OS=Opistho... [more]
A0A4Z2CP492.072e-14868.21Neuronal acetylcholine receptor subunit alpha-6 is... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrne8.491e-3626.51acetylcholine receptor subunit gamma-like [Source:... [more]
chrnb3a2.743e-3525.81cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3a3.030e-3525.61cholinergic receptor, nicotinic, beta polypeptide ... [more]
chrnb3b5.329e-3525.91neuronal acetylcholine receptor subunit non-alpha-... [more]
chrnb3b6.474e-3525.91neuronal acetylcholine receptor subunit non-alpha-... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b1.077e-3730.65cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna34.944e-3325.23cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb1l5.686e-2725.41cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
chrna2a2.012e-2527.91cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
ENSPMAT00000008550.18.340e-2428.33pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320531.720e-3327.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374251.585e-3225.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497342.359e-3226.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461244.882e-3226.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361732.289e-3126.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb3b2.513e-3626.63neuronal acetylcholine receptor subunit non-alpha-... [more]
ENSORLT00000017941.21.619e-3527.67neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrna63.196e-3528.83neuronal acetylcholine receptor subunit alpha-3 [S... [more]
ENSORLT00000016544.23.493e-3529.45neuronal acetylcholine receptor subunit alpha-10-l... [more]
chrne4.681e-3426.30acetylcholine receptor subunit gamma [Source:NCBI ... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043840.10.000e+0100.00SMESG000043840.1[more]
SMESG000052669.10.000e+060.65SMESG000052669.1[more]
SMESG000077071.14.108e-16556.12SMESG000077071.1[more]
SMESG000077071.15.029e-16556.12SMESG000077071.1[more]
SMESG000061997.11.167e-15451.68SMESG000061997.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017866 ID=SMED30017866|Name=Neuronal acetylcholine receptor subunit alpha-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1659bp
GGAAATATTGCCTTTTTATTGAAATTTACATTTGGCATTTCTTTCAACTT
TTGAACATTTTACGTGTTCGACCTATGGACTGCCGTATTATTTATTTGAA
TAATTCGATATAATTGGTAGGAAATCTCGGTCGATGAATTATTTATTTTC
AGTCTTCGTTTTATCAAGCATAATTCTGAGATCATTTTGTAATGTTCCAC
AGAGCTACGAAGAGGAATTATTAAATATTTTAAGAAAACGAAACCTGAAA
GTCCGGCCAAATCCTTGCCGTTCCCATTGCGCCAACCCAGTCAATGTTAA
TATTACATACAATGTCATACAGATCTTAGCTTTTTCTCAAGCGGAAGAAA
CAATGAGCATATCTGGATGGTTTACAATTGTGTGGAGTGATAACCGGCTT
GAATGGAATTCAGAGAAATATGGTAACCTAAATGCAGTTTCGATTCCTGC
TCAAGACATGTGGCTTCCCGATATTGGAATCATGAATGTTAAAAACAGTA
AAAACTTCGATTTCAGTACAATTGCTCAATCTAGAATTTCTGTTGAATCT
GATGGCAGAATCACTTGGTTACATGGTGCTATTTTAGATGTTACTTGCCC
CCTTGATGTTCGATTTTTCCCGTTTGATGTTCAAACTTGTTACCTTGTTA
TAACTCCATGGCAAAGTTCAGATAAACAAATGCTAATTCATCCGTATCAA
TTGGGATCAGCTGTGGATAATAGTTACCTACCAAATTCTAACGTAAGCGA
ATGGGAAATCAGAGCTGTTCACTTCAAAAGAAAACGCTATCGTAGTGATC
TTAATGTGACTTATCAGTACATCCGAGTCAGTATACACCTCAGGCGACAA
CCTTTATATTTTGTGGTGTTAGTTTTGATTCCTTTTTCCATGCTTTCGGG
ATTAGCTTGTTTAATTTTTACTCTCGAAGATACTGGTGATCGGTTAAGCG
TTGCGCTATCCTTGGTACTTAGCATGACTATGTATGTCGTTATTGTATCA
TCCAATGCTCCTAGATCTATGAGAAGTTTACCAGTAATAGGAATCTATCT
ATTAGACCAATTGGGATTACTGAGTCTGGCTACGGTTTTAGCCGTCATCA
ACAATAAAGTGCGATATTTCAAAGTTTCTCCAGAATCAAAAAGTCGGAAG
CAACCCACCGGATATCGCTGTCCTGAATATAATAACGATAGTCCCATCAT
CCAACTACAAAACTCAAAAAATCGTATGAATGATGCCAACCATAAAATCA
ACAAAAAGTTTAATGCCGACTATAATTTCTCGAAATCATATGCAAATAAT
TCGGTGCGAGTCAACTTTAATGTAGCGAATTCTTTGTCGAGAAATTCTTC
GCCATCAACGTCTTTATCGTCGACTGATTTTTTGCCTTTATATCAACCTC
GAGGTGTCAATATTTACAAGGATTTAGCAGATAGATTTGATAAAATAGAA
ATGGTTACGTATCTTATTATTTCCTTTATTAATGGCGTATTTTGCCTCAT
TGTTGTCCCTTCGTATTTCCAGGATGTGAATTTGAATCCCCCGGATTGAA
TCATTTGATGAGCCTACCCTTAGAAATTTAACTTTATTTTTCATTTGACA
TGTATGTTAATGTTTCGATTATTATCTATGTTTTAGAAATATATATAGTT
GTATGCAAA
back to top

protein sequence of SMED30017866-orf-1

>SMED30017866-orf-1 ID=SMED30017866-orf-1|Name=SMED30017866-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=472bp
MNYLFSVFVLSSIILRSFCNVPQSYEEELLNILRKRNLKVRPNPCRSHCA
NPVNVNITYNVIQILAFSQAEETMSISGWFTIVWSDNRLEWNSEKYGNLN
AVSIPAQDMWLPDIGIMNVKNSKNFDFSTIAQSRISVESDGRITWLHGAI
LDVTCPLDVRFFPFDVQTCYLVITPWQSSDKQMLIHPYQLGSAVDNSYLP
NSNVSEWEIRAVHFKRKRYRSDLNVTYQYIRVSIHLRRQPLYFVVLVLIP
FSMLSGLACLIFTLEDTGDRLSVALSLVLSMTMYVVIVSSNAPRSMRSLP
VIGIYLLDQLGLLSLATVLAVINNKVRYFKVSPESKSRKQPTGYRCPEYN
NDSPIIQLQNSKNRMNDANHKINKKFNADYNFSKSYANNSVRVNFNVANS
LSRNSSPSTSLSSTDFLPLYQPRGVNIYKDLADRFDKIEMVTYLIISFIN
GVFCLIVVPSYFQDVNLNPPD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR027361Acetylcholine_rcpt_TM
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 75..91
score: 31.09
coord: 108..119
score: 37.52
coord: 155..169
score: 54.09
coord: 234..246
score: 34.18
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 34..357
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 243..376
e-value: 2.6E-16
score: 61.8
NoneNo IPR availablePANTHERPTHR18945:SF783ACETYLCHOLINE RECEPTORcoord: 34..357
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 241..328
e-value: 1.26148E-10
score: 56.6021
NoneNo IPR availableCDDcd18989LGIC_ECD_cationcoord: 53..239
e-value: 2.3568E-50
score: 167.539
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.665
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 271..290
NoneNo IPR availableTMHMMTMhelixcoord: 440..462
NoneNo IPR availableTMHMMTMhelixcoord: 300..322
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 28..242
e-value: 1.2E-46
score: 160.7
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 29..240
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 28..240
e-value: 6.0E-40
score: 137.0
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 155..169
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 240..461