Ras family protein

Overview
NameRas family protein
Smed IDSMED30017852
Length (bp)962
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras family protein (SMED30017852) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras family protein (SMED30017852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras family protein (SMED30017852) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras family protein (SMED30017852) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017852SMESG000019606.1 SmedASXL_009214SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30017852SMESG000019606.1 dd_Smed_v4_23935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017852SMESG000019606.1 dd_Smed_v6_23935_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30017852SMESG000019606.1 SMED30017852smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017852SMESG000019606.1 OX_Smed_1.0.22094ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras family protein vs. Ensembl Human
Match: RASD2 (RASD family member 2 [Source:HGNC Symbol;Acc:HGNC:18229])

HSP 1 Score: 96.6709 bits (239), Expect = 9.478e-23
Identity = 59/184 (32.07%), Postives = 102/184 (55.43%), Query Frame = 2
Query:    8 STTNCNSKYPP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            S+ NC    P     R+V LG+  VGK+SI+++F+   F+++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EV+ + ++       LK + ++  + P+ I  NK+D   +   +  +E  E L+S +     F   SAK +  + E+F  L+
Sbjct:    6 SSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTE-AELLVSGDENCAYFEV-SAKKNTNVDEMFYVLF 187          
BLAST of Ras family protein vs. Ensembl Human
Match: RASD1 (ras related dexamethasone induced 1 [Source:HGNC Symbol;Acc:HGNC:15828])

HSP 1 Score: 96.6709 bits (239), Expect = 1.332e-22
Identity = 56/169 (33.14%), Postives = 97/169 (57.40%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            R+V LGS  VGKT+I+++F+   F++ Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EVQ + ++       LK + ++    PL I  NK D      ++ + E+ E L+  + +   +   SAK +  + ++FR+L+
Sbjct:   26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGD-RDFYREVDQREI-EQLVGDDPQRCAYFEISAKKNSSLDQMFRALF 192          
BLAST of Ras family protein vs. Ensembl Human
Match: DIRAS2 (DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC:19323])

HSP 1 Score: 93.2041 bits (230), Expect = 4.830e-22
Identity = 55/164 (33.54%), Postives = 88/164 (53.66%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSD-IPTIENDITESELTE--WLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            RV   G+G VGK+S++ +F+  TF E Y PTVED + +          L   DT G++ F AM+R+S++ G AF+LV++   R S  E++ I E++   + D    P+ +V NK D  P+ E   +E+E     W  +       F+  SAK +  + E+F+ L
Sbjct:    9 RVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCA-------FMETSAKLNHNVKELFQEL 165          
BLAST of Ras family protein vs. Ensembl Human
Match: RAP1B (RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9857])

HSP 1 Score: 90.1225 bits (222), Expect = 5.347e-21
Identity = 53/172 (30.81%), Postives = 93/172 (54.07%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPI 556
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  F LV++   + +F ++Q + E++ +  +D    P+ +V NK D   +E++    +     ++       F+  SAKS   ++EIF  L ++     TP+
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI-LRVKDTDDVPMILVGNKCD---LEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDL-VRQINRKTPV 171          
BLAST of Ras family protein vs. Ensembl Human
Match: RAP1B (RAP1B, member of RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9857])

HSP 1 Score: 90.1225 bits (222), Expect = 5.347e-21
Identity = 53/172 (30.81%), Postives = 93/172 (54.07%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPI 556
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  F LV++   + +F ++Q + E++ +  +D    P+ +V NK D   +E++    +     ++       F+  SAKS   ++EIF  L ++     TP+
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI-LRVKDTDDVPMILVGNKCD---LEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDL-VRQINRKTPV 171          
BLAST of Ras family protein vs. Ensembl Celegans
Match: ssr-2 (Sperm-Specific family, class R [Source:UniProtKB/TrEMBL;Acc:O02139])

HSP 1 Score: 116.316 bits (290), Expect = 6.189e-30
Identity = 62/168 (36.90%), Postives = 99/168 (58.93%), Query Frame = 2
Query:   20 CNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            C  +Y  R+V LGS  VGKT+II +++YN F  +Y+ T+ED+ +R F      + LD +DT   +NF  MRR+S+ S +AF+LVF+ +D  SF E+  I +E+   R D  + P+ +V NK D   +EN     E  +   +      ++I  SAK + +I+++FR+L
Sbjct:    2 CEERY--RLVVLGSAKVGKTNIIRRYLYNEFSSKYKETIEDLHSREFRIQGVPLPLDILDTN--FNFPDMRRLSIASASAFLLVFSVDDVTSFKEMSDIWQEICSRRSDLNELPIVVVGNKCD---VENKKIYEETAKAFTNRLSSDVRYIEVSAKDNIRITDVFRTL 162          
BLAST of Ras family protein vs. Ensembl Celegans
Match: drn-1 (GTP-binding protein drn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09930])

HSP 1 Score: 91.6633 bits (226), Expect = 1.116e-21
Identity = 54/164 (32.93%), Postives = 96/164 (58.54%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSI-ELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELK-MEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            RV   G+G VGK+SI  +F+  TF+E Y PT+ED + +       ++  L   DT G++ F AM+R+S++ G AF+L+++  ++ SF E+  I+E +K ++     + P+ +V NK D    E+    S  +   ++ N++   FI  SAK+++ I+E+F+ L 
Sbjct:   32 RVAVFGAGGVGKSSITQRFVKGTFNENYVPTIEDTYRQVISCNQKNVCTLQITDTTGSHQFPAMQRLSISKGNAFILIYSVTNKQSFAELVPIIEMMKEVKGNAIAETPIMLVGNKKD---EESKREVSSNSGQKVATNME-CGFIETSAKNNENITELFQQLL 191          
BLAST of Ras family protein vs. Ensembl Celegans
Match: rap-1 (Ras-related protein Rap-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18246])

HSP 1 Score: 85.8853 bits (211), Expect = 7.761e-20
Identity = 50/167 (29.94%), Postives = 91/167 (54.49%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIP---TIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  FVLV++   + +F ++  + +++ +  +D  + P+ +V NK D+     +  D  ++   ++        + F+  SAK+   +SE+F  L  Q
Sbjct:    5 KIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRDQI-LRVKDTDEVPMILVGNKCDLEDERVVGKDQGQNLARQF-------GSAFLETSAKAKINVSEVFYDLVRQ 163          
BLAST of Ras family protein vs. Ensembl Celegans
Match: ras-2 (GTP binding protein; R-RAS related [Source:UniProtKB/TrEMBL;Acc:G5EGA7])

HSP 1 Score: 78.5666 bits (192), Expect = 4.720e-17
Identity = 52/157 (33.12%), Postives = 86/157 (54.78%), Query Frame = 2
Query:   23 NSKYPP-RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEF-GNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAK 487
            +SK P  ++V +G G VGK+S+  +F    F + Y PT+ED + +  E  GN+ I +D +DT G   F+AMR   +  G  F+LVF+  +R SF E   +  ++ +  +D  ++P+ +V NK D+   +  ++E E  E    + L    +I  SAK
Sbjct:   12 DSKLPYYKLVVIGDGGVGKSSLTIQFFQKQFVDYYDPTIEDQYIQHCEIDGNWVI-MDVLDTAGQEEFSAMREQYIRGGRGFLLVFSVTERKSFEEAHKLYNQV-LRVKDRSEYPVLLVANKVDLIN-QRVVSEQEGRELAAQLKL---MYIETSAK 162          
BLAST of Ras family protein vs. Ensembl Celegans
Match: ras-2 (GTP binding protein; R-RAS related [Source:UniProtKB/TrEMBL;Acc:G5EGA7])

HSP 1 Score: 78.5666 bits (192), Expect = 4.720e-17
Identity = 52/157 (33.12%), Postives = 86/157 (54.78%), Query Frame = 2
Query:   23 NSKYPP-RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEF-GNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAK 487
            +SK P  ++V +G G VGK+S+  +F    F + Y PT+ED + +  E  GN+ I +D +DT G   F+AMR   +  G  F+LVF+  +R SF E   +  ++ +  +D  ++P+ +V NK D+   +  ++E E  E    + L    +I  SAK
Sbjct:   12 DSKLPYYKLVVIGDGGVGKSSLTIQFFQKQFVDYYDPTIEDQYIQHCEIDGNWVI-MDVLDTAGQEEFSAMREQYIRGGRGFLLVFSVTERKSFEEAHKLYNQV-LRVKDRSEYPVLLVANKVDLIN-QRVVSEQEGRELAAQLKL---MYIETSAK 162          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG30158 (gene:FBgn0050158 transcript:FBtr0086165)

HSP 1 Score: 129.413 bits (324), Expect = 3.737e-35
Identity = 59/163 (36.20%), Postives = 100/163 (61.35%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLIS--MNLKPTQFICGSAKSSDKISEIFRSL 523
            R+V LG   VGK+SI+ +F++ T+ ++YR TVED++ R ++ G  ++++D +DT G   F AMRR+S+ +  AF+LV+A     SF  V+   EE++ +R DF   P+ I  NK+D+ T   ++   E+T+W+      L+     C SAK    ++++F+SL
Sbjct:    8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATTHREVKLEEVTDWVFCELPRLRAKVLEC-SAKEDSNVTDLFKSL 169          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG13375 (gene:FBgn0040370 transcript:FBtr0342963)

HSP 1 Score: 109.768 bits (273), Expect = 7.690e-28
Identity = 61/175 (34.86%), Postives = 107/175 (61.14%), Query Frame = 2
Query:   20 CNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESEL----TEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
             N+++  ++V +GS  VGKTSII +F+YNTF  +Y+ T+E++    F     S+ LD +DT G+Y F AMR +S++S  AF+LV+   D  +F EV+ I +++  E +     P+ +V NK D+  + +  TE E+    TE +++++ +   F+  SA S++ I+++F+ L  Q
Sbjct:   15 ANARH--KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIH-ETKATTAVPIVVVGNKIDL--LADGETEREVEYATTESVVTVDWE-NGFVEASASSNENITQVFKELLAQ 183          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG13375 (gene:FBgn0040370 transcript:FBtr0070103)

HSP 1 Score: 109.383 bits (272), Expect = 1.834e-27
Identity = 61/175 (34.86%), Postives = 107/175 (61.14%), Query Frame = 2
Query:   20 CNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESEL----TEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
             N+++  ++V +GS  VGKTSII +F+YNTF  +Y+ T+E++    F     S+ LD +DT G+Y F AMR +S++S  AF+LV+   D  +F EV+ I +++  E +     P+ +V NK D+  + +  TE E+    TE +++++ +   F+  SA S++ I+++F+ L  Q
Sbjct:   44 ANARH--KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIH-ETKATTAVPIVVVGNKIDL--LADGETEREVEYATTESVVTVDWE-NGFVEASASSNENITQVFKELLAQ 212          
BLAST of Ras family protein vs. Ensembl Fly
Match: CG13375 (gene:FBgn0040370 transcript:FBtr0300326)

HSP 1 Score: 109.383 bits (272), Expect = 1.834e-27
Identity = 61/175 (34.86%), Postives = 107/175 (61.14%), Query Frame = 2
Query:   20 CNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESEL----TEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
             N+++  ++V +GS  VGKTSII +F+YNTF  +Y+ T+E++    F     S+ LD +DT G+Y F AMR +S++S  AF+LV+   D  +F EV+ I +++  E +     P+ +V NK D+  + +  TE E+    TE +++++ +   F+  SA S++ I+++F+ L  Q
Sbjct:   44 ANARH--KIVVMGSAKVGKTSIITQFLYNTFSTKYKRTIEEMHQGNFSIAGVSLTLDILDTAGSYEFPAMRALSISSADAFILVYDVTDATTFEEVRTIRDQIH-ETKATTAVPIVVVGNKIDL--LADGETEREVEYATTESVVTVDWE-NGFVEASASSNENITQVFKELLAQ 212          
BLAST of Ras family protein vs. Ensembl Fly
Match: Rap1 (gene:FBgn0004636 transcript:FBtr0303154)

HSP 1 Score: 94.3597 bits (233), Expect = 5.513e-23
Identity = 57/168 (33.93%), Postives = 92/168 (54.76%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICG----SAKSSDKISEIFRSLWIQ 532
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  FVLV++   + +F ++Q + E++ +  +D    P+ +V NK D+   E  +   EL + L       TQF C     SAK+   +++IF  L  Q
Sbjct:    5 KIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQI-LRVKDTDDVPMVLVGNKCDLE--EERVVGKELGKNL------ATQFNCAFMETSAKAKVNVNDIFYDLVRQ 163          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: rasd4 (rasd family member 4 [Source:ZFIN;Acc:ZDB-GENE-050506-133])

HSP 1 Score: 101.293 bits (251), Expect = 3.884e-25
Identity = 55/165 (33.33%), Postives = 102/165 (61.82%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQF-PLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
            R+VF+G+  VGKT++I +F+ ++F+ ++R TVE++ ++ +E     + ++ MDT G+Y+F AMR++S+ +G AF LV++ +D  S   V  + EE+   +ED  +F P+ +V NK D   IE  ++  ++    + M+     F+  SAK ++ + E+F+ L  Q
Sbjct:   12 RLVFMGAAGVGKTALIKRFLQDSFEPKHRRTVEELHSKEYEVAGVKVTINIMDTSGSYSFPAMRKLSIQNGDAFALVYSVDDPESLEVVNRLREEILEVKED--KFTPIVVVGNKKD-RLIERRVSADDVLAK-VEMDWN-NCFMEASAKENENVMEVFKELLQQ 171          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: rasd3 (RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060818-9])

HSP 1 Score: 93.9745 bits (232), Expect = 2.065e-22
Identity = 53/169 (31.36%), Postives = 94/169 (55.62%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-LKMEREDFGQFPLAIVCNKSDIPTIENDITESELT----EWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
            R VFLG+  VGKT++I +F+ + FD +Y  TVE++    ++     + ++ +DT G+Y+F AMR + + +G AF LV+A ++  S  EVQ + EE L+++ E F    + ++ NK+D+ +     T   +     +W          F+  SA++ D ++ +FR L  Q
Sbjct:   12 RFVFLGAAGVGKTALITRFLQDRFDSKYTRTVEELHALEYDTEGARVRIEILDTSGSYSFPAMRALCIRTGDAFALVYAADEPDSLEEVQRLREEILELKGESFT--GITVIENKADLCSRSRQATAEAMRAVEEDW-------GAGFVETSARTGDNVTAVFRDLLQQ 171          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: si:dkey-27j5.5 (si:dkey-27j5.5 [Source:ZFIN;Acc:ZDB-GENE-121214-264])

HSP 1 Score: 96.6709 bits (239), Expect = 3.191e-22
Identity = 55/179 (30.73%), Postives = 92/179 (51.40%), Query Frame = 2
Query:   17 NCNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQ------FPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICG----SAKSSDKISEIFRSL 523
            NC      R+V LG+  VGKTSI+ +F+ + F+E+Y PT ED   + ++    + ++D +D  G  +F A RR+S+ +G  F+LVF+ +DR SF EV+ +  E+   +    +       P  +  NK D+P  +  ++  E+   L S         C     SAK S  + ++F +L
Sbjct:  130 NCR-----RIVVLGAPRVGKTSILRRFLRDGFEEQYEPTCEDFHRKLYQIRGETYQIDILDASGERSFPAKRRLSILTGDIFLLVFSLDDRSSFEEVRALHTEIVAAKAALRRSKQPLCVPTVVCANKVDLPAEQRAVSRPEVLSALGSS--------CALFETSAKDSVNLEQVFEAL 295          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: rasd3 (RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060818-9])

HSP 1 Score: 93.2041 bits (230), Expect = 3.557e-22
Identity = 53/169 (31.36%), Postives = 93/169 (55.03%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-LKMEREDFGQFPLAIVCNKSDIPTIENDITESELT----EWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
            R VFLG+  VGKT++I +F+ + FD +Y  TVE++    ++     + ++ +DT G+Y F AMR + + +G AF LV+A ++  S  EVQ + EE L+++ E F    + ++ NK+D+ +     T   +     +W          F+  SA++ D ++ +FR L  Q
Sbjct:   12 RFVFLGAAGVGKTALITRFLQDRFDSKYTRTVEELHALEYDTEGARVRIEILDTSGSYPFPAMRALCIRTGDAFALVYAADEPDSLEEVQRLREEILELKGESFTG--ITVIENKADLCSRSRQATAEAMRAVEEDW-------GAGFVETSARTGDNVTAVFRDLLQQ 171          
BLAST of Ras family protein vs. Ensembl Zebrafish
Match: rasd1 (RAS, dexamethasone-induced 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1473])

HSP 1 Score: 93.9745 bits (232), Expect = 6.827e-22
Identity = 58/169 (34.32%), Postives = 97/169 (57.40%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            R+V LGS  VGKT+I+++F+   F+E+Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EVQ + ++       LK + ++    PL I  NK D      ++   E+ E LI+ + +   F   SAK +  + ++F+ L+
Sbjct:   21 RMVILGSTKVGKTAIVSRFLNGRFEEQYTPTIEDFHRKLYSIKGDVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFHEVQRLKQQIYETKSCLKNKTKENVDVPLVICGNKGD-REFYREVQRDEI-EQLIAGDEQCAYFEI-SAKRNTNVDQMFQRLF 186          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: ras-dva2 (small GTPase Ras-dva-2 [Source:NCBI gene;Acc:733456])

HSP 1 Score: 100.138 bits (248), Expect = 1.453e-24
Identity = 48/118 (40.68%), Postives = 78/118 (66.10%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEF-GNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDI 391
            R+VFLG+  VGKTS+I++F+ +TFD ++R TVE++ +  +E      + ++ MDT G+Y F AMR+++M SG AF LV+  +D  SF  V+ + EE+ +E +     P+ +V NK D+
Sbjct:   12 RLVFLGAAGVGKTSLISRFLLDTFDPKHRRTVEELHSTEYEATCGTQVRVEIMDTSGSYEFPAMRKLNMKSGDAFALVYTMDDPDSFEMVKHLREEI-LEAKGDKSPPIVVVANKKDL 128          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: angptl5 (angiopoietin like 5 [Source:Xenbase;Acc:XB-GENE-479274])

HSP 1 Score: 98.2117 bits (243), Expect = 8.116e-24
Identity = 47/122 (38.52%), Postives = 79/122 (64.75%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDI-PTIE 403
            R+VF G+  VGKT++I +F+ + FD+RYR TVE+++    E G   + +  +DT G+Y+F AMR++S+  G AF LVF+ ++  SF EV+ +  E+   + D  + P+ +V N+ D+ P +E
Sbjct:   12 RLVFFGAAGVGKTALIQRFLNDRFDDRYRRTVEEMYCLNPEPGALQLRIQILDTSGSYSFPAMRKLSIQQGDAFALVFSLSEPDSFQEVERLRSEIIQVKGD-AEVPIVVVGNQMDLFPGLE 132          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: rasd2 (RASD family member 2 [Source:NCBI gene;Acc:548760])

HSP 1 Score: 98.2117 bits (243), Expect = 2.638e-23
Identity = 59/184 (32.07%), Postives = 104/184 (56.52%), Query Frame = 2
Query:    8 STTNCNSKYPP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEEL-------KMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            S+ NC    P     R+V LG+  VGK++I+++F+   F+++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EV+ + +++       K + ++ G+FP+ I  NKSD       +  +E  E L+S +     F   SAK +  + ++F+ L+
Sbjct:    6 SSGNCTLSVPAKNSYRMVVLGASRVGKSAIVSRFLNGRFEDQYTPTIEDFHRKLYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFDEVKRLRKQILEVKSCVKNKTKETGEFPMMICGNKSDHGEHHRKV-RAEEAERLVSGDENCAYFEI-SAKKNINVDKMFQVLF 187          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: rasd1 (ras related dexamethasone induced 1 [Source:NCBI gene;Acc:779862])

HSP 1 Score: 96.6709 bits (239), Expect = 8.575e-23
Identity = 61/175 (34.86%), Postives = 100/175 (57.14%), Query Frame = 2
Query:   35 PP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            PP    R+V LGS  VGKTSI+++F+   F+E+Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EVQ + ++       LK + ++    P+ I  NK D      ++   E+ E L+  + K + F   SAK +  + E+F++L+
Sbjct:   21 PPKNCYRMVILGSSKVGKTSIVSRFLSGRFEEQYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQIIETKSCLKNKTKENVDVPIVICGNKVD-RDFYREVQPHEI-EQLVGEDSKCSYFEV-SAKKNSSLDEMFKALF 192          
BLAST of Ras family protein vs. Ensembl Xenopus
Match: rasd1 (ras related dexamethasone induced 1 [Source:NCBI gene;Acc:779862])

HSP 1 Score: 97.0561 bits (240), Expect = 9.040e-23
Identity = 61/175 (34.86%), Postives = 100/175 (57.14%), Query Frame = 2
Query:   35 PP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            PP    R+V LGS  VGKTSI+++F+   F+E+Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EVQ + ++       LK + ++    P+ I  NK D      ++   E+ E L+  + K + F   SAK +  + E+F++L+
Sbjct:   32 PPKNCYRMVILGSSKVGKTSIVSRFLSGRFEEQYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQIIETKSCLKNKTKENVDVPIVICGNKVD-RDFYREVQPHEI-EQLVGEDSKCSYFEV-SAKKNSSLDEMFKALF 203          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Rasd2 (RASD family, member 2 [Source:MGI Symbol;Acc:MGI:1922391])

HSP 1 Score: 96.6709 bits (239), Expect = 7.974e-23
Identity = 59/184 (32.07%), Postives = 101/184 (54.89%), Query Frame = 2
Query:    8 STTNCNSKYPP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            S+ NC    P     R+V LG+  VGK+SI+++F+   F+++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ + R SF EV+ + ++       LK + ++  + P+ I  NK+D   +   +   E  E L+S +     F   SAK +  ++E+F  L+
Sbjct:    6 SSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAME-AELLVSGDENCAYFEV-SAKKNTNVNEMFYVLF 187          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Rasd2 (RASD family, member 2 [Source:MGI Symbol;Acc:MGI:1922391])

HSP 1 Score: 96.6709 bits (239), Expect = 7.974e-23
Identity = 59/184 (32.07%), Postives = 101/184 (54.89%), Query Frame = 2
Query:    8 STTNCNSKYPP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            S+ NC    P     R+V LG+  VGK+SI+++F+   F+++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ + R SF EV+ + ++       LK + ++  + P+ I  NK+D   +   +   E  E L+S +     F   SAK +  ++E+F  L+
Sbjct:    6 SSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAME-AELLVSGDENCAYFEV-SAKKNTNVNEMFYVLF 187          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Rasd1 (RAS, dexamethasone-induced 1 [Source:MGI Symbol;Acc:MGI:1270848])

HSP 1 Score: 96.6709 bits (239), Expect = 1.004e-22
Identity = 56/169 (33.14%), Postives = 97/169 (57.40%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            R+V LGS  VGKT+I+++F+   F++ Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EVQ + ++       LK + ++    PL I  NK D      ++ + E+ E L+  + +   +   SAK +  + ++FR+L+
Sbjct:   26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGD-RDFYREVEQREI-EQLVGDDPQRCAYFEISAKKNSSLDQMFRALF 192          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Diras2 (DIRAS family, GTP-binding RAS-like 2 [Source:MGI Symbol;Acc:MGI:1915453])

HSP 1 Score: 92.4337 bits (228), Expect = 5.715e-22
Identity = 55/164 (33.54%), Postives = 87/164 (53.05%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSD-IPTIENDITESELTE--WLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            RV   G+G VGK+S++ +F+  TF E Y PTVED + +          L   DT G++ F AM+R+S++ G AF+LV++   R S  E++ I E++   + D    P+ +V NK D  P  E   +E+E     W  +       F+  SAK +  + E+F+ L
Sbjct:    9 RVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPNREVQSSEAEALARTWKCA-------FMETSAKLNHNVKELFQEL 165          
BLAST of Ras family protein vs. Ensembl Mouse
Match: Rap1b (RAS related protein 1b [Source:MGI Symbol;Acc:MGI:894315])

HSP 1 Score: 90.1225 bits (222), Expect = 3.671e-21
Identity = 53/172 (30.81%), Postives = 93/172 (54.07%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPI 556
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  F LV++   + +F ++Q + E++ +  +D    P+ +V NK D   +E++    +     ++       F+  SAKS   ++EIF  L ++     TP+
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI-LRVKDTDDVPMILVGNKCD---LEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDL-VRQINRKTPV 171          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|Q96D21|RHES_HUMAN (GTP-binding protein Rhes OS=Homo sapiens OX=9606 GN=RASD2 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.552e-22
Identity = 59/184 (32.07%), Postives = 102/184 (55.43%), Query Frame = 2
Query:    8 STTNCNSKYPP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            S+ NC    P     R+V LG+  VGK+SI+++F+   F+++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EV+ + ++       LK + ++  + P+ I  NK+D   +   +  +E  E L+S +     F   SAK +  + E+F  L+
Sbjct:    6 SSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTE-AELLVSGDENCAYFEV-SAKKNTNVDEMFYVLF 187          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|Q5R6S2|DIRA2_PONAB (GTP-binding protein Di-Ras2 OS=Pongo abelii OX=9601 GN=DIRAS2 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.957e-22
Identity = 56/164 (34.15%), Postives = 88/164 (53.66%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSD-IPTIENDITESELTE--WLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            RV   G+G VGK+S++ +F+  TF E Y PTVED + R          L   DT G++ F AM+R+S++ G AF+LV++   R S  E++ I E++   + D    P+ +V NK D  P+ E   +E+E     W  +       F+  SAK +  + E+F+ L
Sbjct:    9 RVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRRVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCA-------FMETSAKLNHNVKELFQEL 165          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|P08645|RAP1_DROME (Ras-related protein Rap1 OS=Drosophila melanogaster OX=7227 GN=Rap1 PE=2 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 5.526e-22
Identity = 57/168 (33.93%), Postives = 92/168 (54.76%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICG----SAKSSDKISEIFRSLWIQ 532
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  FVLV++   + +F ++Q + E++ +  +D    P+ +V NK D+   E  +   EL + L       TQF C     SAK+   +++IF  L  Q
Sbjct:    5 KIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQI-LRVKDTDDVPMVLVGNKCDLE--EERVVGKELGKNL------ATQFNCAFMETSAKAKVNVNDIFYDLVRQ 163          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|P63033|RHES_RAT (GTP-binding protein Rhes OS=Rattus norvegicus OX=10116 GN=Rasd2 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 5.578e-22
Identity = 59/184 (32.07%), Postives = 101/184 (54.89%), Query Frame = 2
Query:    8 STTNCNSKYPP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            S+ NC    P     R+V LG+  VGK+SI+++F+   F+++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ + R SF EV+ + ++       LK + ++  + P+ I  NK+D   +   +   E  E L+S +     F   SAK +  ++E+F  L+
Sbjct:    6 SSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAME-AELLVSGDENCAYFEV-SAKKNTNVNEMFYVLF 187          
BLAST of Ras family protein vs. UniProt/SwissProt
Match: sp|P63032|RHES_MOUSE (GTP-binding protein Rhes OS=Mus musculus OX=10090 GN=Rasd2 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 5.578e-22
Identity = 59/184 (32.07%), Postives = 101/184 (54.89%), Query Frame = 2
Query:    8 STTNCNSKYPP----RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            S+ NC    P     R+V LG+  VGK+SI+++F+   F+++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ + R SF EV+ + ++       LK + ++  + P+ I  NK+D   +   +   E  E L+S +     F   SAK +  ++E+F  L+
Sbjct:    6 SSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAME-AELLVSGDENCAYFEV-SAKKNTNVNEMFYVLF 187          
BLAST of Ras family protein vs. TrEMBL
Match: A0A183VT06 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS3612 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 9.055e-46
Identity = 80/220 (36.36%), Postives = 133/220 (60.45%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQF---------------------PLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNF--QAVTPIKFNKIENETSNRLEGSSLLHTNSSS 631
            R+VFLGS  VGKTSII +F++N F+ +Y PTVEDI  + F   ++ ++L  MDT G+Y+F AM R+ +N   AFV+VFA ++  S ++   +L ++K +R+D+                        P+ +VCNKSD+P  ++ ++E  + EWL++  LKP+QF+  SAKS+D I  IF SLW+QN   +A+   +++ +   +    + ++L H++ +S
Sbjct:   54 RIVFLGSAKVGKTSIIQRFLHNHFESKYTPTVEDIHLKKFIVRDHLVKLVLMDTAGSYDFPAMLRLCINKANAFVIVFAHDNLDSLVQAGQLLTQIKSQRKDYAPLVSNTLNDQYDDCIFNMNVASPPIVVVCNKSDLPNSDSQVSEGAIMEWLLTNGLKPSQFVYASAKSNDSIIAIFESLWLQNTVSKAIKLARWDGVRRASLTNSQQTALPHSSITS 273          
BLAST of Ras family protein vs. TrEMBL
Match: A0A3Q0KPB4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 7.626e-45
Identity = 79/197 (40.10%), Postives = 122/197 (61.93%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQF--------------------PLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQN--FQAVTPIKFN 565
            R+VFLGS  VGKTSII +F+YN F+ +Y PTVEDI ++ F   N+ ++L  +DT G+Y+F AM R+ ++   AFV+VFA +   S ++   +L ++K +R D+                       P+ +VCNKSD+P   + I+E  + EWL++  LKP+QF+  SAK++D I  IF SLW+QN   +A+T +K++
Sbjct:   53 RIVFLGSAKVGKTSIIQRFLYNHFETKYTPTVEDIHSKKFIVRNHIVKLVLIDTAGSYDFPAMLRLCISKANAFVIVFAHDSLDSLVQAGQLLSQIKSQRTDYASLTSNLSHEQSEEWALSMNMASPITVVCNKSDLPNSYSQISEGAIMEWLLTNGLKPSQFVYVSAKTNDSIMSIFESLWLQNDVSKAITLVKWD 249          
BLAST of Ras family protein vs. TrEMBL
Match: A0A183RZ03 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.979e-44
Identity = 79/197 (40.10%), Postives = 122/197 (61.93%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQF--------------------PLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQN--FQAVTPIKFN 565
            R+VFLGS  VGKTSII +F+YN F+ +Y PTVEDI ++ F   N+ ++L  +DT G+Y+F AM R+ ++   AFV+VFA +   S ++   +L ++K +R D+                       P+ +VCNKSD+P   + I+E  + EWL++  LKP+QF+  SAK++D I  IF SLW+QN   +A+T +K++
Sbjct:   53 RIVFLGSAKVGKTSIIQRFLYNHFETKYTPTVEDIHSKKFIVRNHIVKLVLIDTAGSYDFPAMLRLCISKANAFVIVFAHDSLDSLVQAGQLLSQIKSQRTDYASLTSNLSHEQSEEWALSMNMASPITVVCNKSDLPNSFSQISEGAIMEWLLTNGLKPSQFVYVSAKTNDSIMSIFESLWLQNDVSKAITLVKWD 249          
BLAST of Ras family protein vs. TrEMBL
Match: A0A430QGE9 (RAS, dexamethasone-induced Ras-related protein 1 OS=Schistosoma bovis OX=6184 GN=DC041_0001539 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.621e-44
Identity = 79/197 (40.10%), Postives = 125/197 (63.45%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDF------------GQF--------PLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQN--FQAVTPIKFN 565
            R+VFLGS  VGKTSII +F++N F+ +Y PTVEDI  + F   N+ ++L  +DT G+Y+F AM R+ ++  +AFV+VFA +   S ++   +L ++K +R+D+            G +        P+ +VCNKSD+P   + I+E  + EWL++  LKP+QF+  SAK++D I  IF SLW+QN   +A+T +K++
Sbjct:   53 RIVFLGSAKVGKTSIIQRFLHNHFETKYTPTVEDIHLKKFIVRNHIVKLVLIDTAGSYDFPAMLRLCISKASAFVIVFAHDSLDSLVQAGQLLSQIKSQRKDYVSLTSNLSHEQSGDYVPSMNMASPITVVCNKSDLPNSYSQISEGAIMEWLLTNGLKPSQFVYVSAKTNDSIMSIFESLWLQNDVSKAITLVKWD 249          
BLAST of Ras family protein vs. TrEMBL
Match: A0A183PAN0 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS11416 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 4.668e-44
Identity = 78/197 (39.59%), Postives = 123/197 (62.44%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQF--------------------PLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQN--FQAVTPIKFN 565
            R+VFLGS  VGKTSII +F++N F+ +Y PTVEDI  + F   N+ ++L  +DT G+Y+F AM R+ ++  +AFV+VFA +   S ++   +L ++K +R+D+                       P+ +VCNKSD+P   + I+E  + EWL++  LKP+QF+  SAK++D I  IF SLW+QN   +A+T +K++
Sbjct:   53 RIVFLGSAKVGKTSIIQRFLHNHFETKYTPTVEDIHLKKFIVRNHIVKLVLIDTAGSYDFPAMLRLCISKASAFVIVFAHDSLDSLVQAGQLLSQIKSQRKDYVSLTSNLSHEQSGDCVPSMNMASPITVVCNKSDLPNSYSQISEGAIMEWLLTNGLKPSQFVYVSAKTNDSIMSIFESLWLQNDVSKAITLVKWD 249          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: ENSAMXT00000027032.2 (GTP-binding protein Rhes-like [Source:NCBI gene;Acc:103025798])

HSP 1 Score: 105.145 bits (261), Expect = 1.220e-26
Identity = 54/165 (32.73%), Postives = 103/165 (62.42%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQF-PLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
            R+VF+G+  VGKT++I++F+ ++F+ ++R TVE++ ++ +E     + L+ MDT G+Y+F AMR++S+ S  AF L++A +D  S   V+ + +E+   +ED  +F P+ +V NK+D    E  +   ++   ++ ++     F+  SAK ++ + E+FR L  Q
Sbjct:   12 RLVFMGAAGVGKTALIHRFLKDSFEPKHRRTVEELHSKEYEIAGVKVTLEIMDTSGSYSFPAMRKLSIQSSDAFALIYAVDDPESLDVVKSLRDEIMEVKED--KFTPIVVVGNKTD--KTERKVQADDVLS-MVELDWN-NSFLEASAKENENVVEVFRELLQQ 170          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: rasd4 (ras-related protein Rap-1b-like [Source:NCBI gene;Acc:103035404])

HSP 1 Score: 104.375 bits (259), Expect = 2.177e-26
Identity = 56/169 (33.14%), Postives = 102/169 (60.36%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQF-PLAIVCNKSD----IPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
            R+VF+G+  VGKT++I +F+ ++F+ ++R TVE++ ++ +E G   + ++ MDT G+Y+F AMR++S+ +G AF LV++ +D  S   V+ + EE+   +ED  +F P+ +V NK+D         +D+  +   +W          F+  SAK ++ + E+FR L  Q
Sbjct:   13 RLVFMGAAGVGKTALIQRFLQDSFEPKHRRTVEELHSKEYEVGGVKVTINIMDTSGSYSFPAMRKLSIQNGDAFALVYSVDDPESLDAVKSLREEILEVKED--KFTPIVVVGNKTDRLGERRVSADDVLATVELDW-------NNCFLEASAKENNNVLEVFRELLQQ 172          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: ENSAMXT00000052770.1 (dexamethasone-induced Ras-related protein 1-like [Source:NCBI gene;Acc:103040487])

HSP 1 Score: 98.5969 bits (244), Expect = 1.078e-23
Identity = 64/209 (30.62%), Postives = 111/209 (53.11%), Query Frame = 2
Query:   11 TTNCNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW--IQNFQAVTPIKFNKIENETSNRLEGSSL 610
              NC+     R+V LGS  VGKT+I+++F+   FD++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EVQ +  +       LK + ++    PL I  NK D   +  ++T+ E+ + L     +P  +   SAK +  +  +F +L+   +    ++P +  K+  +  + L   SL
Sbjct:   16 AKNCH-----RMVILGSTKVGKTAIVSRFLNERFDDQYTPTIEDFHRKFYSIRGDVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFQEVQRLKRQIFETKSCLKNKTKENVDVPLVICGNKCD-RELSREVTDEEIEQLLAGG--EPCAYFEVSAKRNTNVDLMFHALFSMAKLPDEMSPDRHRKVSLQYGDVLRRKSL 216          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: rap1aa (RAP1A, member of RAS oncogene family [Source:NCBI gene;Acc:103047011])

HSP 1 Score: 91.2781 bits (225), Expect = 1.036e-21
Identity = 55/185 (29.73%), Postives = 99/185 (53.51%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPIKFNKIENETSNRL 595
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  F LV++   + +F ++Q + E++ +  +D    P+ +V NK D   +E++    +     ++       F+  SAKS   ++EIF  L ++     TP++  K +  ++  L
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI-LRVKDTEDVPMILVGNKCD---LEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDL-VRQINRKTPVEKKKAKKRSNCTL 184          
BLAST of Ras family protein vs. Ensembl Cavefish
Match: rap1b (RAP1B, member of RAS oncogene family [Source:NCBI gene;Acc:103035254])

HSP 1 Score: 91.2781 bits (225), Expect = 1.065e-21
Identity = 53/172 (30.81%), Postives = 93/172 (54.07%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPI 556
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  F LV++   + +F ++Q + E++ +  +D    P+ +V NK D   +E++    +     ++       F+  SAKS   ++EIF  L ++     TP+
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI-LRVKDTDDVPMILVGNKCD---LEDERVVGKEQGQNLARQWNSCAFLESSAKSKINVNEIFYDL-VRQINRKTPV 171          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: rasd3 (RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060818-9])

HSP 1 Score: 110.538 bits (275), Expect = 4.859e-29
Identity = 52/116 (44.83%), Postives = 77/116 (66.38%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSD 388
            R+VFLG+  VGKTSII +F+   F+ RYRPTVE+++   +E G   I+L+ MDT G+Y F AMR++ +  G AF LVF+  +  SF EV+ + EE+   +ED    P+ ++ NK+D
Sbjct:   12 RLVFLGAAGVGKTSIIKRFLQGAFETRYRPTVEELYALEYEAGGSKIKLEVMDTSGSYRFPAMRKLYIRDGDAFALVFSLEEPQSFEEVRRLREEVLEIKEDKCP-PIVVIANKAD 126          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: RIT2 (Ras like without CAAX 2 [Source:HGNC Symbol;Acc:HGNC:10017])

HSP 1 Score: 80.1073 bits (196), Expect = 4.737e-18
Identity = 40/122 (32.79%), Postives = 66/122 (54.10%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIEN 406
            ++V LG G VGK+++  +FI + F E + PT+ED +       + +  LD +DT G   FTAMR   M +G  F++ ++  DR SF E     + +   R  + + P+ +V NK+D+  I  
Sbjct:   22 KIVMLGPGGVGKSAMTMQFISHRFPEDHDPTIEDAYKTQVRIDDETAHLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFQEAAQFKQLIYQVRHTY-EVPVVLVGNKTDLGEIRQ 142          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: DIRAS2 (DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC:19323])

HSP 1 Score: 77.411 bits (189), Expect = 2.696e-17
Identity = 50/152 (32.89%), Postives = 76/152 (50.00%), Query Frame = 2
Query:   74 KTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESE--LTEWLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            K+S++ +F+  TF E Y PTVED + +          L   DT G++ F AM+R+S++ G AFVLV++   R S  E++ I E +   + D    P+ +V NK D  T E    E E     W  +       F+  SAK    + E+F+ L
Sbjct:   20 KSSLVLRFVRGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISRGHAFVLVYSIASRQSLEELRPIYEVICSLKGDTEAVPIMLVGNKCDETTREVQTAEGEAQAKAWRCA-------FMETSAKMDYNVRELFQEL 164          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: DIRAS2 (DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC:19323])

HSP 1 Score: 76.2554 bits (186), Expect = 8.327e-17
Identity = 47/152 (30.92%), Postives = 74/152 (48.68%), Query Frame = 2
Query:   74 KTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESE--LTEWLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            K+S++ +F+  TF E Y PTVED + +          L   DT G++ F AM+R++++ G AF+LV++   R S  E++ I + +   + D    P+ +V NK D    E    E E     W  +       F   SAK    +SE F+ L
Sbjct:   20 KSSLVLRFVRGTFREAYVPTVEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLAISRGHAFLLVYSVTSRQSLEELRPIYDVIAQIKGDVSAVPMMLVANKCDETAREVAAGEGETQAKAWRCA-------FTETSAKMDYNVSEAFQEL 164          
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Match: ralba (v-ral simian leukemia viral oncogene homolog Ba (ras related) [Source:ZFIN;Acc:ZDB-GENE-040801-267])

HSP 1 Score: 73.559 bits (179), Expect = 7.746e-16
Identity = 43/161 (26.71%), Postives = 81/161 (50.31%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIP---TIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIF 514
            +V+ +GSG VGK+++  +F+Y+ F E Y PT  D + +        +++D +DT G  ++ A+R     SG  F+ VF+  +  SF       E++   +ED    P  +V NKSD+     + ++   +   +W +S       ++  SAK+   + ++F
Sbjct:   15 KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSICEHESFAATLEFREQILRVKED-DSVPFLLVGNKSDLEERRQVSSEEARARAEQWRVS-------YVETSAKTRANVDKVF 167          
BLAST of Ras family protein vs. Ensembl Yeast
Match: RSR1 (GTP-binding protein of the Ras superfamily; required for bud site selection, morphological changes in response to mating pheromone, and efficient cell fusion; localized to the plasma membrane; significantly similar to mammalian Rap GTPases [Source:SGD;Acc:S000003384])

HSP 1 Score: 90.5077 bits (223), Expect = 1.544e-21
Identity = 40/117 (34.19%), Postives = 72/117 (61.54%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDI 391
            ++V LG+G VGK+ +  +F+   + + Y PT+ED + +T E  N   +L+ +DT G   FTAMR + + SG  F+LV++  DR S  E+  + E++ +  +D  + P+ ++ NK+D+
Sbjct:    5 KLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELMELREQV-LRIKDSDRVPMVLIGNKADL 120          
BLAST of Ras family protein vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 72.4034 bits (176), Expect = 1.820e-15
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVE-DIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDI 391
            ++VFLG   VGKTS+I +F+Y+TFD+ Y+ T+  D  ++T    + +I L   DT G   F ++    +      ++V+    R SF  +   +E++K ER D     L IV NKSD+
Sbjct:   12 KIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGD-ENVILCIVGNKSDL 128          
BLAST of Ras family protein vs. Ensembl Yeast
Match: YPT53 (Stress-induced Rab family GTPase; required for vacuolar protein sorting and endocytosis; involved in ionic stress tolerance; similar to Vps21p and Ypt52p; functional homolog of Vps21p; mammalian Rab5 homolog; YPT53 has a paralog, VPS21, that arose from the whole genome duplication [Source:SGD;Acc:S000005037])

HSP 1 Score: 65.0846 bits (157), Expect = 6.831e-13
Identity = 53/172 (30.81%), Postives = 83/172 (48.26%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIF-TRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQ-FPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFIC---------GSAKSSDKISEIFRSL 523
            +VV LG  AVGK+SI+ +F+ + F E   PT+   F T+        I+ +  DT G   F  +  +   +  A ++VF   + GSF + Q  +EEL    E  G    +A+V NK D+  + ND  E+E      +M     Q +C          SAK+ + I +IF++L
Sbjct:   14 KVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEEL---HEKVGHDIVIALVGNKMDL--LNND-DENENR----AMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTL 175          
BLAST of Ras family protein vs. Ensembl Yeast
Match: RAS1 (GTPase involved in G-protein signaling in adenylate cyclase activation; plays a role in cell proliferation; localized to the plasma membrane; homolog of mammalian RAS proto-oncogenes; relative distribution to the nucleus increases upon DNA replication stress; RAS1 has a paralog, RAS2, that arose from the whole genome duplication [Source:SGD;Acc:S000005627])

HSP 1 Score: 61.6178 bits (148), Expect = 2.435e-11
Identity = 44/150 (29.33%), Postives = 76/150 (50.67%), Query Frame = 2
Query:   74 KTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            K+++  +FI + F + Y PT+ED + +     +    LD +DT G   ++AMR   M +G  F+LV++   R SF E+    ++++  + D    P+ +V NK D   +EN+   S      ++  L    F+  SAK +  + E F SL
Sbjct:   23 KSALTIQFIQSYFVDEYDPTIEDSYRKQVVIDDKVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRNSFDELLSYYQQIQRVK-DSDYIPVVVVGNKLD---LENERQVSYEDGLRLAKQLNAP-FLETSAKQAINVDEAFYSL 167          
BLAST of Ras family protein vs. Ensembl Yeast
Match: RHB1 (Putative Rheb-related GTPase; involved in regulating canavanine resistance and arginine uptake; member of the Ras superfamily of G-proteins [Source:SGD;Acc:S000000622])

HSP 1 Score: 58.5362 bits (140), Expect = 1.140e-10
Identity = 32/128 (25.00%), Postives = 68/128 (53.12%), Query Frame = 2
Query:    8 STTNCNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDI 391
            S++N    +  ++  +G+  VGKT++  +F+ + F E Y PT+E+ FTR   + ++   L+ +DT G    + +   S+      +L ++  +R SF ++  IL +  +++      P+ +V  K+D+
Sbjct:    7 SSSNSTHNFQRKIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAGQDEVSLLNIKSLTGVRGIILCYSIINRASF-DLIPILWDKLVDQLGKDNLPVILVGTKADL 133          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO36578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI58])

HSP 1 Score: 97.0561 bits (240), Expect = 1.694e-24
Identity = 59/172 (34.30%), Postives = 94/172 (54.65%), Query Frame = 2
Query:   44 VVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIEN----------DITESEL--TEWLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            +VF G+ +VGKTS+I +F+   F++ Y PT+ED F +   F N + EL  +DT GTY F AMR++ +  G AFVLV++Q+   SF ++     E+    ++  + P  +VCNK+D+P   +           I+   L  TEW        + +I  SAK + ++ +IF  L
Sbjct:    1 IVFFGASSVGKTSLILRFLGYAFNDDYSPTIEDFFIKHVFFNNETYELQIIDTSGTYEFPAMRKVDIAKGDAFVLVYSQDHPESFTKLNRYRSEILEGGKN--RHPCIVVCNKNDLPLATHLGVLTDHRGLRISAQHLVQTEW-------QSLWIDCSAKENSQVEDIFLRL 163          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO27138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI58])

HSP 1 Score: 97.0561 bits (240), Expect = 1.694e-24
Identity = 59/172 (34.30%), Postives = 94/172 (54.65%), Query Frame = 2
Query:   44 VVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIEN----------DITESEL--TEWLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            +VF G+ +VGKTS+I +F+   F++ Y PT+ED F +   F N + EL  +DT GTY F AMR++ +  G AFVLV++Q+   SF ++     E+    ++  + P  +VCNK+D+P   +           I+   L  TEW        + +I  SAK + ++ +IF  L
Sbjct:    1 IVFFGASSVGKTSLILRFLGYAFNDDYSPTIEDFFIKHVFFNNETYELQIIDTSGTYEFPAMRKVDIAKGDAFVLVYSQDHPESFTKLNRYRSEILEGGKN--RHPCIVVCNKNDLPLATHLGVLTDHRGLRISAQHLVQTEW-------QSLWIDCSAKENSQVEDIFLRL 163          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO39047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB93])

HSP 1 Score: 90.8929 bits (224), Expect = 5.400e-22
Identity = 57/191 (29.84%), Postives = 100/191 (52.36%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPIKFNKIENETSNRLEGSSLL 613
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  FVLV++   + +F ++Q + E++ +  +D    P+ +V NK D   +E++    +     ++       F+  SAK+   ++EIF  L ++     TP      E ++  +  G  LL
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQI-LRVKDTDDVPMVLVGNKCD---LEDERVVGKDQGQNLAKQFANCTFLETSAKAKINVNEIFYDL-VRQINRKTP------ETKSRKKKRGCVLL 184          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO33484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS29])

HSP 1 Score: 83.1889 bits (204), Expect = 4.040e-19
Identity = 41/116 (35.34%), Postives = 70/116 (60.34%), Query Frame = 2
Query:   44 VVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDI 391
             VF G+G VGKTSI+ +F    F E Y PTVED +++        + L+  D+ G+Y F AMR +++   + F+LV++ + + SF E++ +L E+ +E++     P+ +V NK D+
Sbjct:   12 AVFGGAG-VGKTSIVKRFYCGKFSEEYEPTVEDCYSKVLNKNGSIMVLNTTDSSGSYQFPAMREVAIKRASGFILVYSLDSKFSFEELKRLLYEV-IEKKKSADIPVVLVGNKKDL 125          
BLAST of Ras family protein vs. Ensembl Nematostella
Match: EDO30327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T133])

HSP 1 Score: 83.1889 bits (204), Expect = 5.476e-19
Identity = 38/116 (32.76%), Postives = 67/116 (57.76%), Query Frame = 2
Query:   44 VVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDI 391
            +   G   VGKTSI+ +F    F E Y PTVED +++        + L+  D+ G+Y F AMR +++   + F+LV++ + + SF E++ +L E+ +E++     P+ +V NK D+
Sbjct:   11 IAVFGGAGVGKTSIVKRFYCGKFSEEYEPTVEDCYSKVLNKNGSIMVLNTTDSSGSYQFPAMREVAIKRASGFILVYSLDSKFSFEELKRLLYEV-IEKKKSADIPVVLVGNKKDL 125          
BLAST of Ras family protein vs. Ensembl Medaka
Match: ENSORLT00000000267.2 (ras-related protein Rap-2a [Source:NCBI gene;Acc:101163576])

HSP 1 Score: 104.76 bits (260), Expect = 1.546e-26
Identity = 46/116 (39.66%), Postives = 81/116 (69.83%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSD 388
            R+VFLG+G VGKT++I++F+ +TFD ++R TVE+I  + +E G+  + ++ +DT G+Y+F AMR++S+ +G AF LV++ +D  S   V+ + +E+   +ED    P+ ++ NK D
Sbjct:   12 RLVFLGAGGVGKTALIHRFLQDTFDPKHRRTVEEIHRKEYEVGDVKVTINIIDTSGSYSFPAMRKLSIQTGDAFALVYSVDDPDSLETVKRLRDEIIELKED-KHAPIVVIGNKID 126          
BLAST of Ras family protein vs. Ensembl Medaka
Match: rasd2 (dexamethasone-induced Ras-related protein 1 [Source:NCBI gene;Acc:101165889])

HSP 1 Score: 96.2857 bits (238), Expect = 4.369e-22
Identity = 59/180 (32.78%), Postives = 99/180 (55.00%), Query Frame = 2
Query:    2 MQSTTNCNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEEL-----KMEREDFGQFPLAIVC-NKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSL 523
            + S  NC+     R+V LG+  VGK++II +F+   F+E Y+PT ED + + F  G  + ++D +D     +F A RR+S+ +G  F+LVF+ +DR S  E+  +L E+     K+ + +  +   A+VC NK+D+      +T S++TE L     +   F   SAK+   +   FR+L
Sbjct:  163 LTSRRNCH-----RLVVLGAPRVGKSNIIRRFLCEEFEEHYKPTAEDFYRKLFFIGGEAYQVDVLDAACERDFPAKRRLSILTGDIFLLVFSLDDRDSLNEIHELLAEIRAAKAKLLKSNHPRMVPAVVCGNKADL-DAHRAVTRSDVTEILG----EDVPFFEASAKTGTGLQGCFRAL 332          
BLAST of Ras family protein vs. Ensembl Medaka
Match: ENSORLT00000033796.1 (ras related dexamethasone induced 1 [Source:NCBI gene;Acc:101173549])

HSP 1 Score: 93.2041 bits (230), Expect = 9.558e-22
Identity = 57/169 (33.73%), Postives = 97/169 (57.40%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEE-------LKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLW 526
            R+V LGS  VGKT+II++F+   FD++Y PT+ED   + +       +LD +DT G + F AMRR+S+ +G  F+LVF+ ++R SF EVQ +  +       L+ + ++    PL I  NK D      ++ + E+ E L+  + +   F   SAK +  + ++F++L+
Sbjct:   21 RMVILGSTKVGKTAIISRFLNERFDDQYTPTIEDFHRKFYSIRGDVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFQEVQRLKRQIHETKSCLRNKTKENVDVPLVICGNKCD-RDFYREVQDEEI-EQLVGGDEQCAYFEI-SAKKNTNVDQMFQTLF 186          
BLAST of Ras family protein vs. Ensembl Medaka
Match: ENSORLT00000047032.1 (ras-related protein Rap-1b [Source:NCBI gene;Acc:101172864])

HSP 1 Score: 90.8929 bits (224), Expect = 1.222e-21
Identity = 57/177 (32.20%), Postives = 94/177 (53.11%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ-NFQAVTPIKFNK 568
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  F LV++   + +F ++Q + E++ +  +D    P+ +V NK D+        ES +    ++       F+  SAKS   ++EIF  L  Q N ++  P K  K
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEIDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI-LRVKDTEDVPMILVGNKCDLEVERVVAKESGIG---LARQWNSCAFLETSAKSKINVNEIFYDLVRQINKKSPVPGKTRK 177          
BLAST of Ras family protein vs. Ensembl Medaka
Match: rap1aa (ras-related protein O-Krev [Source:NCBI gene;Acc:101171247])

HSP 1 Score: 88.9669 bits (219), Expect = 6.573e-21
Identity = 55/176 (31.25%), Postives = 93/176 (52.84%), Query Frame = 2
Query:   41 RVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPIKFNK 568
            ++V LGSG VGK+++  +F+   F E+Y PT+ED + +  E       L+ +DT GT  FTAMR + M +G  F LV++   + +F ++Q + E++ +  +D    P+ +V NK D   +E++    +     ++       F+  SAKS   ++EIF  L  Q  +   P K  K
Sbjct:    5 KLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEIDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI-LRVKDTEDVPMILVGNKCD---LEDERVVGKEQGQNLARQWNNCAFLETSAKSKINVNEIFYDLVRQINRKSPPEKKTK 176          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000077284.1 (SMESG000077284.1)

HSP 1 Score: 181.8 bits (460), Expect = 4.057e-55
Identity = 87/181 (48.07%), Postives = 124/181 (68.51%), Query Frame = 2
Query:   23 NSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMER-EDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPIKF 562
            N + P RV+FLG+G  GKTS+IN+F+ N F+  YRPTVEDIF R F   +  I+++ +DTGG YNF  MR+I + +  AFVLVF+Q+   SF   + +  ELK+E+ E+    P+ I CNKSD  T+E  I+E E+ +WL+   LKPTQF+  SA++++ I +IF SLWIQN+ +  P+KF
Sbjct:    2 NDEKPIRVLFLGAGKTGKTSLINRFLTNKFENLYRPTVEDIFHREFHVRSCVIDIEILDTGGYYNFIGMRKIYIKTSVAFVLVFSQDSYSSFDVCKDLYSELKLEKNEELTNAPIVIACNKSDSITVE--ISEIEIMDWLVKSQLKPTQFVFCSARNNENIIDIFESLWIQNYNSENPLKF 180          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000074007.1 (SMESG000074007.1)

HSP 1 Score: 135.191 bits (339), Expect = 1.739e-37
Identity = 66/179 (36.87%), Postives = 109/179 (60.89%), Query Frame = 2
Query:   29 KYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIEL--DFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQN-FQAVTPI 556
            K P R+VFLGSG VGKT +I++ +     E+Y PT+EDI++R  E  +  I+L  + +DT G++NF  M  +S++   AFVLV + +D  S  +V+ +L +++ +R+DF   P+ I CNK+D+  + +   E  ++     ++++  Q +  SAK  + + EIF SLW QN F+   PI
Sbjct:    5 KKPCRIVFLGSGKVGKTCLIHRLLKMQIAEKYHPTIEDIYSRDIEKSDEKIQLKIEILDTSGSFNFAGMLALSISQATAFVLVCSVDDDFSIEQVKNLLSQIQSQRDDFDLIPICITCNKTDMKALYSKDIEKLISSLQSDLHVESNQIVLTSAKLDENVLEIFHSLWNQNIFKKAFPI 183          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000015251.1 (SMESG000015251.1)

HSP 1 Score: 124.79 bits (312), Expect = 1.616e-33
Identity = 68/166 (40.96%), Postives = 101/166 (60.84%), Query Frame = 2
Query:   44 VVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMER-EDF-GQFPLAIVCNKSDIPTIENDITESELTE-WLISMNLKPTQFICGSAKSSDKISEIFRSLWIQ 532
            + FLG+G VGKTSII +F+ +TF E+Y PTVED FT+  +     + + F+D+ G+Y F AMRR+ +    AFVLVF+  D+ SF  +  +L E+K  R  DF    P+ I  NK+D   IE    E E+ E W+++ ++     I  SAK++D I  +F++LW Q
Sbjct:    7 IAFLGTGKVGKTSIIRQFLQHTFIEKYTPTVEDTFTKVIDINGQQVNVQFIDSSGSYAFPAMRRLWIQKATAFVLVFSVTDKESFELLDSLLAEIKDVRGSDFQSNIPIVIAGNKND---IEKKCVEDEIAEDWVLNNDVPFDSLIFCSAKTNDSIHSLFQALWEQ 169          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000067334.1 (SMESG000067334.1)

HSP 1 Score: 122.094 bits (305), Expect = 7.657e-31
Identity = 59/181 (32.60%), Postives = 106/181 (58.56%), Query Frame = 2
Query:   44 VVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMERED--FGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPIKFNKIENE 580
            ++FLG   VGKTS+I +FI   FDE+Y PTVED++ R +E  +++  ++F+DT G Y F AMRR++++   AFVL+ +     S   +  + +++  E+++  F + P+ I+ NKSD  + +  I+E+++ +W    N+     I  S K    + ++F+SLW Q  +    +K +   N+
Sbjct:  268 ILFLGDAQVGKTSLIKRFINEEFDEKYTPTVEDVYIRQYEINDWAYCIEFLDTSGRYTFPAMRRLNISKATAFVLMISMTQSNSIESLSQLWDDVLEEKDEGVFNKLPVVIIANKSDSLS-QYQISENDIHQWAKQRNVPTDNVIVCSCKDESGVWDVFQSLWEQKVKTSPHLKISPRSNQ 447          
BLAST of Ras family protein vs. Planmine SMEST
Match: SMESG000049496.1 (SMESG000049496.1)

HSP 1 Score: 115.931 bits (289), Expect = 5.253e-30
Identity = 71/197 (36.04%), Postives = 103/197 (52.28%), Query Frame = 2
Query:   44 VVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFTRTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFLEVQGILEELKMERED--------FGQFPLAIVCNKSDIPTIENDITESELTEWLISMNLKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPIKFNKIENETSNRLEGSSL 610
            +VF G G  GK+ +I +F+  TFD+ YR T+ED++ R FE    +++L F+DTGG YNF AMR++S+     FV VF+  D  S   +  IL  +   +              PL I+ NK D+   +  + E E+  WL    L   QF   SAK  D I + F +L+ Q F+   PI     EN+  N+L GSS+
Sbjct:   14 IVFFGGGKTGKSCLIKQFLNQTFDKEYRSTIEDVYNRKFEINGRALDLQFIDTGGLYNFPAMRKLSIKKAVGFVFVFSLTDEESLYYLTDILNLINETKSSNNSSQILFTSSVPLIILGNKMDLLN-KRCLYEDEIDRWLFESKLSKEQFFLTSAKEEDGIWDAFSNLYFQ-FEKQFPIISEDFENK--NKL-GSSI 205          
The following BLAST results are available for this feature:
BLAST of Ras family protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASD29.478e-2332.07RASD family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
RASD11.332e-2233.14ras related dexamethasone induced 1 [Source:HGNC S... [more]
DIRAS24.830e-2233.54DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
RAP1B5.347e-2130.81RAP1B, member of RAS oncogene family [Source:HGNC ... [more]
RAP1B5.347e-2130.81RAP1B, member of RAS oncogene family [Source:HGNC ... [more]
back to top
BLAST of Ras family protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssr-26.189e-3036.90Sperm-Specific family, class R [Source:UniProtKB/... [more]
drn-11.116e-2132.93GTP-binding protein drn-1 [Source:UniProtKB/Swiss... [more]
rap-17.761e-2029.94Ras-related protein Rap-1 [Source:UniProtKB/Swiss... [more]
ras-24.720e-1733.12GTP binding protein; R-RAS related [Source:UniPro... [more]
ras-24.720e-1733.12GTP binding protein; R-RAS related [Source:UniPro... [more]
back to top
BLAST of Ras family protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG301583.737e-3536.20gene:FBgn0050158 transcript:FBtr0086165[more]
CG133757.690e-2834.86gene:FBgn0040370 transcript:FBtr0342963[more]
CG133751.834e-2734.86gene:FBgn0040370 transcript:FBtr0070103[more]
CG133751.834e-2734.86gene:FBgn0040370 transcript:FBtr0300326[more]
Rap15.513e-2333.93gene:FBgn0004636 transcript:FBtr0303154[more]
back to top
BLAST of Ras family protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasd43.884e-2533.33rasd family member 4 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
rasd32.065e-2231.36RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
si:dkey-27j5.53.191e-2230.73si:dkey-27j5.5 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
rasd33.557e-2231.36RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
rasd16.827e-2234.32RAS, dexamethasone-induced 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Ras family protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ras-dva21.453e-2440.68small GTPase Ras-dva-2 [Source:NCBI gene;Acc:73345... [more]
angptl58.116e-2438.52angiopoietin like 5 [Source:Xenbase;Acc:XB-GENE-47... [more]
rasd22.638e-2332.07RASD family member 2 [Source:NCBI gene;Acc:548760][more]
rasd18.575e-2334.86ras related dexamethasone induced 1 [Source:NCBI g... [more]
rasd19.040e-2334.86ras related dexamethasone induced 1 [Source:NCBI g... [more]
back to top
BLAST of Ras family protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rasd27.974e-2332.07RASD family, member 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Rasd27.974e-2332.07RASD family, member 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Rasd11.004e-2233.14RAS, dexamethasone-induced 1 [Source:MGI Symbol;Ac... [more]
Diras25.715e-2233.54DIRAS family, GTP-binding RAS-like 2 [Source:MGI S... [more]
Rap1b3.671e-2130.81RAS related protein 1b [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ras family protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96D21|RHES_HUMAN4.552e-2232.07GTP-binding protein Rhes OS=Homo sapiens OX=9606 G... [more]
sp|Q5R6S2|DIRA2_PONAB4.957e-2234.15GTP-binding protein Di-Ras2 OS=Pongo abelii OX=960... [more]
sp|P08645|RAP1_DROME5.526e-2233.93Ras-related protein Rap1 OS=Drosophila melanogaste... [more]
sp|P63033|RHES_RAT5.578e-2232.07GTP-binding protein Rhes OS=Rattus norvegicus OX=1... [more]
sp|P63032|RHES_MOUSE5.578e-2232.07GTP-binding protein Rhes OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Ras family protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183VT069.055e-4636.36Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A3Q0KPB47.626e-4540.10Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183RZ031.979e-4440.10Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A430QGE93.621e-4440.10RAS, dexamethasone-induced Ras-related protein 1 O... [more]
A0A183PAN04.668e-4439.59Uncharacterized protein OS=Schistosoma mattheei OX... [more]
back to top
BLAST of Ras family protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000027032.21.220e-2632.73GTP-binding protein Rhes-like [Source:NCBI gene;Ac... [more]
rasd42.177e-2633.14ras-related protein Rap-1b-like [Source:NCBI gene;... [more]
ENSAMXT00000052770.11.078e-2330.62dexamethasone-induced Ras-related protein 1-like [... [more]
rap1aa1.036e-2129.73RAP1A, member of RAS oncogene family [Source:NCBI ... [more]
rap1b1.065e-2130.81RAP1B, member of RAS oncogene family [Source:NCBI ... [more]
back to top
BLAST of Ras family protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasd34.859e-2944.83RASD family member 3 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
RIT24.737e-1832.79Ras like without CAAX 2 [Source:HGNC Symbol;Acc:HG... [more]
DIRAS22.696e-1732.89DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
DIRAS28.327e-1730.92DIRAS family GTPase 2 [Source:HGNC Symbol;Acc:HGNC... [more]
ralba7.746e-1626.71v-ral simian leukemia viral oncogene homolog Ba (r... [more]
back to top
BLAST of Ras family protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RSR11.544e-2134.19GTP-binding protein of the Ras superfamily; requir... [more]
YPT61.820e-1534.75Rab family GTPase; required for endosome-to-Golgii... [more]
YPT536.831e-1330.81Stress-induced Rab family GTPase; required for vac... [more]
RAS12.435e-1129.33GTPase involved in G-protein signaling in adenylat... [more]
RHB11.140e-1025.00Putative Rheb-related GTPase; involved in regulati... [more]
back to top
BLAST of Ras family protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO365781.694e-2434.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO271381.694e-2434.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390475.400e-2229.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334844.040e-1935.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303275.476e-1932.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras family protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000267.21.546e-2639.66ras-related protein Rap-2a [Source:NCBI gene;Acc:1... [more]
rasd24.369e-2232.78dexamethasone-induced Ras-related protein 1 [Sourc... [more]
ENSORLT00000033796.19.558e-2233.73ras related dexamethasone induced 1 [Source:NCBI g... [more]
ENSORLT00000047032.11.222e-2132.20ras-related protein Rap-1b [Source:NCBI gene;Acc:1... [more]
rap1aa6.573e-2131.25ras-related protein O-Krev [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras family protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077284.14.057e-5548.07SMESG000077284.1[more]
SMESG000074007.11.739e-3736.87SMESG000074007.1[more]
SMESG000015251.11.616e-3340.96SMESG000015251.1[more]
SMESG000067334.17.657e-3132.60SMESG000067334.1[more]
SMESG000049496.15.253e-3036.04SMESG000049496.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017852 ID=SMED30017852|Name=Ras family protein|organism=Schmidtea mediterranea sexual|type=transcript|length=962bp
GATGCAATCTACCACAAATTGTAACTCTAAATATCCTCCAAGAGTTGTTT
TCCTAGGATCTGGAGCTGTTGGTAAAACTTCAATAATTAATAAATTTATT
TATAACACTTTTGATGAGAGATATCGGCCAACTGTGGAAGATATTTTTAC
TCGAACCTTTGAATTCGGAAATTATTCCATCGAATTAGACTTTATGGATA
CTGGAGGGACATATAACTTCACTGCAATGCGAAGAATAAGCATGAACAGT
GGAGCGGCATTTGTTTTAGTTTTTGCTCAAAATGATCGAGGTTCATTTCT
AGAAGTTCAAGGCATTTTGGAAGAACTTAAAATGGAGAGAGAAGACTTCG
GACAATTTCCGTTGGCAATTGTTTGTAATAAATCTGACATTCCAACTATA
GAAAACGACATAACAGAATCAGAACTTACAGAATGGTTGATATCAATGAA
TCTCAAGCCAACTCAATTCATTTGTGGATCGGCAAAATCTTCAGATAAAA
TTTCGGAAATTTTTCGCAGCTTGTGGATTCAAAACTTTCAAGCGGTGACA
CCGATTAAATTCAACAAAATCGAAAACGAAACCTCAAATCGTCTGGAAGG
ATCGAGTTTATTGCATACGAATTCTTCATCCTTTCTTCAGTTGCATGATT
ATAACACAAAAACCGTCCATGATGAATTTTCACATGTGTCCAATGAGATC
AACACTGAAACCGGAACAAAATTAAATAGAAATATTTTCCGGTCAAGTCT
GAAATTGAAAAGAAAGTCAACGAAAAAAAAACGAAACCCAAGCCAAAATA
TCATCACACTAAATTGCAAGATTTCGTGAATGTGAAAATTGTGAGTTAGA
AAAGATTTAGTTAGTTTGTGCTTTGTCATAGTTTTGTTAGATCTTGTTTA
ATTCTTTATAAATATTATTATAATTAAAAATTTATCAAACCTATTTTACG
TATCATACGCGC
back to top

protein sequence of SMED30017852-orf-1

>SMED30017852-orf-1 ID=SMED30017852-orf-1|Name=SMED30017852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=276bp
MQSTTNCNSKYPPRVVFLGSGAVGKTSIINKFIYNTFDERYRPTVEDIFT
RTFEFGNYSIELDFMDTGGTYNFTAMRRISMNSGAAFVLVFAQNDRGSFL
EVQGILEELKMEREDFGQFPLAIVCNKSDIPTIENDITESELTEWLISMN
LKPTQFICGSAKSSDKISEIFRSLWIQNFQAVTPIKFNKIENETSNRLEG
SSLLHTNSSSFLQLHDYNTKTVHDEFSHVSNEINTETGTKLNRNIFRSSL
KLKRKSTKKKRNPSQNIITLNCKIS*
back to top
Aliases
The feature 'Ras family protein' has the following synonyms
Synonym
Smed_09720
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0004708MAP kinase kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR020849Small_GTPase_Ras-type
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0000165MAPK cascade
GO:0000187activation of MAPK activity
GO:0001756somitogenesis
GO:0003428chondrocyte intercalation involved in growth plate cartilage morphogenesis
GO:0007165signal transduction
GO:0007507heart development
GO:0032525somite rostral/caudal axis specification
GO:0060026convergent extension
GO:0060536cartilage morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005911cell-cell junction
GO:0016020membrane
GO:0030054cell junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 13..34
score: 32.85
coord: 36..52
score: 27.95
coord: 53..75
score: 24.71
coord: 117..130
score: 31.92
coord: 156..178
score: 24.92
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 8..181
e-value: 5.2E-18
score: 75.8
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 14..181
e-value: 2.8E-5
score: -43.9
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 15..181
e-value: 1.6E-5
score: -46.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 12..181
e-value: 1.2E-36
score: 127.7
NoneNo IPR availablePANTHERPTHR24070:SF290RAS-DVA-2 SMALL GTPASE-RELATEDcoord: 10..274
NoneNo IPR availablePROSITEPS51419RABcoord: 8..234
score: 13.371
IPR001806Small GTPasePFAMPF00071Rascoord: 14..174
e-value: 7.6E-29
score: 100.4
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 11..169
e-value: 2.2E-16
score: 58.0
IPR020849Small GTPase superfamily, Ras-typePANTHERPTHR24070FAMILY NOT NAMEDcoord: 10..274
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 10..186