Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30017850
Length (bp)468
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30017850) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30017850) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP4C (protein phosphatase 4 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9319])

HSP 1 Score: 159.844 bits (403), Expect = 1.553e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP4C (protein phosphatase 4 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9319])

HSP 1 Score: 159.844 bits (403), Expect = 1.553e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP2CB (protein phosphatase 2 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9300])

HSP 1 Score: 129.798 bits (325), Expect = 6.772e-37
Identity = 65/132 (49.24%), Postives = 89/132 (67.42%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + +EQL +CK ++E +V+ LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+P+RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP2CA (protein phosphatase 2 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9299])

HSP 1 Score: 128.257 bits (321), Expect = 3.505e-36
Identity = 67/132 (50.76%), Postives = 88/132 (66.67%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL +CK +SE +VK LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+ +RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP6C (protein phosphatase 6 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9323])

HSP 1 Score: 119.783 bits (299), Expect = 4.417e-33
Identity = 61/134 (45.52%), Postives = 84/134 (62.69%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVVA 465
            DL + +E  + CK++ E  +K LC    ++L+EESNVQ V +P+T              LF+    +P+TNY+F+ DFVD G+YS+E   +LLA K + PDRITL R +HES QIT+VYGFYDE   KY +  A
Sbjct:    5 DLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANA 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-4.1 (Serine/threonine-protein phosphatase 4 catalytic subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XW79])

HSP 1 Score: 148.288 bits (373), Expect = 3.536e-44
Identity = 73/132 (55.30%), Postives = 90/132 (68.18%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            DL R IE+L +C+ I+E  VK LC+K +EIL EE NVQ+++SP+T              LFK    +PNTNYLFL DFVD GFYSVE  L LLA K R+PDR+ L R +HES QIT+VYGFYDE +RKY + 
Sbjct:   31 DLDRHIEKLMRCELIAEQDVKTLCAKAREILAEEGNVQVIDSPVTICGDIHGQFYDLMELFKVGGPVPNTNYLFLGDFVDRGFYSVETFLLLLALKARYPDRMMLIRGNHESRQITQVYGFYDECLRKYGNA 162          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-4.2 (Serine/threonine-protein phosphatase 4 catalytic subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTT8])

HSP 1 Score: 133.265 bits (334), Expect = 3.251e-40
Identity = 67/132 (50.76%), Postives = 90/132 (68.18%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRS 456
            +DL RQIE   +C+ I E +VK +C+K +EIL+EE+NVQ++++P+T              LF+     PNTNYLFL D+VD G+ SVE  + L+  K R+PDRITL R +HES QIT+VYGFYDE +RKY S
Sbjct:   15 NDLDRQIEIAMRCELICETQVKSICAKVREILIEEANVQVIDTPVTICGDIHGQFHDLMELFRVGGSPPNTNYLFLGDYVDRGYNSVETFILLMLLKCRYPDRITLIRGNHESRQITQVYGFYDECVRKYGS 146          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-4.2 (Serine/threonine-protein phosphatase 4 catalytic subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTT8])

HSP 1 Score: 134.035 bits (336), Expect = 7.719e-39
Identity = 67/132 (50.76%), Postives = 90/132 (68.18%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRS 456
            +DL RQIE   +C+ I E +VK +C+K +EIL+EE+NVQ++++P+T              LF+     PNTNYLFL D+VD G+ SVE  + L+  K R+PDRITL R +HES QIT+VYGFYDE +RKY S
Sbjct:   15 NDLDRQIEIAMRCELICETQVKSICAKVREILIEEANVQVIDTPVTICGDIHGQFHDLMELFRVGGSPPNTNYLFLGDYVDRGYNSVETFILLMLLKCRYPDRITLIRGNHESRQITQVYGFYDECVRKYGS 146          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: let-92 (Serine/threonine-protein phosphatase 2A catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:G5EGK8])

HSP 1 Score: 127.102 bits (318), Expect = 3.709e-36
Identity = 66/129 (51.16%), Postives = 85/129 (65.89%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            D+ + IEQL +CK +SE +VK LC K KEIL +E NVQ V  P+T              LFK     P+TNYLF+ D+VD G+YSVE +  L+  K+R+ DR+TL R +HES QIT+VYGFYDE +RKY
Sbjct:   18 DVDQWIEQLYECKPLSENQVKTLCEKAKEILEKEPNVQEVRCPVTVCGDVHGQFHDLMELFKMGGKSPDTNYLFMGDYVDRGYYSVETVSLLVCLKIRYKDRVTLLRGNHESRQITQVYGFYDECLRKY 146          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: let-92 (Serine/threonine-protein phosphatase 2A catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:G5EGK8])

HSP 1 Score: 127.102 bits (318), Expect = 3.709e-36
Identity = 66/129 (51.16%), Postives = 85/129 (65.89%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            D+ + IEQL +CK +SE +VK LC K KEIL +E NVQ V  P+T              LFK     P+TNYLF+ D+VD G+YSVE +  L+  K+R+ DR+TL R +HES QIT+VYGFYDE +RKY
Sbjct:   18 DVDQWIEQLYECKPLSENQVKTLCEKAKEILEKEPNVQEVRCPVTVCGDVHGQFHDLMELFKMGGKSPDTNYLFMGDYVDRGYYSVETVSLLVCLKIRYKDRVTLLRGNHESRQITQVYGFYDECLRKY 146          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp4-19C (gene:FBgn0023177 transcript:FBtr0077325)

HSP 1 Score: 157.532 bits (397), Expect = 6.231e-48
Identity = 80/136 (58.82%), Postives = 95/136 (69.85%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D+SDL RQIEQLK+C+ I E  VK LC+K +EIL+EE NVQ V+SP+T              LFK   D+P  NYLF+ DFVD G+YSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY S  
Sbjct:    3 DYSDLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTA 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp4-19C (gene:FBgn0023177 transcript:FBtr0077324)

HSP 1 Score: 157.532 bits (397), Expect = 6.231e-48
Identity = 80/136 (58.82%), Postives = 95/136 (69.85%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D+SDL RQIEQLK+C+ I E  VK LC+K +EIL+EE NVQ V+SP+T              LFK   D+P  NYLF+ DFVD G+YSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY S  
Sbjct:    3 DYSDLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTA 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp4-19C (gene:FBgn0023177 transcript:FBtr0345017)

HSP 1 Score: 157.532 bits (397), Expect = 6.231e-48
Identity = 80/136 (58.82%), Postives = 95/136 (69.85%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D+SDL RQIEQLK+C+ I E  VK LC+K +EIL+EE NVQ V+SP+T              LFK   D+P  NYLF+ DFVD G+YSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY S  
Sbjct:    3 DYSDLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTA 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp4-19C (gene:FBgn0023177 transcript:FBtr0445386)

HSP 1 Score: 157.532 bits (397), Expect = 6.231e-48
Identity = 80/136 (58.82%), Postives = 95/136 (69.85%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D+SDL RQIEQLK+C+ I E  VK LC+K +EIL+EE NVQ V+SP+T              LFK   D+P  NYLF+ DFVD G+YSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY S  
Sbjct:    3 DYSDLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTA 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp4-19C (gene:FBgn0023177 transcript:FBtr0346620)

HSP 1 Score: 157.532 bits (397), Expect = 6.231e-48
Identity = 80/136 (58.82%), Postives = 95/136 (69.85%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D+SDL RQIEQLK+C+ I E  VK LC+K +EIL+EE NVQ V+SP+T              LFK   D+P  NYLF+ DFVD G+YSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY S  
Sbjct:    3 DYSDLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPEKNYLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSTA 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp4cb (protein phosphatase 4, catalytic subunit b [Source:NCBI gene;Acc:562705])

HSP 1 Score: 159.844 bits (403), Expect = 1.054e-48
Identity = 81/136 (59.56%), Postives = 97/136 (71.32%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D SDL RQI+QL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    3 DMSDLDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp4ca (protein phosphatase 4, catalytic subunit a [Source:NCBI gene;Acc:100003080])

HSP 1 Score: 154.066 bits (388), Expect = 2.471e-46
Identity = 78/136 (57.35%), Postives = 95/136 (69.85%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D +DL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   ++P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGF+DE  RKY S  
Sbjct:    7 DFTDLDRQIEQLRRCELIKENEVKALCAKAREILVEESNVQSVDSPVTVCGDIHGQFYDLKELFRVGGEVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFFDECHRKYGSAT 142          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp2cb (protein phosphatase 2, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-040426-2487])

HSP 1 Score: 130.183 bits (326), Expect = 3.229e-37
Identity = 65/132 (49.24%), Postives = 89/132 (67.42%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + +EQL +CK ++E +V+ LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+P+RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWVEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp2cb (protein phosphatase 2, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-040426-2487])

HSP 1 Score: 130.183 bits (326), Expect = 3.229e-37
Identity = 65/132 (49.24%), Postives = 89/132 (67.42%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + +EQL +CK ++E +V+ LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+P+RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWVEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp2ca (protein phosphatase 2, catalytic subunit, alpha isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-441])

HSP 1 Score: 128.642 bits (322), Expect = 1.636e-36
Identity = 67/132 (50.76%), Postives = 89/132 (67.42%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL +CK +SE +VK+LC K KEIL +ESNVQ V  P+T              LFK     P+TNYLF+ D+VD G+YSVE +  L++ KVR+ +RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNECKQLSENQVKILCEKAKEILSKESNVQEVRCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVSLKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: f2 (coagulation factor II, thrombin [Source:Xenbase;Acc:XB-GENE-481539])

HSP 1 Score: 159.844 bits (403), Expect = 1.378e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: atp13a5 (ATPase type 13A5 [Source:Xenbase;Acc:XB-GENE-12441880])

HSP 1 Score: 128.257 bits (321), Expect = 4.212e-37
Identity = 67/132 (50.76%), Postives = 88/132 (66.67%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL +CK +SE +VK LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+ +RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNECKQLSENQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: atp13a5 (ATPase type 13A5 [Source:Xenbase;Acc:XB-GENE-12441880])

HSP 1 Score: 128.642 bits (322), Expect = 2.258e-36
Identity = 67/132 (50.76%), Postives = 88/132 (66.67%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL +CK +SE +VK LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+ +RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNECKQLSENQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp6c (uncharacterized loc100216173 [Source:Xenbase;Acc:XB-GENE-5997771])

HSP 1 Score: 122.865 bits (307), Expect = 2.711e-34
Identity = 62/134 (46.27%), Postives = 85/134 (63.43%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVVA 465
            DL + +E  +QCK++ E  +K LC    ++L+EESNVQ V +P+T              LF+    +P+TNY+F+ DFVD G+YS+E   +LLA K + PDRITL R +HES QIT+VYGFYDE   KY +  A
Sbjct:    5 DLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANA 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp6c (uncharacterized loc100216173 [Source:Xenbase;Acc:XB-GENE-5997771])

HSP 1 Score: 106.301 bits (264), Expect = 3.897e-28
Identity = 55/120 (45.83%), Postives = 76/120 (63.33%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLTLFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVVA 465
            DL + +E  +QCK++ E  +K LC    ++L+EESNVQ V +P+T+  ++            DFVD G+YS+E   +LLA K + PDRITL R +HES QIT+VYGFYDE   KY +  A
Sbjct:    5 DLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHG--------QGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANA 116          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp4c (protein phosphatase 4, catalytic subunit [Source:MGI Symbol;Acc:MGI:1891763])

HSP 1 Score: 159.844 bits (403), Expect = 1.066e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp4c (protein phosphatase 4, catalytic subunit [Source:MGI Symbol;Acc:MGI:1891763])

HSP 1 Score: 159.844 bits (403), Expect = 1.066e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp2cb (protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:1321161])

HSP 1 Score: 129.798 bits (325), Expect = 4.649e-37
Identity = 65/132 (49.24%), Postives = 89/132 (67.42%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + +EQL +CK ++E +V+ LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+P+RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp2ca (protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform [Source:MGI Symbol;Acc:MGI:1321159])

HSP 1 Score: 128.257 bits (321), Expect = 2.458e-36
Identity = 67/132 (50.76%), Postives = 88/132 (66.67%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL +CK +SE +VK LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+ +RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp6c (protein phosphatase 6, catalytic subunit [Source:MGI Symbol;Acc:MGI:1915107])

HSP 1 Score: 122.865 bits (307), Expect = 2.053e-34
Identity = 62/134 (46.27%), Postives = 85/134 (63.43%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVVA 465
            DL + +E  +QCK++ E  +K LC    ++L+EESNVQ V +P+T              LF+    +P+TNY+F+ DFVD G+YS+E   +LLA K + PDRITL R +HES QIT+VYGFYDE   KY +  A
Sbjct:    5 DLDKYVEIARQCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANA 138          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q6P861|PP4C_XENTR (Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis OX=8364 GN=ppp4c PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 7.301e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q6IP91|PP4C_XENLA (Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis OX=8355 GN=ppp4c PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 7.301e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q5BJ92|PP4C_RAT (Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp4c PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 7.301e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q5R6K8|PP4C_PONAB (Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii OX=9601 GN=PPP4C PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 7.460e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P97470|PP4C_MOUSE (Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus OX=10090 GN=Ppp4c PE=1 SV=2)

HSP 1 Score: 159.844 bits (403), Expect = 7.460e-48
Identity = 81/134 (60.45%), Postives = 96/134 (71.64%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    5 SDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A4Y2RLE5 (Serine/threonine-protein phosphatase OS=Araneus ventricosus OX=182803 GN=ppp4c_1 PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 6.895e-48
Identity = 86/154 (55.84%), Postives = 105/154 (68.18%), Query Frame = 1
Query:   43 ILEFVINFILKFSQNMSVDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            IL   +   + F  ++  D SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LFK   D+P+TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    9 ILAISLRMRILFEDSIMEDCSDLDRQIEQLRRCEIIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 162          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A0K2U272 (Serine/threonine-protein phosphatase (Fragment) OS=Lepeophtheirus salmonis OX=72036 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.001e-47
Identity = 83/135 (61.48%), Postives = 97/135 (71.85%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            DHSDL RQI QL++C+ I E  VK LCSK +EIL+EESNVQ V+SP+T              LFK   D+P+TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY S 
Sbjct:    3 DHSDLDRQIAQLRKCEIIKESEVKSLCSKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSA 137          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: F4WTJ8 (Serine/threonine-protein phosphatase OS=Acromyrmex echinatior OX=103372 GN=G5I_09196 PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.396e-47
Identity = 82/137 (59.85%), Postives = 97/137 (70.80%), Query Frame = 1
Query:   94 VDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
             + SDL RQIEQLK+C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LFK   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY S+ 
Sbjct:    2 AESSDLDRQIEQLKKCEIIKEAEVKALCAKAREILIEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSIT 138          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: B3S495 (Serine/threonine-protein phosphatase OS=Trichoplax adhaerens OX=10228 GN=TRIADDRAFT_64151 PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.541e-47
Identity = 85/137 (62.04%), Postives = 99/137 (72.26%), Query Frame = 1
Query:   94 VDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLTL--------------FKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            +D+SDL RQIEQLK C+ ISE  VK LCSK KEIL EESNVQ V++P+TL              FK   D+P+TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY S+ 
Sbjct:    2 MDYSDLDRQIEQLKLCETISESEVKALCSKAKEILAEESNVQKVDAPVTLCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSIT 138          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A5J4N682 (Serine/threonine-protein phosphatase (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0003643 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.210e-47
Identity = 81/133 (60.90%), Postives = 95/133 (71.43%), Query Frame = 1
Query:  100 HSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRS 456
            HSDL RQIEQL+ C  I+E  VK LC+K +EIL+EESNVQ V+SP+T              LFK   D+P+TNYLFL DFVD G+YSVE  L LLA KVR+PDRITL R +HES QIT VYGFY+E +RKY S
Sbjct:    4 HSDLDRQIEQLRACTLITEDEVKALCAKAREILIEESNVQCVDSPVTVCGDIHGQFYDLIELFKVGGDVPDTNYLFLGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITTVYGFYEECLRKYGS 136          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp4cb (protein phosphatase 4 catalytic subunit [Source:NCBI gene;Acc:103024225])

HSP 1 Score: 159.073 bits (401), Expect = 1.653e-48
Identity = 81/136 (59.56%), Postives = 97/136 (71.32%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D SDL RQI+QL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    3 DISDLDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp4cb (protein phosphatase 4 catalytic subunit [Source:NCBI gene;Acc:103024225])

HSP 1 Score: 159.073 bits (401), Expect = 1.653e-48
Identity = 81/136 (59.56%), Postives = 97/136 (71.32%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D SDL RQI+QL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    3 DISDLDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp2ca (protein phosphatase 2, catalytic subunit, alpha isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-441])

HSP 1 Score: 131.724 bits (330), Expect = 5.686e-38
Identity = 64/119 (53.78%), Postives = 89/119 (74.79%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLTLFKNVKD-IPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL +CK +SE +VK+LC K KEIL +ESNVQ V  P+T+  ++    P+TNYLF+ D+VD G+YSVE +  L++ KVR+ +RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNECKQLSENQVKILCEKAKEILSKESNVQEVRCPVTVCGDIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVSLKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA 127          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ENSAMXT00000037663.1 (protein phosphatase 2 catalytic subunit alpha [Source:NCBI gene;Acc:103045214])

HSP 1 Score: 127.872 bits (320), Expect = 2.125e-36
Identity = 67/132 (50.76%), Postives = 87/132 (65.91%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL  CK +SE +VK LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A KVR+ +RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNDCKQLSESQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp2cb (protein phosphatase 2, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-040426-2487])

HSP 1 Score: 127.102 bits (318), Expect = 5.490e-36
Identity = 64/132 (48.48%), Postives = 87/132 (65.91%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + +EQL +CK ++E +V+ LC K KEIL +ESNVQ V  P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+A K R P+RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWVEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKGRFPERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005238.1 (pep scaffold:Pmarinus_7.0:GL487052:8065:11513:-1 gene:ENSPMAG00000004764.1 transcript:ENSPMAT00000005238.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 1.609e-28
Identity = 53/105 (50.48%), Postives = 70/105 (66.67%), Query Frame = 1
Query:  178 SKGKEILMEESNVQIVESPLTLFKNVKD--------------IPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            S+ KEIL +ESNVQ V  P+T+  +V                 P+TNYLF+ D+VD G+YSVE +  L+A KVR+ +RIT+ R +HES QIT+VYGFYDE +RKY
Sbjct:   13 SQAKEILTKESNVQEVRCPVTVCGDVHGQFHDLIELFNIGGKSPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKY 117          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 81.6481 bits (200), Expect = 4.453e-20
Identity = 41/115 (35.65%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  148 ISEMRVKVLCSKGKEILMEESNVQIVESPLTLFKNVKD--------------IPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            ++E  V+ LC K +EI + +  +  +E+PL +  ++                 P +NYLFL D+VD G  S+E I  LLAYK+++P+   L R +HE   I ++YGFYDE  R++
Sbjct:   16 MTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRF 130          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005085.1 (pep scaffold:Pmarinus_7.0:GL481040:2845:3652:-1 gene:ENSPMAG00000004627.1 transcript:ENSPMAT00000005085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.032e-19
Identity = 40/109 (36.70%), Postives = 61/109 (55.96%), Query Frame = 1
Query:  148 ISEMRVKVLCSKGKEILMEESNVQIVESPLTLFKNVKD--------------IPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYD 432
            +SE  V+ LC K +EI + +  +  +E+PL +  ++                 P +NYLFL D+VD G  S+E I  LLAYK+++P+   L R +HE   I ++YGFYD
Sbjct:   26 MSEAEVRALCIKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 134          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 78.9518 bits (193), Expect = 1.524e-18
Identity = 41/115 (35.65%), Postives = 66/115 (57.39%), Query Frame = 1
Query:  148 ISEMRVKVLCSKGKEILMEESNVQIVESPLTLFKNVKD--------------IPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            ++E  ++ LC K +EI + +  +  +E+PL +  ++                 P +NYLFL D+VD G  S+E I  LLAYK+++P+   L R +HE+  I ++YGFYDE  R+Y
Sbjct:   12 LTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEA-SINRIYGFYDECKRRY 125          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 3.918e-16
Identity = 34/72 (47.22%), Postives = 46/72 (63.89%), Query Frame = 1
Query:  235 LTLFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            L LF+     P  NYLFL D+VD G  S+E I  LLAYK+++P+   L R +HE   I ++YGFYDE  R++
Sbjct:   11 LRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRF 82          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH3 (Catalytic subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form active complex, Psy4p may provide substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; involved in activation of Gln3p to alleviate nitrogen catabolite repression; Pph3p and Psy2p localize to foci on meiotic chromosomes [Source:SGD;Acc:S000002482])

HSP 1 Score: 117.087 bits (292), Expect = 3.652e-33
Identity = 64/129 (49.61%), Postives = 79/129 (61.24%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESP--------------LTLFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            DL + I  L+  K I E  V  LC   +E+LM E NV  V++P              LTLF+    +  T Y+FL DFVD GFYS+E  L LL YK+R+PDRITL R +HE+ QITKVYGFYDE +RKY
Sbjct:    3 DLDKIIASLRDGKHIPEETVFRLCLNSQELLMNEGNVTQVDTPVTICGDIHGQLHDLLTLFEKSGGVEKTRYIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKY 131          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH22 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph21p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; protein abundance increases in response to DNA replication stress; dephosphorylates Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase release from telomeres at G2/M; PPH22 has a paralog, PPH21, that arose from the whole genome duplication [Source:SGD;Acc:S000002347])

HSP 1 Score: 115.546 bits (288), Expect = 5.812e-32
Identity = 65/157 (41.40%), Postives = 93/157 (59.24%), Query Frame = 1
Query:   31 GTKSILEFVINFILKFSQNMSVDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            G+  I +   +  LK + N +++  D +  IE L +C+ +SE  V  LC    ++L  E NV+ +  P+T              LFK     P+TNYLF+ D+VD G+YSVE + +L+A KVR+P RIT+ R +HES QIT+VYGFYDE +RKY S 
Sbjct:   55 GSSGIADHKSSKPLKLT-NTNINQLDQW--IEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSA 208          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 114.39 bits (285), Expect = 1.451e-31
Identity = 60/131 (45.80%), Postives = 81/131 (61.83%), Query Frame = 1
Query:  109 LYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            L + IE L +C+ +SE  V  LC    ++L  E NV+ +  P+T              LFK     P+TNYLF+ D+VD G+YSVE + +L+A KVR+P RIT+ R +HES QIT+VYGFYDE +RKY S 
Sbjct:   70 LDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSA 200          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: SIT4 (Ceramide-activated, type 2A-related serine-threonine phosphatase; functions in G1/S transition of mitotic cycle; controls lifespan, mitochondrial function, cell cycle progression by regulating HXK2 phosphorylation; regulator of COPII coat dephosphorylation; required for ER to Golgi traffic; interacts with Hrr25p kinase; cytoplasmic and nuclear protein that modulates functions mediated by Pkc1p including cell wall and actin cytoskeleton organization; similar to human PP6 [Source:SGD;Acc:S000002205])

HSP 1 Score: 112.464 bits (280), Expect = 2.617e-31
Identity = 56/129 (43.41%), Postives = 82/129 (63.57%), Query Frame = 1
Query:  121 IEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNT-NYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            +E +K+C+ ++E  +K LC   KE+LMEESN+Q V++P+T              LF+     P+  NY+FL D+VD G+YS+E    L+  KV++P +ITL R +HES QIT+VYGFY+E + KY S  
Sbjct:   10 LETIKKCQALTENEMKQLCEMVKELLMEESNIQPVQTPVTVCGDIHGQFHDLLELFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLMCLKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYGSTT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPG1 (Putative serine/threonine protein phosphatase; putative phosphatase of the type 2A-like phosphatase family, required for glycogen accumulation; interacts with Tap42p, which binds to and regulates other protein phosphatases [Source:SGD;Acc:S000005315])

HSP 1 Score: 105.145 bits (261), Expect = 3.371e-28
Identity = 54/124 (43.55%), Postives = 80/124 (64.52%), Query Frame = 1
Query:  121 IEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            +E+L + + + E+ V+ LC K KE+L++ESNV  +++P+T              +F+    +P+TNYLFL D+VD G YSVE I+ L+  K+R+P RI L R +HES QIT+ YGFY E + KY
Sbjct:    7 LERLYKAQLLPEVTVRALCFKLKEMLVKESNVIHIQTPVTVVGDMHGQFHDMLEIFQIGGPVPDTNYLFLGDYVDRGLYSVETIMLLIVLKLRYPSRIHLLRGNHESRQITQSYGFYTECLNKY 130          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 158.688 bits (400), Expect = 1.020e-48
Identity = 80/137 (58.39%), Postives = 98/137 (71.53%), Query Frame = 1
Query:   94 VDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
             D SDL RQIE+L+ C+ I+E  VK LC+K +EIL+EESNVQ V+SP+T              LFK   D+P+TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE ++KY S+ 
Sbjct:    2 ADCSDLDRQIEKLRNCELITEKEVKQLCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSIT 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 125.946 bits (315), Expect = 4.855e-36
Identity = 66/132 (50.00%), Postives = 85/132 (64.39%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            DL   IEQL +CK ++E +VK LC K KEIL +ESNVQ V+ P+T              LF+     P+TNYLF+ D+VD G+YSVE +  L+  KVR P RI + R +HES QIT+VYGFYDE +RKY + 
Sbjct:   10 DLEVWIEQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNA 141          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO38434 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SD13])

HSP 1 Score: 121.324 bits (303), Expect = 1.442e-35
Identity = 63/135 (46.67%), Postives = 84/135 (62.22%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVVA 465
            +DL R I+  K+C+++ E  +K LC    E+L+EESNVQ V SP+T              LF+    +PNT+Y+F+ DFVD G+YS+E    LL  K + PDRITL R +HES QIT+VYGFYDE   KY +  A
Sbjct:    2 ADLDRWIDIAKECEYLPENDLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVFMGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQSKYGNANA 136          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO30146 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T1L8])

HSP 1 Score: 120.939 bits (302), Expect = 1.280e-34
Identity = 63/135 (46.67%), Postives = 84/135 (62.22%), Query Frame = 1
Query:  103 SDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVVA 465
            +DL R I+  K+C+++ E  +K LC    E+L+EESNVQ V SP+T              LF+    +PNT+Y+F+ DFVD G+YS+E    LL  K + PDRITL R +HES QIT+VYGFYDE   KY +  A
Sbjct:    2 ADLDRWIDIAKECEYLPENDLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVFMGDFVDRGYYSLETFTRLLTLKAKWPDRITLLRGNHESRQITQVYGFYDECQSKYGNANA 136          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 82.8037 bits (203), Expect = 1.158e-19
Identity = 41/115 (35.65%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  148 ISEMRVKVLCSKGKEILMEESNVQIVESPLTLFKNVKD--------------IPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY 450
            ++E  ++ LC K +EI + +  +  +E+PL +  ++                 P +NYLFL D+VD G  S+E I  LLAYK+++P+   L R +HE   I ++YGFYDE  R+Y
Sbjct:   30 LTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY 144          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp4cb (protein phosphatase 4 catalytic subunit [Source:NCBI gene;Acc:101159020])

HSP 1 Score: 160.614 bits (405), Expect = 5.548e-49
Identity = 82/136 (60.29%), Postives = 97/136 (71.32%), Query Frame = 1
Query:   97 DHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            D SDL RQIEQL++C+ I E  VK LC+K +EIL+EESNVQ V+SP+T              LF+   D+P TNYLF+ DFVD GFYSVE  L LLA KVR+PDRITL R +HES QIT+VYGFYDE +RKY SV 
Sbjct:    7 DISDLDRQIEQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVT 142          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000041911.1 (protein phosphatase 2 catalytic subunit beta [Source:NCBI gene;Acc:101157601])

HSP 1 Score: 128.642 bits (322), Expect = 1.067e-36
Identity = 66/132 (50.00%), Postives = 87/132 (65.91%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL +CK ++E +V+ LC K KEIL +ESNVQ V  P+T              LFK     P+TNYLF+ D+VD G+YSVE +  L+  KVR P+RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNECKQLTENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000001163.2 (protein phosphatase 2 catalytic subunit alpha [Source:NCBI gene;Acc:101173325])

HSP 1 Score: 127.487 bits (319), Expect = 3.757e-36
Identity = 67/132 (50.76%), Postives = 87/132 (65.91%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +L + IEQL +CK ++E +VK LC K KEIL +ESNVQ V  P+T              LFK     P+TNYLF+ D+VD G+YSVE +  L+A KVR  +RIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    9 ELDQWIEQLNECKQLTEGQVKTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRFRERITILRGNHESRQITQVYGFYDECLRKYGNA 140          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP6C (serine/threonine-protein phosphatase 6 catalytic subunit [Source:NCBI gene;Acc:101168723])

HSP 1 Score: 121.709 bits (304), Expect = 5.115e-34
Identity = 62/134 (46.27%), Postives = 84/134 (62.69%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVVA 465
            DL + +E  K CK++ E  +K LC    ++L+EESNVQ V +P+T              LF+    +P+TNY+F+ DFVD G+YS+E   +LLA K + PDRITL R +HES QIT+VYGFYDE   KY +  A
Sbjct:    5 DLDKYVEIAKHCKYLPENDLKRLCDYVCDLLLEESNVQPVATPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANA 138          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP6C (serine/threonine-protein phosphatase 6 catalytic subunit [Source:NCBI gene;Acc:101168723])

HSP 1 Score: 104.76 bits (260), Expect = 9.416e-28
Identity = 55/120 (45.83%), Postives = 75/120 (62.50%), Query Frame = 1
Query:  106 DLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLTLFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVVA 465
            DL + +E  K CK++ E  +K LC    ++L+EESNVQ V +P+T+  ++            DFVD G+YS+E   +LLA K + PDRITL R +HES QIT+VYGFYDE   KY +  A
Sbjct:    5 DLDKYVEIAKHCKYLPENDLKRLCDYVCDLLLEESNVQPVATPVTVCGDIHG--------QGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANA 116          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000080901.1 (SMESG000080901.1)

HSP 1 Score: 200.29 bits (508), Expect = 1.201e-64
Identity = 103/139 (74.10%), Postives = 108/139 (77.70%), Query Frame = 1
Query:   88 MSVDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSVV 462
            MSVDHSDL RQIEQLKQCK ISEM VK+LCSK KEILMEESNVQIVESP+T              LFKN  DIPNTNYLFL DFVD GFYSVE  L LLAYKVR+PDRITL R +HES QIT+VYGFYDE MRKY S V
Sbjct:    1 MSVDHSDLDRQIEQLKQCKLISEMEVKILCSKAKEILMEESNVQIVESPVTVCGDIHGQFYDLLELFKNGGDIPNTNYLFLGDFVDRGFYSVETFLLLLAYKVRYPDRITLIRGNHESRQITQVYGFYDECMRKYGSAV 139          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000015405.1 (SMESG000015405.1)

HSP 1 Score: 174.481 bits (441), Expect = 9.308e-56
Identity = 91/136 (66.91%), Postives = 102/136 (75.00%), Query Frame = 1
Query:   88 MSVDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLTL--------------FKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYR 453
            MSVDH DL +Q+EQLK CK I  M+VKVLCSK KEILMEESNVQIVESP+TL              FKN +DI NTNYLFL DFVD GFY VE+ + LL YKVR PDRITL R +H+S QIT+VYGFY+E MRKYR
Sbjct:    1 MSVDHIDLDQQLEQLKYCKLILVMKVKVLCSKAKEILMEESNVQIVESPVTLCGNTYGQFYDLLELFKNSRDILNTNYLFLGDFVDPGFYFVEISILLLVYKVRFPDRITLIRGNHQSRQITQVYGFYEECMRKYR 136          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000010596.1 (SMESG000010596.1)

HSP 1 Score: 131.724 bits (330), Expect = 6.069e-38
Identity = 67/137 (48.91%), Postives = 92/137 (67.15%), Query Frame = 1
Query:   91 SVDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +++  +L   I+QL +CK +SE +VK+LC K KEIL +E NVQ+V+ P+T              LFK     P+TNYLF+ D+VD G+YSVE +  L+A KVR+ DRIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    3 TIETKELDDWIQQLYECKQLSEAQVKLLCEKAKEILEKEGNVQLVKCPVTVCGDVHGQFHDLMELFKIGGKAPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYKDRITILRGNHESRQITQVYGFYDECLRKYTNA 139          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000009093.1 (SMESG000009093.1)

HSP 1 Score: 127.872 bits (320), Expect = 1.890e-36
Identity = 69/136 (50.74%), Postives = 89/136 (65.44%), Query Frame = 1
Query:   94 VDHSDLYRQIEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            V++ DL + IEQL   K ++E +VKVLC   KEIL +ESNVQ V+ P+T              LFK     P+TNYLF+ D+VD G+YSVE +  L+A KVR  DRIT+ R +HES QIT+VYGFYDE +RKY + 
Sbjct:    4 VEYKDLDQWIEQLYDNKQLTESQVKVLCETAKEILAKESNVQPVKCPVTVCGDVHGQFHDLMELFKIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRFKDRITILRGNHESRQITQVYGFYDECLRKYTNA 139          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000023415.1 (SMESG000023415.1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.069e-24
Identity = 53/127 (41.73%), Postives = 77/127 (60.63%), Query Frame = 1
Query:  121 IEQLKQCKFISEMRVKVLCSKGKEILMEESNVQIVESPLT--------------LFKNVKDIPNTNYLFLEDFVDCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKYRSV 459
            +E   +CK++ E  +  LC     +L+EE N+Q V +P+T              LF+   DI  TNY+F+ DFVD G+YS+E +  LL  K ++P++ITL R +HES QIT+VYGFYDE + KY + 
Sbjct:   10 LEYAYKCKYLPENDLNRLCDYVSLLLIEECNIQPVSTPVTICGDIHGQFYDLLELFRTGGDIVQTNYIFMGDFVDRGYYSLETLTLLLVLKAKYPEKITLLRGNHESRQITQVYGFYDECLNKYGNA 136          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP4C1.553e-4860.45protein phosphatase 4 catalytic subunit [Source:HG... [more]
PPP4C1.553e-4860.45protein phosphatase 4 catalytic subunit [Source:HG... [more]
PPP2CB6.772e-3749.24protein phosphatase 2 catalytic subunit beta [Sour... [more]
PPP2CA3.505e-3650.76protein phosphatase 2 catalytic subunit alpha [Sou... [more]
PPP6C4.417e-3345.52protein phosphatase 6 catalytic subunit [Source:HG... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pph-4.13.536e-4455.30Serine/threonine-protein phosphatase 4 catalytic s... [more]
pph-4.23.251e-4050.76Serine/threonine-protein phosphatase 4 catalytic s... [more]
pph-4.27.719e-3950.76Serine/threonine-protein phosphatase 4 catalytic s... [more]
let-923.709e-3651.16Serine/threonine-protein phosphatase 2A catalytic ... [more]
let-923.709e-3651.16Serine/threonine-protein phosphatase 2A catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pp4-19C6.231e-4858.82gene:FBgn0023177 transcript:FBtr0077325[more]
Pp4-19C6.231e-4858.82gene:FBgn0023177 transcript:FBtr0077324[more]
Pp4-19C6.231e-4858.82gene:FBgn0023177 transcript:FBtr0345017[more]
Pp4-19C6.231e-4858.82gene:FBgn0023177 transcript:FBtr0445386[more]
Pp4-19C6.231e-4858.82gene:FBgn0023177 transcript:FBtr0346620[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp4cb1.054e-4859.56protein phosphatase 4, catalytic subunit b [Source... [more]
ppp4ca2.471e-4657.35protein phosphatase 4, catalytic subunit a [Source... [more]
ppp2cb3.229e-3749.24protein phosphatase 2, catalytic subunit, beta iso... [more]
ppp2cb3.229e-3749.24protein phosphatase 2, catalytic subunit, beta iso... [more]
ppp2ca1.636e-3650.76protein phosphatase 2, catalytic subunit, alpha is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
f21.378e-4860.45coagulation factor II, thrombin [Source:Xenbase;Ac... [more]
atp13a54.212e-3750.76ATPase type 13A5 [Source:Xenbase;Acc:XB-GENE-12441... [more]
atp13a52.258e-3650.76ATPase type 13A5 [Source:Xenbase;Acc:XB-GENE-12441... [more]
ppp6c2.711e-3446.27uncharacterized loc100216173 [Source:Xenbase;Acc:X... [more]
ppp6c3.897e-2845.83uncharacterized loc100216173 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp4c1.066e-4860.45protein phosphatase 4, catalytic subunit [Source:M... [more]
Ppp4c1.066e-4860.45protein phosphatase 4, catalytic subunit [Source:M... [more]
Ppp2cb4.649e-3749.24protein phosphatase 2 (formerly 2A), catalytic sub... [more]
Ppp2ca2.458e-3650.76protein phosphatase 2 (formerly 2A), catalytic sub... [more]
Ppp6c2.053e-3446.27protein phosphatase 6, catalytic subunit [Source:M... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P861|PP4C_XENTR7.301e-4860.45Serine/threonine-protein phosphatase 4 catalytic s... [more]
sp|Q6IP91|PP4C_XENLA7.301e-4860.45Serine/threonine-protein phosphatase 4 catalytic s... [more]
sp|Q5BJ92|PP4C_RAT7.301e-4860.45Serine/threonine-protein phosphatase 4 catalytic s... [more]
sp|Q5R6K8|PP4C_PONAB7.460e-4860.45Serine/threonine-protein phosphatase 4 catalytic s... [more]
sp|P97470|PP4C_MOUSE7.460e-4860.45Serine/threonine-protein phosphatase 4 catalytic s... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2RLE56.895e-4855.84Serine/threonine-protein phosphatase OS=Araneus ve... [more]
A0A0K2U2721.001e-4761.48Serine/threonine-protein phosphatase (Fragment) OS... [more]
F4WTJ81.396e-4759.85Serine/threonine-protein phosphatase OS=Acromyrmex... [more]
B3S4951.541e-4762.04Serine/threonine-protein phosphatase OS=Trichoplax... [more]
A0A5J4N6822.210e-4760.90Serine/threonine-protein phosphatase (Fragment) OS... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp4cb1.653e-4859.56protein phosphatase 4 catalytic subunit [Source:NC... [more]
ppp4cb1.653e-4859.56protein phosphatase 4 catalytic subunit [Source:NC... [more]
ppp2ca5.686e-3853.78protein phosphatase 2, catalytic subunit, alpha is... [more]
ENSAMXT00000037663.12.125e-3650.76protein phosphatase 2 catalytic subunit alpha [Sou... [more]
ppp2cb5.490e-3648.48protein phosphatase 2, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005238.11.609e-2850.48pep scaffold:Pmarinus_7.0:GL487052:8065:11513:-1 g... [more]
ppp1cb4.453e-2035.65protein phosphatase 1, catalytic subunit, beta iso... [more]
ENSPMAT00000005085.11.032e-1936.70pep scaffold:Pmarinus_7.0:GL481040:2845:3652:-1 ge... [more]
ppp1cab1.524e-1835.65protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.13.918e-1647.22pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PPH33.652e-3349.61Catalytic subunit of protein phosphatase PP4 compl... [more]
PPH225.812e-3241.40Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH211.451e-3145.80Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
SIT42.617e-3143.41Ceramide-activated, type 2A-related serine-threoni... [more]
PPG13.371e-2843.55Putative serine/threonine protein phosphatase; put... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499361.020e-4858.39Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297594.855e-3650.00Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO384341.442e-3546.67Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO301461.280e-3446.67Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO446481.158e-1935.65Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp4cb5.548e-4960.29protein phosphatase 4 catalytic subunit [Source:NC... [more]
ENSORLT00000041911.11.067e-3650.00protein phosphatase 2 catalytic subunit beta [Sour... [more]
ENSORLT00000001163.23.757e-3650.76protein phosphatase 2 catalytic subunit alpha [Sou... [more]
PPP6C5.115e-3446.27serine/threonine-protein phosphatase 6 catalytic s... [more]
PPP6C9.416e-2845.83serine/threonine-protein phosphatase 6 catalytic s... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080901.11.201e-6474.10SMESG000080901.1[more]
SMESG000015405.19.308e-5666.91SMESG000015405.1[more]
SMESG000010596.16.069e-3848.91SMESG000010596.1[more]
SMESG000009093.11.890e-3650.74SMESG000009093.1[more]
SMESG000023415.11.069e-2441.73SMESG000023415.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017850 ID=SMED30017850|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=468bp
ATGTTTGTTTTTTATACTCATCAATTAGTTGGAACAAAATCAATATTAGA
ATTTGTTATTAATTTTATTCTTAAATTTTCACAAAATATGTCCGTTGATC
ATAGTGATTTATATCGACAAATAGAACAGCTGAAGCAATGTAAATTTATT
TCAGAAATGAGAGTTAAAGTTTTATGTTCTAAAGGTAAAGAAATTTTAAT
GGAAGAAAGTAATGTTCAAATCGTCGAATCTCCATTAACTCTTTTCAAGA
ATGTTAAAGATATTCCTAACACAAATTATTTGTTTCTCGAGGATTTCGTT
GATTGTGGCTTTTATTCAGTGGAAATGATTTTATTTTTGCTTGCCTACAA
AGTCAGACATCCAGATAGAATCACTTTAACCAGAGATCATCATGAAAGTC
ATCAAATCACTAAAGTATATGGATTTTATGATGAATCTATGAGAAAGTAC
AGATCAGTTGTAGCATGA
back to top

protein sequence of SMED30017850-orf-1

>SMED30017850-orf-1 ID=SMED30017850-orf-1|Name=SMED30017850-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MFVFYTHQLVGTKSILEFVINFILKFSQNMSVDHSDLYRQIEQLKQCKFI
SEMRVKVLCSKGKEILMEESNVQIVESPLTLFKNVKDIPNTNYLFLEDFV
DCGFYSVEMILFLLAYKVRHPDRITLTRDHHESHQITKVYGFYDESMRKY
RSVVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR006186Ser/Thr-sp_prot-phosphatase
IPR029052Metallo-depent_PP-like
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 91..118
score: 52.99
coord: 124..148
score: 52.12
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 22..153
e-value: 1.2E-29
score: 104.9
NoneNo IPR availablePANTHERPTHR45619:SF8SERINE/THREONINE-PROTEIN PHOSPHATASE 4 CATALYTIC SUBUNITcoord: 33..151
NoneNo IPR availablePANTHERPTHR45619FAMILY NOT NAMEDcoord: 33..151
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 30..149