Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30017847
Length (bp)2980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30017847) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30017847) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30017847) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30017847) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017847

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017847SMESG000062657.1 Contig5023GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017847SMESG000056697.1 PL06011A1G12ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017847SMESG000056697.1 Contig5023GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017847SMESG000056697.1 dd_Smed_v4_1371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017847SMESG000056697.1 dd_Smed_v4_1371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DSTYK (dual serine/threonine and tyrosine protein kinase [Source:HGNC Symbol;Acc:HGNC:29043])

HSP 1 Score: 199.904 bits (507), Expect = 3.798e-52
Identity = 156/536 (29.10%), Postives = 260/536 (48.51%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDE-IGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            RK E EL+E +  + +  + ++   ++E L    E +++   ++E+ + I VPENG  +  R I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  K + + VH                 + SNY    L A  + E     G +V   L ++I   I+              S    + EWK + A+E ++    S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   + +   + +++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D        I++   +  +  D+   LK   ++++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F R  S     LW +     RPERL    +E W+LM+ACWD +P  RP
Sbjct:  395 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDATNMEFKDVI-VPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLQSLEKSQDVSVH-----------------ITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRI---------TWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASK--DHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRP 897          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: DSTYK (dual serine/threonine and tyrosine protein kinase [Source:HGNC Symbol;Acc:HGNC:29043])

HSP 1 Score: 153.295 bits (386), Expect = 2.306e-37
Identity = 141/535 (26.36%), Postives = 237/535 (44.30%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDE-IGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            RK E EL+E +  + +  + ++   ++E L    E +++   ++E+ + I VPENG  +  R I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  K + + VH                 + SNY    L A  + E     G +V   L ++I   I+              S    + EWK + A+E ++    S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   + +   + +++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D        I++   +  +  D+   LK   ++++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+   A                                               RPERL    +E W+LM+ACWD +P  RP
Sbjct:  395 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDATNMEFKDVI-VPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLQSLEKSQDVSVH-----------------ITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRI---------TWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLRVRKDHAPRLARLSLESCSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGA-----------------------------------------------RPERLPVFDEECWQLMEACWDGDPLKRP 852          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK7 (NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC:13386])

HSP 1 Score: 106.301 bits (264), Expect = 2.418e-24
Identity = 87/298 (29.19%), Postives = 141/298 (47.32%), Query Frame = 2
Query: 1991 VSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSC--NGQEMAKKTVN----LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVS---KYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESV 2839
            + E+ +       P F     L  D+ G   L    + +KIG+G   EVYR +C  +G  +A K V     +      D  +E+       HP ++   A  I D+      +++I   L    D+S   K+ K+ K  I ER   K  +Q+  AL+++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   D  S+EL +L+  C + +P  RPD+  V
Sbjct:    1 MDEQSQGMQGPPVPQFQPQKALRPDM-GYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDN------ELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYV 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK7 (NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC:13386])

HSP 1 Score: 106.301 bits (264), Expect = 2.418e-24
Identity = 87/298 (29.19%), Postives = 141/298 (47.32%), Query Frame = 2
Query: 1991 VSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSC--NGQEMAKKTVN----LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVS---KYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESV 2839
            + E+ +       P F     L  D+ G   L    + +KIG+G   EVYR +C  +G  +A K V     +      D  +E+       HP ++   A  I D+      +++I   L    D+S   K+ K+ K  I ER   K  +Q+  AL+++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   D  S+EL +L+  C + +P  RPD+  V
Sbjct:    1 MDEQSQGMQGPPVPQFQPQKALRPDM-GYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDN------ELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYV 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK6 (NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC:7749])

HSP 1 Score: 100.138 bits (248), Expect = 3.543e-22
Identity = 81/273 (29.67%), Postives = 132/273 (48.35%), Query Frame = 2
Query: 2075 RYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQL---------NDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVS---KYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESV 2839
            R  L    + +KIG+G   EVY+ +C    + +KTV L   Q+          D  +E+       HP ++  +   I D+      +++I   L    D+S   KY K+ K  I ER   K  +Q+  A++++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   +  S++L EL+  C   +P  RPDI  V
Sbjct:   39 RCSLADFQIEKKIGRGQFSEVYKATC---LLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDN------ELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYV 299          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: frk-1 (Fer-related kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q22146])

HSP 1 Score: 102.064 bits (253), Expect = 1.023e-22
Identity = 80/342 (23.39%), Postives = 166/342 (48.54%), Query Frame = 2
Query: 1883 LAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFA--GLLMLTLDVKGRYMLQ--GIVVNEKIGQGAQGEVYRCSCN---GQEMAKKTVNLPMNQLNDI--AEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSM-ALSNHSFVGTPVH-IAPEIVRKAIYDFKVDIYSYGMLLWYL-AEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQA-CWDNEPSVRPDIESVLCKITLILEN 2869
            + +E+C+  + + +   N F        +  H++ ++SE I   M  K P  A  G  +     +  +++    IV N+K+G+GA G+V+    +    QE+A KT+     +   +   +E      +QH  ++ LI V+I +   +   +      L+      +LK+NKVS+ E+L+   + A+ + YL R + +HRD+   N LL   N + ++D+G   +   + + +    P+  +APE +++ +Y  K DI+++G+L+W + ++G   +P   ++Q+    V+     ++ R +  D     + +++   CW   P  R  ++S+  K+    E+
Sbjct:   63 VTDELCRHFMLNMDPTSNKFYF------EHTHQESTISELINWHMTTKTPISAASGAKIRRPMERSPWLINHDSIVANKKLGEGAFGDVFIAELDQGGKQEVAVKTMRAEATREARLRFMKEARLMRKYQHKHVVKLIGVAIHEHPLMIVMEYCPNGSLLS-----HLKKNKVSLIEKLRFTTEAADGIAYLERSKCIHRDIAARNCLLSAKNELKISDFGMSDNKDEIKDETLEKVPIKWLAPETMQEKVYTHKTDIWTFGVLVWEIYSDGAEPYPGLTKIQTRAKIVV-----NDYRMKMPDGTHPTVADVVTGTCWQKNPEKRSTMDSIHKKLREFYES 388          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: svh-2 (Tyrosine-protein kinase receptor svh-2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZU7])

HSP 1 Score: 102.064 bits (253), Expect = 1.011e-21
Identity = 68/265 (25.66%), Postives = 131/265 (49.43%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRCSCNGQEMAKKTV---NLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKR--NKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFV-----GTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELW-ELMQACWDNEPSVRPDIESVLCKITLILE 2866
            + IGQG  G VY+   +  +  ++ V    L   ++++  EE      F HP +L LI V++ DS+ L    I I   + K D+  +++   N + +++  + A  +A+ + Y+H ++ +HRDL   N LLD++  V +AD+G C+ + +    +V       PV   P  + +  +    DI+S+G+++W L    G  P ++ + S I  + W       R  +     ++L+ ++M ACW   P+ RP    ++  I  +++
Sbjct:  739 DPIGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEEARTMSEFDHPNILKLIGVALDDSSHL---PIIITEYMAKGDLKSFIENVENTIKMRDLFEFAFDIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPVRWFPPEISEQGFGITSDIWSFGVVIWELFT-RGSTP-YSNMASWILILPWLKESETNRLRKPPYCPEKLYTDVMLACWKANPAERPQFSDLVTIIPNVVK 998          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: svh-2 (Tyrosine-protein kinase receptor svh-2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZU7])

HSP 1 Score: 102.064 bits (253), Expect = 1.011e-21
Identity = 68/265 (25.66%), Postives = 131/265 (49.43%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRCSCNGQEMAKKTV---NLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKR--NKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFV-----GTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELW-ELMQACWDNEPSVRPDIESVLCKITLILE 2866
            + IGQG  G VY+   +  +  ++ V    L   ++++  EE      F HP +L LI V++ DS+ L    I I   + K D+  +++   N + +++  + A  +A+ + Y+H ++ +HRDL   N LLD++  V +AD+G C+ + +    +V       PV   P  + +  +    DI+S+G+++W L    G  P ++ + S I  + W       R  +     ++L+ ++M ACW   P+ RP    ++  I  +++
Sbjct:  739 DPIGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEEARTMSEFDHPNILKLIGVALDDSSHL---PIIITEYMAKGDLKSFIENVENTIKMRDLFEFAFDIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPVRWFPPEISEQGFGITSDIWSFGVVIWELFT-RGSTP-YSNMASWILILPWLKESETNRLRKPPYCPEKLYTDVMLACWKANPAERPQFSDLVTIIPNVVK 998          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: svh-2 (Tyrosine-protein kinase receptor svh-2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZU7])

HSP 1 Score: 102.064 bits (253), Expect = 1.179e-21
Identity = 68/265 (25.66%), Postives = 131/265 (49.43%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRCSCNGQEMAKKTV---NLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKR--NKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFV-----GTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELW-ELMQACWDNEPSVRPDIESVLCKITLILE 2866
            + IGQG  G VY+   +  +  ++ V    L   ++++  EE      F HP +L LI V++ DS+ L    I I   + K D+  +++   N + +++  + A  +A+ + Y+H ++ +HRDL   N LLD++  V +AD+G C+ + +    +V       PV   P  + +  +    DI+S+G+++W L    G  P ++ + S I  + W       R  +     ++L+ ++M ACW   P+ RP    ++  I  +++
Sbjct:  739 DPIGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEEARTMSEFDHPNILKLIGVALDDSSHL---PIIITEYMAKGDLKSFIENVENTIKMRDLFEFAFDIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPVRWFPPEISEQGFGITSDIWSFGVVIWELFT-RGSTP-YSNMASWILILPWLKESETNRLRKPPYCPEKLYTDVMLACWKANPAERPQFSDLVTIIPNVVK 998          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: svh-2 (Tyrosine-protein kinase receptor svh-2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZU7])

HSP 1 Score: 101.679 bits (252), Expect = 1.368e-21
Identity = 68/265 (25.66%), Postives = 131/265 (49.43%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRCSCNGQEMAKKTV---NLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKR--NKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFV-----GTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELW-ELMQACWDNEPSVRPDIESVLCKITLILE 2866
            + IGQG  G VY+   +  +  ++ V    L   ++++  EE      F HP +L LI V++ DS+ L    I I   + K D+  +++   N + +++  + A  +A+ + Y+H ++ +HRDL   N LLD++  V +AD+G C+ + +    +V       PV   P  + +  +    DI+S+G+++W L    G  P ++ + S I  + W       R  +     ++L+ ++M ACW   P+ RP    ++  I  +++
Sbjct:  739 DPIGQGHYGVVYKAMYSPSKSLEEKVVCKYLKEGKISEFYEEARTMSEFDHPNILKLIGVALDDSSHL---PIIITEYMAKGDLKSFIENVENTIKMRDLFEFAFDIAKGMNYMHSKKFIHRDLACRNCLLDEHLRVKIADFGLCRKVDIETELYVQMHERDLPVRWFPPEISEQGFGITSDIWSFGVVIWELFT-RGSTP-YSNMASWILILPWLKESETNRLRKPPYCPEKLYTDVMLACWKANPAERPQFSDLVTIIPNVVK 998          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0090002)

HSP 1 Score: 89.3521 bits (220), Expect = 2.174e-18
Identity = 78/270 (28.89%), Postives = 131/270 (48.52%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRC--SCNGQEMAKKTVNL----------PMNQLNDIAEEV-YYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRN-KVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSM----ALSNHSFVGTPVHIAPEIVR------KAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVL 2842
            E +G+G    V RC     G+E A K ++L          P + L    +E+     +  HP +     + + D  E D+    +F    K ++  YL     +S K+   I  Q+ E ++Y+H + I+HRDLK  NILLD+N+NV + D+GF K +     L+N    GTP ++APE ++         Y  +VDI++ G++++ L  G    P + R Q  + + +         PE  D IS++  +L++ C   +PS R  ++ VL
Sbjct:   27 EILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYI-----IDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTN--LCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGC--PPFWHRKQMVMLRNIMEGKYSFTSPEWAD-ISEDPKDLIRKCLVVDPSQRITVKEVL 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343648)

HSP 1 Score: 89.3521 bits (220), Expect = 2.174e-18
Identity = 78/270 (28.89%), Postives = 131/270 (48.52%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRC--SCNGQEMAKKTVNL----------PMNQLNDIAEEV-YYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRN-KVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSM----ALSNHSFVGTPVHIAPEIVR------KAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVL 2842
            E +G+G    V RC     G+E A K ++L          P + L    +E+     +  HP +     + + D  E D+    +F    K ++  YL     +S K+   I  Q+ E ++Y+H + I+HRDLK  NILLD+N+NV + D+GF K +     L+N    GTP ++APE ++         Y  +VDI++ G++++ L  G    P + R Q  + + +         PE  D IS++  +L++ C   +PS R  ++ VL
Sbjct:   27 EILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEISILRQVMGHPYI-----IDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTN--LCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGC--PPFWHRKQMVMLRNIMEGKYSFTSPEWAD-ISEDPKDLIRKCLVVDPSQRITVKEVL 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343587)

HSP 1 Score: 89.3521 bits (220), Expect = 2.188e-18
Identity = 81/272 (29.78%), Postives = 133/272 (48.90%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRC--SCNGQEMAKKTVNL----------PMNQLNDIAEEVYYSYLFQ---HPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRN-KVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSM----ALSNHSFVGTPVHIAPEIVR------KAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVL 2842
            E +G+G    V RC     G+E A K ++L          P + L    +E+  S L Q   HP +     + + D  E D+    +F    K ++  YL     +S K+   I  Q+ E ++Y+H + I+HRDLK  NILLD+N+NV + D+GF K +     L+N    GTP ++APE ++         Y  +VDI++ G++++ L    G  P + R Q  + + +         PE  D IS++  +L++ C   +PS R  ++ VL
Sbjct:   27 EILGRGISSTVRRCIEKETGKEFAAKIIDLGATTESGETNPYHMLEATRQEI--SILRQVMGHPYI-----IDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTN--LCGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLL--VGCPPFWHRKQMVMLRNIMEGKYSFTSPEWAD-ISEDPKDLIRKCLVVDPSQRITVKEVL 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 91.2781 bits (225), Expect = 2.294e-18
Identity = 74/245 (30.20%), Postives = 119/245 (48.57%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRC--SCNGQEMAKKTVNL---PMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNH---SFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPE--RLDEISDELWELMQACWDNE 2809
            EKIGQGA G VY    S  G E+A K +NL   P  +L  I  E+      +HP +     V+  DS  +  +   +   L    ++  +    +   +   +  +V +AL++LH  Q++HRD+K  NILL  + +V L D+GFC  ++       + VGTP  +APE+V +  Y  KVD++S G++   + EG    P +       A  L A+   N +PE    D++S    + +  C + E
Sbjct:  434 EKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKEL--IINEILVMRENKHPNV-----VNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEG---EPPYLNENPLKALYLIAT---NGKPEIKEKDKLSSAFQDFLDQCLEVE 665          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 91.2781 bits (225), Expect = 2.294e-18
Identity = 74/245 (30.20%), Postives = 119/245 (48.57%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRC--SCNGQEMAKKTVNL---PMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNH---SFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPE--RLDEISDELWELMQACWDNE 2809
            EKIGQGA G VY    S  G E+A K +NL   P  +L  I  E+      +HP +     V+  DS  +  +   +   L    ++  +    +   +   +  +V +AL++LH  Q++HRD+K  NILL  + +V L D+GFC  ++       + VGTP  +APE+V +  Y  KVD++S G++   + EG    P +       A  L A+   N +PE    D++S    + +  C + E
Sbjct:  434 EKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKEL--IINEILVMRENKHPNV-----VNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEG---EPPYLNENPLKALYLIAT---NGKPEIKEKDKLSSAFQDFLDQCLEVE 665          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 192.586 bits (488), Expect = 4.339e-50
Identity = 154/547 (28.15%), Postives = 273/547 (49.91%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNS---IKLFF------SKLFGTDQIKESV--------DVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRC-SCNGQE-MAKKTVNLPMNQ-LNDIAEEVYYSY-LFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E ELF  +  + +  + ++ + ++E L    E ++    +L++ + I +  NG  +  + I+ C    Q +I++ L Q + N +   V+  L + +   +E                +CLG      SLE+            +   +  HNV    +++ILN+   +++ F      ++LF  +QIK+ +           + EWK + A++ ++    + LA+ +C        + H AF  +L    +    ++  +E++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C S  G+   A K+V  P ++  ND+A E +Y+  L +H RL+ L   S+ D +      I++   +  +  D+   LK   +S+KERL IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WYL  G+ + P  F +  S     LW + +   RPERL    +E W+LM+ACW+ +PS RP
Sbjct:  355 REKEGELFCSLMAIANRKQEEMKEMIVETLSSMKEQLLEDAQNLDFTDII-MSSNGEPVSSKDIKVCISQIQDLIVNRLNQAVANKLTNSVDY-LRESFVGTLE----------------RCLG------SLEK------------STPESCAHNVTSNHLKQILNAAYHVEVTFHSGSSVTRLF-WEQIKQIIHRITWVNPPAITAEWKRKVAQDAIESLSAAKLAKSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDILLHGKPKLGRELGRGQYGVVYLCDSWAGRHPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHG-SVIDHSYSGGSSIAVLLIMERLHRDLYTGLKAG-LSLKERLLIALDVVEGIRFLHSQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYLCSGSVKLPEAFEKCASK--DQLWTNVKKGCRPERLPVFDEECWQLMEACWNGDPSQRP 859          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 188.734 bits (478), Expect = 5.885e-49
Identity = 147/530 (27.74%), Postives = 259/530 (48.87%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRC-SCNGQE-MAKKTVNLPMNQ-LNDIAEEVYYSY-LFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E ELF  +  + +  + ++ + ++E L    E ++    +L++ + I +  NG  +  + I+ C    Q +I++ L Q + N +   V+  L + +   +E                +CLG      SLE+            +   +  HNV    +++I++ I                    + EWK + A++ ++    + LA+ +C        + H AF  +L    +    ++  +E++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C S  G+   A K+V  P ++  ND+A E +Y+  L +H RL+ L   S+ D +      I++   +  +  D+   LK   +S+KERL IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WYL  G+ + P  F +  S     LW + +   RPERL    +E W+LM+ACW+ +PS RP
Sbjct:  355 REKEGELFCSLMAIANRKQEEMKEMIVETLSSMKEQLLEDAQNLDFTDII-MSSNGEPVSSKDIKVCISQIQDLIVNRLNQAVANKLTNSVDY-LRESFVGTLE----------------RCLG------SLEK------------STPESCAHNVTSNHLKQIIHRITWVNPPAI------------TAEWKRKVAQDAIESLSAAKLAKSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDILLHGKPKLGRELGRGQYGVVYLCDSWAGRHPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHG-SVIDHSYSGGSSIAVLLIMERLHRDLYTGLKAG-LSLKERLLIALDVVEGIRFLHSQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYLCSGSVKLPEAFEKCASK--DQLWTNVKKGCRPERLPVFDEECWQLMEACWNGDPSQRP 831          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 106.301 bits (264), Expect = 6.635e-25
Identity = 78/265 (29.43%), Postives = 132/265 (49.81%), Query Frame = 2
Query: 2093 IVVNEKIGQGAQGEVYRCSC--NGQEMAKKTVN----LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVSK---YLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVL 2842
             ++ +KIG+G   EVYR +C  N Q++A K V     +      D  +E+       HP ++  +   I ++      +++I   L    D+S+   + K+ +  I ER   K  +Q+  AL+++H +++MHRD+K AN+ +  +  V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A     H  F   + N+  +     +    P   +  S +  +L+  C + EP  RPDI  VL
Sbjct:    2 FLIEKKIGRGQFSEVYRATCLLNNQKVALKKVQIFEMMDAKARQDCVKEIDLLKQLNHPNVIKYLDSFIANN------ELNIVLELASAGDLSQMIMHFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITASGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALHSPFYSDKMNLLSLCHKIEQCEYPPLPTEHYSQKFRDLVSMCINPEPDQRPDISFVL 257          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070705-183])

HSP 1 Score: 100.523 bits (249), Expect = 1.052e-21
Identity = 71/254 (27.95%), Postives = 123/254 (48.43%), Query Frame = 2
Query: 2084 LQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLM-KTDVSKYLK---RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCK--SMALSNHSFVGTPVH-IAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            L  + + E IG+G  G V+     GQ +A K +   +       EE        H  L+PL+ V + +        + I   LM K ++  +L+   R  VS+ + L+ AL V E +++L  ++++HRDL   NIL+ ++    ++D+G  +  SMA+ N      PV   APE ++   +  + D++SYG+LLW +    GR P      + + + +    E   R +  DE   +++ +M +CW  EP  RP
Sbjct:  187 LSKLTLGEIIGEGEFGAVFAGEYTGQRVAVKIIKCDVTA-QAFLEETSVMTNLHHKNLVPLLGVILHNG-------LHIVTELMTKGNLVNFLRSRGRFAVSVIQLLRFALDVCEGMEHLESKKLLHRDLAGRNILVSEDGVAKISDFGLARVGSMAVDNSKL---PVKWTAPEALKNKKFSTQSDVWSYGVLLWEIFS-YGRQPYPKMTVNEVKECV----EKGYRMDPPDECPADVYSIMTSCWQTEPKKRP 424          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-070705-183])

HSP 1 Score: 100.523 bits (249), Expect = 1.083e-21
Identity = 71/254 (27.95%), Postives = 123/254 (48.43%), Query Frame = 2
Query: 2084 LQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLM-KTDVSKYLK---RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCK--SMALSNHSFVGTPVH-IAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            L  + + E IG+G  G V+     GQ +A K +   +       EE        H  L+PL+ V + +        + I   LM K ++  +L+   R  VS+ + L+ AL V E +++L  ++++HRDL   NIL+ ++    ++D+G  +  SMA+ N      PV   APE ++   +  + D++SYG+LLW +    GR P      + + + +    E   R +  DE   +++ +M +CW  EP  RP
Sbjct:  190 LSKLTLGEIIGEGEFGAVFAGEYTGQRVAVKIIKCDVTA-QAFLEETSVMTNLHHKNLVPLLGVILHNG-------LHIVTELMTKGNLVNFLRSRGRFAVSVIQLLRFALDVCEGMEHLESKKLLHRDLAGRNILVSEDGVAKISDFGLARVGSMAVDNSKL---PVKWTAPEALKNKKFSTQSDVWSYGVLLWEIFS-YGRQPYPKMTVNEVKECV----EKGYRMDPPDECPADVYSIMTSCWQTEPKKRP 427          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 182.956 bits (463), Expect = 6.855e-47
Identity = 144/533 (27.02%), Postives = 261/533 (48.97%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNY----KFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLK-RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E EL+E +  +    + +L   ++E L    E ++    ++++ + I++P+NG  +  + ++ C    + +I+S L Q + N +   V+  L + +   +E  + S  K +    E+     + +   L++IL + Y     FNS        G  V   + ++I+  I+              S    + EWK + A++ ++    S LA+ +C       ++ H AF  +L+        ++  + ++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D +      I++     +     Y+  +  +S++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  +   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F +  S     LW +     RPERL    +E W+LM+ACW+ +PS RP
Sbjct:  327 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKD-IAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDY-LRESFVGTLERCLRSLEKSQ---QESSSHVTSNH---LKQILNAAYHVEVTFNS--------GSTVTRMVWEQIVQIIQRI---------TWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRP 830          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 182.956 bits (463), Expect = 8.929e-47
Identity = 144/533 (27.02%), Postives = 261/533 (48.97%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNY----KFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLK-RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E EL+E +  +    + +L   ++E L    E ++    ++++ + I++P+NG  +  + ++ C    + +I+S L Q + N +   V+  L + +   +E  + S  K +    E+     + +   L++IL + Y     FNS        G  V   + ++I+  I+              S    + EWK + A++ ++    S LA+ +C       ++ H AF  +L+        ++  + ++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D +      I++     +     Y+  +  +S++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  +   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F +  S     LW +     RPERL    +E W+LM+ACW+ +PS RP
Sbjct:  390 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKD-IAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDY-LRESFVGTLERCLRSLEKSQ---QESSSHVTSNH---LKQILNAAYHVEVTFNS--------GSTVTRMVWEQIVQIIQRI---------TWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRP 893          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 182.185 bits (461), Expect = 9.905e-47
Identity = 144/533 (27.02%), Postives = 261/533 (48.97%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNY----KFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLK-RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E EL+E +  +    + +L   ++E L    E ++    ++++ + I++P+NG  +  + ++ C    + +I+S L Q + N +   V+  L + +   +E  + S  K +    E+     + +   L++IL + Y     FNS        G  V   + ++I+  I+              S    + EWK + A++ ++    S LA+ +C       ++ H AF  +L+        ++  + ++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D +      I++     +     Y+  +  +S++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  +   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F +  S     LW +     RPERL    +E W+LM+ACW+ +PS RP
Sbjct:  306 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKD-IAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDY-LRESFVGTLERCLRSLEKSQ---QESSSHVTSNH---LKQILNAAYHVEVTFNS--------GSTVTRMVWEQIVQIIQRI---------TWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRP 809          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 182.57 bits (462), Expect = 1.044e-46
Identity = 144/533 (27.02%), Postives = 261/533 (48.97%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNY----KFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLK-RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E EL+E +  +    + +L   ++E L    E ++    ++++ + I++P+NG  +  + ++ C    + +I+S L Q + N +   V+  L + +   +E  + S  K +    E+     + +   L++IL + Y     FNS        G  V   + ++I+  I+              S    + EWK + A++ ++    S LA+ +C       ++ H AF  +L+        ++  + ++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D +      I++     +     Y+  +  +S++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  +   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F +  S     LW +     RPERL    +E W+LM+ACW+ +PS RP
Sbjct:  367 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKD-IAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDY-LRESFVGTLERCLRSLEKSQ---QESSSHVTSNH---LKQILNAAYHVEVTFNS--------GSTVTRMVWEQIVQIIQRI---------TWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRP 870          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:493205])

HSP 1 Score: 182.57 bits (462), Expect = 1.246e-46
Identity = 144/533 (27.02%), Postives = 261/533 (48.97%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNY----KFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLK-RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E EL+E +  +    + +L   ++E L    E ++    ++++ + I++P+NG  +  + ++ C    + +I+S L Q + N +   V+  L + +   +E  + S  K +    E+     + +   L++IL + Y     FNS        G  V   + ++I+  I+              S    + EWK + A++ ++    S LA+ +C       ++ H AF  +L+        ++  + ++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D +      I++     +     Y+  +  +S++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  +   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F +  S     LW +     RPERL    +E W+LM+ACW+ +PS RP
Sbjct:  374 RQKENELYESLMRISDRKQEELKDMIVETLNSMREQLLEDAANMQFKD-IAIPQNGEPVSVQEVKCCIFQIKELIISRLNQAVVNKLISSVDY-LRESFVGTLERCLRSLEKSQ---QESSSHVTSNH---LKQILNAAYHVEVTFNS--------GSTVTRMVWEQIVQIIQRI---------TWVSPPTITPEWKRRVAQDAIESLSASKLAKSICSQFCKRLKSSHEAFAASLKQLEVGHSGRLEKTNDLWLRVRKDHAPRLARLSLESRSLQDVLLHGKPRIGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYSYGGGSSIAVLLITERLHRDLYVGLKTGLSLETRLQIALDVVEGIRFLHNQGLVHRDIKLKNVLLDKKHRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGKYDNSVDVYAFGILFWYICSGSVKLPEAFEKCASK--DHLWNNVRKGARPERLAIFDEECWKLMEACWNGDPSQRP 877          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dstyk (dual serine/threonine and tyrosine protein kinase [Source:MGI Symbol;Acc:MGI:1925064])

HSP 1 Score: 200.675 bits (509), Expect = 1.611e-52
Identity = 155/536 (28.92%), Postives = 261/536 (48.69%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDE-IGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            RK E EL+E +  + +  + ++   ++E L    E +++   ++E+ + I VPENG  I  R I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  K + + VH                 + SNY    L A  + E     G +V   L ++I    K    ++   +    ++     EWK + A+E +     S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   + +   + +++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D        +++   +  +  D+   LK   ++++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F R  S     LW +     RPERL    +E W+LM+ACWD +P  RP
Sbjct:  393 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEFKDVI-VPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLQSLEKSQDVSVH-----------------ITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQI----KQIIQRITWVNPPTITL-----EWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASK--DHLWNNVRRGTRPERLPVFDEECWQLMEACWDGDPLKRP 895          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Dstyk (dual serine/threonine and tyrosine protein kinase [Source:MGI Symbol;Acc:MGI:1925064])

HSP 1 Score: 154.066 bits (388), Expect = 1.119e-37
Identity = 141/535 (26.36%), Postives = 239/535 (44.67%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDE-IGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            RK E EL+E +  + +  + ++   ++E L    E +++   ++E+ + I VPENG  I  R I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  K + + VH                 + SNY    L A  + E     G +V   L ++I    K    ++   +    ++     EWK + A+E +     S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   + +   + +++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D        +++   +  +  D+   LK   ++++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+                         TG                        RPERL    +E W+LM+ACWD +P  RP
Sbjct:  393 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEFKDVI-VPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLQSLEKSQDVSVH-----------------ITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQI----KQIIQRITWVNPPTITL-----EWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF------------------------TG-----------------------TRPERLPVFDEECWQLMEACWDGDPLKRP 850          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 105.916 bits (263), Expect = 2.204e-24
Identity = 84/271 (31.00%), Postives = 131/271 (48.34%), Query Frame = 2
Query: 2072 GRYMLQGIVVNEKIGQGAQGEVYRCSC--NGQEMAKKTVN----LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVS---KYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESV 2839
            G   L    + +KIG+G   EVYR SC  +G  +A K V     +      D  +E+       HP ++   A  I D+      +++I   L    D+S   K+ K+ K  I ER   K  +Q+  AL ++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   D  S+EL +L+  C + +P  RPDI  V
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDN------ELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYV 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek7 (NIMA (never in mitosis gene a)-related expressed kinase 7 [Source:MGI Symbol;Acc:MGI:1890645])

HSP 1 Score: 105.916 bits (263), Expect = 2.204e-24
Identity = 84/271 (31.00%), Postives = 131/271 (48.34%), Query Frame = 2
Query: 2072 GRYMLQGIVVNEKIGQGAQGEVYRCSC--NGQEMAKKTVN----LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVS---KYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESV 2839
            G   L    + +KIG+G   EVYR SC  +G  +A K V     +      D  +E+       HP ++   A  I D+      +++I   L    D+S   K+ K+ K  I ER   K  +Q+  AL ++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   D  S+EL +L+  C + +P  RPDI  V
Sbjct:   27 GYNTLANFRIEKKIGRGQFSEVYRASCLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDN------ELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALDHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNICINPDPEKRPDIAYV 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek6 (NIMA (never in mitosis gene a)-related expressed kinase 6 [Source:MGI Symbol;Acc:MGI:1891638])

HSP 1 Score: 98.5969 bits (244), Expect = 7.222e-22
Identity = 80/270 (29.63%), Postives = 131/270 (48.52%), Query Frame = 2
Query: 2075 RYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQL---------NDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVS---KYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDI 2830
            R  L    + +KIG+G   EVY+ +C    + +KTV L   Q+          D  +E+       HP ++  +   I D+      +++I   L    D+S   KY K+ K  I ER   K  +Q+  A++++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   +  S++L EL+  C   +P  RPDI
Sbjct:   39 RCSLADFQIEKKIGRGQFSEVYKATC---LLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDN------ELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGIVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCIYPDPDHRPDI 296          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6XUX2|DUSTY_RAT (Dual serine/threonine and tyrosine protein kinase OS=Rattus norvegicus OX=10116 GN=Dstyk PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 9.871e-53
Identity = 156/536 (29.10%), Postives = 262/536 (48.88%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDE-IGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            RK E EL+E +  + +  + ++   ++E L    E +++   ++E+ + I VPENG  +  R I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  K + + VH                 + SNY    L A  + E     G +V   L ++I    K    ++   +    ++     EWK + A+E +     S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   + +   + +++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D        +++   +  +  D+   LK   +S++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F R  S     LW +     RPERL    +E W+LM+ACWD +PS RP
Sbjct:  393 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEFKDVI-VPENGETVGTREIKSCIRQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLQSLEKSQDVSVH-----------------ITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQI----KQIIQRITWVNPPTITL-----EWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LSLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASK--DHLWNNVRRGTRPERLPVFDEECWQLMEACWDGDPSKRP 895          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4TVR5|DUSTY_BOVIN (Dual serine/threonine and tyrosine protein kinase OS=Bos taurus OX=9913 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.059e-52
Identity = 157/536 (29.29%), Postives = 262/536 (48.88%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDE-IGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            RK E EL+E +  + +  + ++   ++E L    E +++   ++E+ + I VPENG  +  R I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  K + + VH                 + SNY    L A  + E     G +V   L ++I   I+              S    + EWK + A+E ++    S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   + +   + +++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D +      I++   +  +  D+   LK   ++++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F R  S     LW +     RPERL    +E W+LM+ACWD +PS RP
Sbjct:  394 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEFKDVI-VPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLQSLEKSQDVSVH-----------------ITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRI---------TWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYSYGGGSSIAVLLIMERLHRDLYTGLKAG-LALETRLQIALDVVEGIRFLHSQGLVHRDVKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASK--DHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPSQRP 896          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6XUX1|DUSTY_MOUSE (Dual serine/threonine and tyrosine protein kinase OS=Mus musculus OX=10090 GN=Dstyk PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.127e-51
Identity = 155/536 (28.92%), Postives = 261/536 (48.69%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDE-IGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            RK E EL+E +  + +  + ++   ++E L    E +++   ++E+ + I VPENG  I  R I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  K + + VH                 + SNY    L A  + E     G +V   L ++I    K    ++   +    ++     EWK + A+E +     S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   + +   + +++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D        +++   +  +  D+   LK   ++++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F R  S     LW +     RPERL    +E W+LM+ACWD +P  RP
Sbjct:  393 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEFKDVI-VPENGETIGTREIKSCIRQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLQSLEKSQDVSVH-----------------ITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQI----KQIIQRITWVNPPTITL-----EWKRKVAQEAIDSLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYNYGGGSSVAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSIKLPEAFERCASK--DHLWNNVRRGTRPERLPVFDEECWQLMEACWDGDPLKRP 895          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q20CR4|DUSTY_MACMU (Dual serine/threonine and tyrosine protein kinase OS=Macaca mulatta OX=9544 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.135e-51
Identity = 156/536 (29.10%), Postives = 260/536 (48.51%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDE-IGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYY-SYLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            RK E EL+E +  + +  + ++   ++E L    E +++   ++E+ + I VPENG  +  R I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  K + + VH                 + SNY    L A  + E     G +V   L ++I   I+              S    + EWK + A+E ++    S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   + +   + +++G+G  G VY C   G     A K+V  P     ND+A E +Y   L +H RL+ L   S+ D        I++   +  +  D+   LK   ++++ RL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G+ + P  F R  S     LW +     RPERL    +E W+LM+ACWD +P  RP
Sbjct:  373 RKKENELYESLMNIANRKQEEMKDMIVETLNTMKEELLDDAANMEFKDVI-VPENGEPVGTREIKCCIRQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLQSLEKSQDVSVH-----------------ITSNYLKQILNAAYHVEVTFHSGSSVTRMLWEQIKQIIQRI---------TWVSPPAITLEWKRKVAQEAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEAGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHRKPKLGQELGRGQYGVVYLCDNWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLPKHERLVDLHG-SVIDYNYGGGSSIAVLLIMERLHRDLYTGLKAG-LTLETRLQIALDVVEGIRFLHSQGLVHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGSVKLPEAFERCASK--DHLWNNVRRGARPERLPVFDEECWQLMEACWDGDPLKRP 875          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6XUX0|DUSTY_CHICK (Dual serine/threonine and tyrosine protein kinase OS=Gallus gallus OX=9031 GN=DSTYK PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.412e-51
Identity = 156/536 (29.10%), Postives = 261/536 (48.69%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQC----QGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKD-EIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTE-----GHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEM--AKKTVNLP-MNQLNDIAEEVYYSYLFQ-HPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPR-FARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E EL+E +  + +  + ++   +IE L +  E ++    ++E+ + I +PENG  +  + I+ C    Q +I+S L Q + N +   V+  L + +   +E  + S  +  E+ VH A+ L K+     +   + SNY    L A  + E     G  V   L ++I   I+              S    + +WK + A++ ++    S LA+ +C        + H AF  +L         ++  +E++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G     A K+V  P     ND+A E +Y    Q H RL+ L   S+ D        I++   +  +  D+   LK   + ++ RL+IAL V E ++YLH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WY+  G  + P  F R  S     LW +    +RPERL    +E W+LM+ACWD + S RP
Sbjct:  382 RRKENELYESLMNIANRKQEEMKDMIIETLSNMKEELLEDAANMEFKDII-IPENGEPVSSKDIKCCIKQIQELIISRLNQAVANKLISSVDY-LRESFVGTLERCLKSLEESWEVSVHPARSLEKSK---DVSVHITSNYLKQILNAAYHVEVTFHSGSTVTRMLWEQIKQIIQRI---------TWVSPPAITSDWKRKVAQDAIESLSASKLAKSICSQFRTRLNSSHEAFAASLRQLEDGHSGRLEKTEDLWLKVRKDHAPRLARLSLESRSLQDVLLHGKPKLGRELGRGQYGVVYLCDSWGGHFPCALKSVVPPDEKHWNDLALEFHYMRSLQSHERLVDLHG-SVIDYGYGGGSSIAVLLIMERLHRDLYTGLKAG-LELETRLQIALDVVEGIRYLHSQGLVHRDIKLKNVLLDKKNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYICSGHVKLPEAFERCASK--DHLWNNVRRGVRPERLPVFDEECWQLMEACWDGDSSQRP 898          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267FM29 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021056g2 PE=4 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 2.895e-120
Identity = 271/882 (30.73%), Postives = 462/882 (52.38%), Query Frame = 2
Query:  332 KQDVNQ--------KVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENG-KVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIK-LAESKMELAFKKLQYNNFI-PTSFKHWSECPYFHGASLYCYMDYY--------KNKRTEEILFHFD------LFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNS-ISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVD--VKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEK--IGQGAQGEVYRCSCNGQE--MAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQ--ISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILL-DDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTG-RHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLILEN 2869
            +Q VNQ          D   P I IVGQ K+GKS+F+N LL    V Q+   CTAR+TRLTYS + YV +  + G ++ + + L KPTI +  ++L DEDR     I+  V AGIK +FL +GIDIIDSPGL+EN++L +L+   I S LPI+IYVID  + +      DL  +K  V   ++ Y ++K+D    TE E + P + + E K E  F KLQ   +I P   K   +C  F   S +    +         KNK   E L   +       F + +  +  F    F+N I  +   +   Q ++LT  + +A  + +        ++ I+ +E+E+ ++ K ++  ++++L+++      +    I++ +  L+Y  S IS   +   I+K+ +++   +I   +     + +K        Q++ D         +K ++  +E K + +TP    L++ L   Y  +S          + ++  +  I+  IK F  ++     +  S+   ++  +WK  QA++ L       L E +  SL + FE +H  FL  + +  + V   + ++E+ R+++    P  A L MLT+DV  +Y  +G  ++ +  +G GAQGEV+R      E  +A K +      L+DIA EVY+S + +H  L+ ++ V +  S   D K+  + I+  LM  D    ++R+++ +++RLKI L++A+ALQ+LH  +++HRD+KLAN+L+ +D   V L+D+G  KS    N + VGTP+++APE+VR   Y    D++S G+ LWYL EGTG RHP +  +  ++  +L A    + RP RL  +SD+LW+LM++CW   P  RP  ++ +  +  I+++
Sbjct:   65 RQKVNQLYRGNQTGSSDSSKPCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGITVAVQKDLTTIKKTVLGAEVFYLVTKMDVSKDTEQEANRPAQEIEEEKAERVFSKLQRLGYISPNETKE--KCNKFLCVSCWEVRRFRRKKELMIKKNKLDPEALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVSSGGGLRRIQSEILTLFMDKATNIKESNLRKKKALYQIKSLEQEIHQQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVISADMSQKDIEKKCVDEIHALINDRIIASFCDFLKDGALRLCLQEFDD---------LKQKVAEYE-KDVEQTPAYQVLKKTLLEGYSLSS---------KDFLLGPLNVIIFRIKHFVRQMVRNPGLVLSISTPIQDQKWKEYQAEKYLGTISKENLVECLITSLKEWFEKQHREFLDNIASSEQLVESCMKLTEKERSEIKTLYPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLEHDNLVHVVGVRLHKSKP-DEKRWTVEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDVKLANVLVSEDLRQVKLSDFGLVKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILLAGA-LDCRPTRLPNMSDQLWDLMESCWSGTPDSRPTAKAAVESLQKIVDS 923          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267FLZ4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023032g1 PE=4 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 4.394e-119
Identity = 280/891 (31.43%), Postives = 463/891 (51.96%), Query Frame = 2
Query:  335 QDVNQKV------------DIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENG-KVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIK-LAESKMELAFKKLQYNNFI-PTSFKHWSECPYFHGASLYCYMDYY--------KNKRTEEILFHFD------LFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVL--SDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNS-ISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEA-KCLGKT---PYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQI--KESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEK--IGQGAQGEVYRCSCNGQE--MAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQ--ISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILL-DDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTG-RHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLILEN 2869
            +DV QKV            D   P I IVGQ K+GKS+F+N LL    V Q+   CTAR+TRLTYS + YV +  + G ++ + + L KPTI +  ++L DEDR     I+  V AGIK +FL +GIDIIDSPGL+EN++L +L+   I S LPI+IYVID  + +      DL  +K  V   ++ Y ++K+D    TE E + P + + E K E  F KLQ   +I P   +    C  F   S +    +         KNK   E L   +       F + +  +  F    F+N I  + D +++ Q ++LT  + RA  +  S+  KE L   + I+ +E+E +++ K ++  ++++L+++      +    I++ +  L+Y  S IS   +   I+K+ +++   +I        + +I  F +       +      + + ++ ++    A + L KT    Y +SLE +  S   F                     I+  IK F  K+     +    S  ++  +WK  QA++ L+  + + L E +   L +  E +H  FL  + +  + V   + ++EE R+++    P  A L MLT+DV  +Y  +G  ++ +  +G GAQGEV+R      E  +A K +      L+DIA EVY+S + +H  L+ ++ V +  S   D K+  + I+  LM  D    ++R+++ +++RLKI L++A+ALQ+LH  +++HRDLKLAN+L+ +D   V L+D+G  KS    N + VGTP+++APE+VR   Y    D++S G+ LWYL EGTG RHP +  +  ++  +L AS   + RP RL  +SD+LW+LM++CW   P  RP  E  +  +  I+++
Sbjct:   62 EDVRQKVNQLYRGNQTGSSDSSKPCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGITIAVQKDLTTIKKTVLGAEVFYLVTKMDVSKDTEQEANQPAQEIEEEKAERVFSKLQRLGYISPNETR--DTCNKFLCVSCWKVRGFRRKKELMIKKNKLDPEALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVRSGDELMHIQSEILTLFMDRATNIKESNLRKEAL---YQIKSLEQETYQQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVISADMSQKDIEKKCVDEIHALIN-------DRIIASFFDFFKNHGLKGFDLKNLMAELEKDVNPTPAYQVLKKTMLMSYSVSLEELKLSCLGF---------------------IIFKIKFFVIKIVTKPGLVFSTSTPIQDPKWKKYQAEKYLEAINKNILVERLITWLKEWLEKQHREFLDNIASSEQLVESGMKLTEEERSEIKSLFPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLEHDNLVHVVGVRLHKSKP-DEKRWTVEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDLKLANVLVSEDLRQVKLSDFGLVKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILLASA-LDCRPTRLPNMSDQLWDLMESCWSGTPDSRPTAEEAVESLQKIVDS 917          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A267FEQ6 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021099g2 PE=4 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 2.286e-115
Identity = 271/888 (30.52%), Postives = 466/888 (52.48%), Query Frame = 2
Query:  332 KQDVNQ--------KVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENG-KVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIK-LAESKMELAFKKLQYNNFI-PTSFKHWSECPYFHGASLYCYMDYY--------KNKRTEEILFHFD------LFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNS-ISVPENGMVIDKRLIEQCQGV----IMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVD--VKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEK--IGQGAQGEVYRCSCNGQE--MAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSK-QISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILL-DDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTG-RHPRFARVQSNIAQVLWASTEHNMRPERLDEIS---DELWELMQACWDNEPSVRPDIESVLCKITLILEN 2869
            +Q VNQ          D   P I IVGQ K+GKS+F+N LL    V Q+   CTAR+TRLTYS + YV +  + G ++ + + L KPTI +  ++L D+DR  +  I+  V AGIK +FL +GIDIIDSPGL+EN++L +L+   I S LPI+IYVID  T +      DL  +K  V   ++ Y ++K+D    TE E +   + + E K E  F KLQ    I P   K   +C  F   S +    +         KNK   + L   +       F + +  +  F    F+N I  +   +   Q ++LT  + +A  + +        ++ I+ +E+E+ ++ K ++  ++++L+++      +    I++ +  L+Y  S I+   +   I+K+ +++ + +    I++S C  L++   +  ++E               R+K  +  +E K + +TP    L++ L   Y      +LS  E     +K    I+  IK F   +F   ++  S+   ++   WK  QA++ ++      L E +  +LI+ FE  H+ FL  + +  + V   + ++E+ R+++    P  A L MLT+DV  +Y  +G  ++ +  +G GAQGEV+R      E  +A K +      L+DIA EVY+S + +H  L+ ++ V +  S   + +  + I+  LM  D    ++R+++ +++RLKI L++A+ALQ+LH  +++HRD+KLAN+L+ +D   V L+D+G  KS    N + VGTP+++APE+VR   Y    D++S G+ LWYL EGTG RHP +  +  ++  +L A    + RP RL  +S   D+LW+LM++CW   P  RP  ++ +  +  I+++
Sbjct:   65 RQKVNQLYRGNQTGSSDSSKPCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDKDRENKELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNTGITVAVQNDLTRIKQTVLGAEVFYLVTKMDVSKDTEQEANQTAQEIEEEKAERVFSKLQSLKCISPNETKE--KCSKFLCVSCWKVRGFRRKKELMIKKNKLDPKALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVSSGGGLRRIQSEILTLFMDKATNIKESNLRKKKALYQIKSLEQEIHKQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVITADMSRKDIEKKCVDEIRALINDRIIASFCDFLKDGALRTCQNEF-------------DRLKQVVAEYE-KNVKQTPTYQVLKKTLLVGY------SLSPEEVRPGCLKY---IIIRIKTFVKHIFKNPRLVFSISKPIQDPNWKEYQAEKYVEAMSKENLVECLITALIEWFEMCHSEFLDNIASSEQLVESCMKLTEKERSEIKTLYPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLKHENLVHVVGVRLHKSKSDEKRWTVEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDVKLANVLVSEDLRQVKLSDFGLMKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILLAGA-LDCRPTRLPNMSDQPDQLWDLMESCWSGTPDSRPTAKAAVESLQKIVDS 926          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8G8Z8 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 5.672e-112
Identity = 268/880 (30.45%), Postives = 446/880 (50.68%), Query Frame = 2
Query:  332 KQDVNQ--------KVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENG-KVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIK-LAESKMELAFKKLQYNNFI-PTSFKHWSECPYFHGASLYCYMDYY--------KNKRTEEILFHFD------LFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNS-ISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEK--IGQGAQGEVYRCSCNGQE--MAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQ--ISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILL-DDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTG-RHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLILEN 2869
            +Q VNQ          D   P I IVGQ K+GKS+F+N LL    V Q+   CTAR+TRLTYS + YV +  + G ++ + + L KPTI +  ++L DEDR     I+  V AGIK +FL +GIDIIDSPGL+EN++L +L+   I S LPI+IYVID  + +      DL  +K  V   ++ Y ++K+D    TE E + P + + E K E  F KLQ   +I P   K   +C  F   S +    +         KNK   E L   +       F + +  +  F    F+N I  +   +   Q ++LT  + +A  + +        ++ I+ +E+E+ ++ K ++  ++++L+++      +    I++ +  L+Y  S IS   +   I+K+ +++   +I   +     + +K        Q++ D         +K ++  +E K + +TP    L++ L   Y  +S                        K F   L GT                  +KE L  C        +  SL + FE +H  FL  + +  + V   + ++E+ R+++    P  A L MLT+DV  +Y  +G  ++ +  +G GAQGEV+R      E  +A K +      L+DIA EVY+S + +H  L+ ++ V +  S   D K+  + I+  LM  D    ++R+++ +++RLKI L++A+ALQ+LH  +++HRD+KLAN+L+ +D   V L+D+G  KS    N + VGTP+++APE+VR   Y    D++S G+ LWYL EGTG RHP +  +  ++  +L A    + RP RL  +SD+LW+LM++CW   P  RP  ++ +  +  I+++
Sbjct:   65 RQKVNQLYRGNQTGSSDSSKPCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGITVAVQKDLTTIKKTVLGAEVFYLVTKMDVSKDTEQEANRPAQEIEEEKAERVFSKLQRLGYISPNETKE--KCNKFLCVSCWEVRRFRRKKELMIKKNKLDPEALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVSSGGGLRRIQSEILTLFMDKATNIKESNLRKKKALYQIKSLEQEIHQQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVISADMSQKDIEKKCVDEIHALINDRIIASFCDFLKDGALRLCLQEFDD---------LKQKVAEYE-KDVEQTPAYQVLKKTLLEGYSLSS------------------------KDF---LLGT-----------------ISKENLVEC--------LITSLKEWFEKQHREFLDNIASSEQLVESCMKLTEKERSEIKTLYPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLEHDNLVHVVGVRLHKSKP-DEKRWTVEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDVKLANVLVSEDLRQVKLSDFGLVKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILLAGA-LDCRPTRLPNMSDQLWDLMESCWSGTPDSRPTAKAAVESLQKIVDS 878          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1I8HXC8 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 9.624e-111
Identity = 265/876 (30.25%), Postives = 442/876 (50.46%), Query Frame = 2
Query:  332 KQDVNQ--------KVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENG-KVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIK-LAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCY-----MDYYKNKRTEEILFHFD------LFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNS-ISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEK--IGQGAQGEVYRCSCNGQE--MAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQ--ISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILL-DDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTG-RHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLILEN 2869
            +Q VNQ          D   P I IVGQ K+GKS+F+N LL    V Q+   CTAR+TRLTYS + YV +  + G ++ + + L KPTI +  ++L DEDR     I+  V AGIK +FL +GIDIIDSPGL+EN++L +L+   I S LPI+IYVID  + +      DL  +K  V   ++ Y ++K+D    TE E + P + + E K E  F KLQ   +I  +    +    F       +     +   KNK   E L   +       F + +  +  F    F+N I  +   +   Q ++LT  + +A  + +        ++ I+ +E+E+ ++ K ++  ++++L+++      +    I++ +  L+Y  S IS   +   I+K+ +++   +I   +     + +K        Q++ D         +K ++  +E K + +TP    L++ L   Y  +S                        K F   L GT                  +KE L  C        +  SL + FE +H  FL  + +  + V   + ++E+ R+++    P  A L MLT+DV  +Y  +G  ++ +  +G GAQGEV+R      E  +A K +      L+DIA EVY+S + +H  L+ ++ V +  S   D K+  + I+  LM  D    ++R+++ +++RLKI L++A+ALQ+LH  +++HRD+KLAN+L+ +D   V L+D+G  KS    N + VGTP+++APE+VR   Y    D++S G+ LWYL EGTG RHP +  +  ++  +L A    + RP RL  +SD+LW+LM++CW   P  RP  E  +  +  I+++
Sbjct:   65 RQKVNQLYRGNQTGSSDSSKPCIIIVGQTKSGKSSFINELLGGTFVAQSQSPCTARVTRLTYSDRIYVLVRSKTGEQIGDVQYLEKPTIEEDLVKLKDEDRENDELISSTVEAGIKCEFLRHGIDIIDSPGLNENSSLDSLTLGAIDSFLPIIIYVIDSNSGITVAVQKDLTTIKKTVLGAEVFYLVTKMDVSKDTEQEANRPAQEIEEEKAERVFSKLQRLGYISPNETRDNATSSFASRVGKRFRRKKELMIKKNKLDPEALKEMENSKWVRRFEEVKTRILKFAQDQFRNLIVSSGGGLRRIQSEILTLFMDKATNIKESNLRKKKALYQIKSLEQEIHQQSKSIVEKNRDELLRQAGLFFAERKPLILDEVRALKYSESVISADMSQKDIEKKCVDEIHALINDRIIASFCDFLKDGALRLCLQEFDD---------LKQKVAEYE-KDVEQTPAYQVLKKTLLEGYSLSS------------------------KDF---LLGT-----------------ISKENLVEC--------LITSLKEWFEKQHREFLDNIASSEQLVESCMKLTEKERSEIKTLYPRVARLHMLTMDVISKYKYRGFRIDTEGNLGSGAQGEVFRVLNESGEPALAAKRIVSDEPSLDDIATEVYHSSVLEHDNLVHVVGVRLHKSKP-DEKRWTVEIYMELMCCDAWNLMQRHRLPVRQRLKIGLELAKALQFLHSSELIHRDVKLANVLVSEDLRQVKLSDFGLVKSTGFVNRTLVGTPIYLAPELVRGESYHTSADVFSLGIALWYLFEGTGKRHPEYVEIMPSVGAILLAGA-LDCRPTRLPNMSDQLWDLMESCWSGTPDSRPTAEKAVESLQKIVDS 876          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:402922])

HSP 1 Score: 151.369 bits (381), Expect = 4.863e-37
Identity = 140/544 (25.74%), Postives = 248/544 (45.59%), Query Frame = 2
Query: 1271 RKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRL---IEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNS---IKLFFSKLFGT-----DQIKESVD--------VKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQE--MAKKTVNLPMNQ-LNDIAEEVYYSY-LFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            R+ E ELF  +  + +  + ++ + ++E L    E ++    +LE+ + I  P    V  K +   I+Q Q +I+  L Q + N   + + S  Y   R++            +G              +LER L+S  K     + +++  HNV    +++ILN+   +++ F           +QIK+ +           + EWK + A++ ++    + LA+ +C        + H+AF  +L    +    ++  +E++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G++   A K+V  P ++  ND+A E +Y+  L +H RL+ L   S+ D T      I++   +  +  D+   LK   +S+KERL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+                         TG                        RPERL    +E W+LM+ACW+ +P  RP
Sbjct:  375 REKESELFASLMAIANRKQEEMKEMIVETLSTMKEQLLEDAANLEFTDIIVTPNGEPVTTKEIKSCIQQIQELIVVRLNQAVAN---KLISSVDY--LRESF-----------VG--------------TLERCLSSLEK-----STTDSSVHNVTSNHLKQILNAAYHVEVTFHSGSSVTRLVWEQIKQIIQRLTWVNPPAITPEWKRKVAQDAIESLSAAKLAKSICSQFRTRLNSSHDAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLYGKPKLGRELGRGQYGVVYLCDKWGEQNPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVNLHG-SVIDHTYGGGSSIAVLLIMERLHRDLYTGLKAG-LSLKERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF------------------------TGS-----------------------RPERLPTFDEECWQLMEACWNGDPLQRP 834          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:103034670])

HSP 1 Score: 99.7525 bits (247), Expect = 1.106e-21
Identity = 74/256 (28.91%), Postives = 129/256 (50.39%), Query Frame = 2
Query: 2084 LQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLK---RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCK--SMALSNHSFVGTPVH-IAPEIVRKAIYDFKVDIYSYGMLLW-YLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDI 2830
            L G+ + E IG+G  G VY     G+++A K +   +     + E    + L QH  L+ L+ V + +   + ++ ++      K ++  YL+   R+ +S  + L  AL+V E ++YL  ++++HRDL   NILL ++N   ++D+G  K  S A  N      PV   APE ++      + D++SYG+LLW   + G   +P+ + +Q    QV     E   R E  +    E++ +M+ CW+ EP +RP  
Sbjct:  165 LAGLTLGESIGEGEFGAVYEGEYMGRKVAVKNIKSDVTAQAFLGETSVMTKL-QHKNLVQLLGVILHNGLYIVTEFMA------KGNLVNYLRSRGRSVISTVQLLHYALEVCEGMEYLECKKLVHRDLAARNILLSEDNVAKVSDFGLAKVDSQAFDNTKL---PVKWTAPEGLKNKKISTRSDVWSYGVLLWEIFSYGMQPYPKMS-LQEVKEQV-----EQGYRMEAPEACPPEVYTIMRDCWEKEPKMRPSF 404          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: matk (megakaryocyte-associated tyrosine kinase [Source:NCBI gene;Acc:103034670])

HSP 1 Score: 99.7525 bits (247), Expect = 1.421e-21
Identity = 75/256 (29.30%), Postives = 129/256 (50.39%), Query Frame = 2
Query: 2084 LQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLK---RNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCK--SMALSNHSFVGTPVH-IAPEIVRKAIYDFKVDIYSYGMLLW-YLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDI 2830
            L G+ + E IG+G  G VY     G+++A K +   +     + E    + L QH  L+ L+ V + +   +    ++ F  + K ++  YL+   R+ +S  + L  AL+V E ++YL  ++++HRDL   NILL ++N   ++D+G  K  S A  N      PV   APE ++      + D++SYG+LLW   + G   +P+ + +Q    QV     E   R E  +    E++ +M+ CW+ EP +RP  
Sbjct:  192 LAGLTLGESIGEGEFGAVYEGEYMGRKVAVKNIKSDVTAQAFLGETSVMTKL-QHKNLVQLLGVILHNGLYI----VTEF--MAKGNLVNYLRSRGRSVISTVQLLHYALEVCEGMEYLECKKLVHRDLAARNILLSEDNVAKVSDFGLAKVDSQAFDNTKL---PVKWTAPEGLKNKKISTRSDVWSYGVLLWEIFSYGMQPYPKMS-LQEVKEQV-----EQGYRMEAPEACPPEVYTIMRDCWEKEPKMRPSF 431          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:103046491])

HSP 1 Score: 95.9005 bits (237), Expect = 3.230e-21
Identity = 78/263 (29.66%), Postives = 126/263 (47.91%), Query Frame = 2
Query: 2072 GRYMLQGIVVNEKIGQGAQGEVYRCS--CNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESV 2839
            G   L    + +KIG+G   EVYR     N   +A K +     QLN      Y++   +   L   I + + D+ +L S+ I            K+ K+ +  I E+   K  +Q+  AL+++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   D  S+EL +L+  C + +P  RPDI  V
Sbjct:   33 GYSTLSNFQIEKKIGRGQFSEVYRARYLINNTAVALKKIQ----QLNHPNVIKYHASFIEENELN--IVLELADAGDL-SRMI------------KHFKKQRRLIPEKTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRKLVDMCINPDPERRPDIAYV 273          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek6 (NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-040724-133])

HSP 1 Score: 94.3597 bits (233), Expect = 1.130e-20
Identity = 78/268 (29.10%), Postives = 128/268 (47.76%), Query Frame = 2
Query: 2084 LQGIVVNEKIGQGAQGEVYRCS--CNGQEMAKKTVN----LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVS---KYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVL 2842
            L    + +KIG+G   EVYR +     Q++A K V     +      D  +E+       HP ++  +   I D+      +++I   L    D+S   KY K+ +  I ER   K  +Q+  A++++H +++MHRD+K AN+ +     V L D G   F  S     HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   Q N+  +     + +  P   +  S++L  L+  C + +   RPDI  VL
Sbjct:   28 LSNFRIEKKIGRGQFSEVYRATYLLENQQVALKKVQIFEMMDAKSRQDCIKEIDLLKQLNHPNVIKYLDSFIEDN------ELNIVLELADAGDLSHMIKYFKKKRRLIPERTIWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTVVHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYSDQMNLLSLCQKIEQCDYPPLPPEHFSEKLRSLVSMCINPDADERPDIVFVL 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 95.5153 bits (236), Expect = 4.058e-20
Identity = 76/250 (30.40%), Postives = 130/250 (52.00%), Query Frame = 2
Query: 2099 VNEKIGQGAQGEVY--RCSCNGQEMAKK---TVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLK-IALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSN---HSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVR 2821
            V E IG+G+ G+VY  R    GQ +A K    V     +L ++  E+      QHP +     V + DS E D K++ +     + ++ + L+ +    +E+++ IA Q+  AL YLH  +I+HRD+K  NILL     V L D+GF ++M+++     S  GTP++++PE+V +  YD   D++S G +L+ L  GT   P F    ++I Q++    +  ++  +   +S E    +Q     EP +R
Sbjct:    6 VLEMIGEGSFGKVYKGRKRYTGQVVALKFIPKVGRSDKELRNLRREIDIMRGLQHPNI-----VQMLDSFETD-KEVVVVTDYAEGELFQILEDDGNLPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEKPYDHTADLWSMGCILYELFVGT---PPF--YTNSIFQLVSLIIKDPVKWPK--NMSSEFRNFLQGLLTKEPKLR 242          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006100.1 (pep scaffold:Pmarinus_7.0:GL478927:1672:12797:-1 gene:ENSPMAG00000005510.1 transcript:ENSPMAT00000006100.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 1.466e-19
Identity = 65/256 (25.39%), Postives = 120/256 (46.88%), Query Frame = 2
Query: 2093 IVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELD--SKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLH---RQQIMHRDLKLANILLDDNNNVF-LADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVL 2842
            I+V E +G+GA G V +    G ++A K +     +   I E    S +  HP ++ L    +     +   ++  S++  L   +   Y      +    ++  LQ A+ + YLH    + ++HRDLK  N+LL     +  + D+G    +     +  G+   +APE+   + Y  K D++S+G++LW +   T R P F  +     +++WA   +  RP  +  +   +  LM  CWD EP++RP +E ++
Sbjct:   26 IIVEEVVGRGAFGVVCKAKWRGMDVAIKQIESESERKAFIVELRQLSRV-NHPNIVRLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYY-----TAAHAMRWCLQCAQGVAYLHCMKPKALIHRDLKPPNLLLISGGTILKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVI--TRRKP-FDEIGGPAFRIMWA-VHNGTRPPLIKNLPKPIEGLMTRCWDKEPALRPSMEEIV 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 5.943e-18
Identity = 63/252 (25.00%), Postives = 116/252 (46.03%), Query Frame = 2
Query: 2111 IGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNK-VSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSM--ALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITL 2857
            +G GAQG V+     G+ +A K V            ++ + +  +HP ++    V              I     +  + + L+  + +S +  +     +A  + YLH  +I+HRDLK  N+L+  ++ V ++D+G  K M    +  SF GT   +APE++R      KVDI+S+G++LW L   TG  P +  V S  + ++W    +++         +    L+  CW+++P  RP    +L  + +
Sbjct:   20 LGSGAQGAVFLGKFRGEHVAVKKVR------EQKETDIKHLHKLRHPNIITFKGVCTHAPC-----YCIIMEYCAQGQLYEVLRAGRRISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSKEMREKSTRMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELL--TGEIP-YRDVDS--SAIIWGVGSNSLHLPIPASCPEGFKILLTQCWNSKPRNRPSFRQILLHLEI 255          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: phkg1b (phosphorylase kinase, gamma 1b (muscle) [Source:ZFIN;Acc:ZDB-GENE-050522-52])

HSP 1 Score: 85.1149 bits (209), Expect = 1.112e-17
Identity = 69/264 (26.14%), Postives = 130/264 (49.24%), Query Frame = 2
Query: 2102 NEKIGQGAQGEVYRC--SCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIA-----VSITDSTELDSKQISIFAPLMKTDVSKYL-KRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSN--HSFVGTPVHIAPEIVRKAI------YDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLC 2845
             E +G G    V RC     GQ+ A K +++  ++L++   E  YS   +   +L  ++     +++ D+ E  +    +F  + + ++  YL ++  +S K+   I   + E + +LH + I+HRDLK  NILLDDN N+ L+D+GF   +          GTP +++PE+++ ++      Y  +VD+++ G++++ L  G+   P + R Q  + +++         PE  D  SD + +L+      EP  R   E  L 
Sbjct:   28 KEVLGSGVSSVVRRCVHKRTGQDFAVKIIDITPDRLSEEELEDIYSSTVKEVDILKAVSGHPHIITLIDAYESSTFFFLVFDLMKRGELFDYLTEKVALSEKDTRSIMRSIFEVVHFLHAKNIVHRDLKPENILLDDNMNIRLSDFGFSMQLRPGERLRELCGTPGYLSPELLKCSMDESHPGYGKEVDLWACGVIMYTLLAGSP--PFWHRKQMTMLRLIMDGKYDFSTPEWEDR-SDTVKDLISRLLVVEPEKRFTAEQALA 288          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 85.1149 bits (209), Expect = 1.704e-17
Identity = 59/194 (30.41%), Postives = 102/194 (52.58%), Query Frame = 2
Query: 2111 IGQG--AQGEVYRCSCNGQEMAKKTVN---LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYL-KRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNH--SFVGTPVHIAPEIVRKAIYDF-KVDIYSYGMLLWYLAEGT 2665
            IG+G  A+ ++ + +  GQE+A K ++   L  + L  +  EV    +  HP ++ L  V      E++     +       +V  YL    ++  KE      Q+  A+QY H++ I+HRDLK  N+LLD + N+ +AD+GF     L +   +F G+P + APE+ +   YD  +VD++S G++L+ L  G+
Sbjct:   74 IGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQKLFREVRIMKVLNHPNIVKLFEV-----IEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGS 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 89.3521 bits (220), Expect = 3.094e-19
Identity = 61/208 (29.33%), Postives = 109/208 (52.40%), Query Frame = 2
Query: 2063 DVKGRYMLQGIVVNEKIGQGAQGEVY--RCSCNGQEMAKKTVN----LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVSKYLKRNKVSIKERLKI-ALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEG 2662
            D  G+Y L    +   +G G+ G V+  R + NG+  A KT+     + + Q+    +E     +  HP ++ +        T  DS+Q+ +    ++  ++   L++++       K  A +V  AL+YLH + I++RDLK  NILLD N ++ + D+GF K +    ++  GTP +IAPE+V    Y+  VD +S+G+L++ +  G
Sbjct:   78 DTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWG------TFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAG 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 88.5817 bits (218), Expect = 5.139e-19
Identity = 60/205 (29.27%), Postives = 108/205 (52.68%), Query Frame = 2
Query: 2072 GRYMLQGIVVNEKIGQGAQGEVY--RCSCNGQEMA----KKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVSKYLKRNKVSIKERLKI-ALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEG 2662
            G+Y LQ   +   +G G+ G V+  R   NG+  A    KK + + + Q+    +E     +  HP ++ +        T  D++QI +    ++  ++   L++++       K  A +V  AL+YLH + I++RDLK  NILLD N ++ + D+GF K +    ++  GTP +IAPE+V    Y+  +D +S+G+L++ +  G
Sbjct:   80 GKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWG------TFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAG 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 84.3445 bits (207), Expect = 1.132e-17
Identity = 62/206 (30.10%), Postives = 104/206 (50.49%), Query Frame = 2
Query: 2069 KGRYMLQGIVVNEKIGQGAQGEVY--RCSCNGQEMA----KKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVSKYLKRNKVSIKERLKI-ALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEG 2662
            KG+Y L    +   +G G+ G V+  R   NG+  A    KK   + M Q+    +E     L +HP L+ +        T  D++ I +    ++  ++   L++++       K  A +V  AL+YLH   I++RDLK  NILLD N ++ + D+GF K +     +  GTP +IAPE++    Y+  VD +S G+L++ +  G
Sbjct:   62 KGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWG------TFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAG 261          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 83.5741 bits (205), Expect = 6.116e-17
Identity = 59/192 (30.73%), Postives = 107/192 (55.73%), Query Frame = 2
Query: 2111 IGQGAQGEVYRC--SCNGQEMAKKTVNLPMNQLND----IAEEVYYSYLFQHPRLLPLIAVSITDSTELDSK-QISIFAPLMKTDVSKYL-KRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSN--HSFVGTPVHIAPEIVRKAIY-DFKVDIYSYGMLLWYL 2653
            +G+G+ G+V     +  GQ++A K +N  +   +D    I  E+ Y  L +HP ++ L  V       + SK +I +       ++  Y+ +R+K+S +E  +   Q+  A++Y HR +I+HRDLK  N+LLD++ NV +AD+G    M   N   +  G+P + APE++   +Y   +VD++S G++L+ +
Sbjct:   61 LGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDV-------IKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVM 245          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: YPL150W_mRNA (Protein kinase of unknown cellular role; binds phosphatidylinositols and cardiolipin in a large-scale study [Source:SGD;Acc:S000006071])

HSP 1 Score: 83.9593 bits (206), Expect = 6.705e-17
Identity = 63/191 (32.98%), Postives = 99/191 (51.83%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLND--IAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSN--HSFVGTPVHIAPEIVRKAIYD-FKVDIYSYGMLLWYLAEG 2662
            ++IG+G+ G+VY           + V L  +  ND  I  EV+Y   F  P +  L  V +T+S    + +   + P  K      L   ++S+ E  ++  Q++ A+ Y H    +HRDLKL NILLD N N  L D+GF +         +  GT V++APE++ +  YD FK+DI+S G++L+ L  G
Sbjct:   45 KQIGEGSFGKVYLAL---HRPTHRKVCLKTSDKNDPNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALE---YCP-GKELYDHLLSLRRISLLECGELFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMAPELIERRTYDGFKIDIWSLGVILYTLITG 228          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44458 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVW1])

HSP 1 Score: 194.897 bits (494), Expect = 3.101e-51
Identity = 209/863 (24.22%), Postives = 384/863 (44.50%), Query Frame = 2
Query:  368 PAIAIVGQVKAGKSTFVNVLLRKNVVCQAYE---RCTARLTRLTYSSQNYVEIL----DENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFI------SKLXXXXXXXXXFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEE-------ILFHFDLFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIE------EELF-----------EKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEK-APDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCS--CNGQEMAKKTVNLPMNQ-LNDIAEEVYYS-YLFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            P I +VGQ    K   +N LL + V+    +     + R+ R+ Y + + V ++     E    L   +     +P+  L+LNDE++   +  + +    +    L+ G  ++ SP   E     N+     + +LPI++Y I+ +  +   D A+LL++K   P L I +F+        L    T   +     + AE++  + F++L+   ++        E P    A  +  +D    K   +       ++ +F LF  F + ++  L  +    + EA   M +     L+  IT A    D  +   + I T R++E      EELF           E+IK VI S+  +L  ++++ +E      +   G+ +  N   +      I + ++ +    +  ++   +E + + FV +   Q+  D++E   +   ++      A         ++L+ ++ + Y+       S++    +  K+ Q I          L G    K  VD     WK + A++ L     + LA+ +C          H +F   +         ++  +EE R ++ +  AP  A L + +  ++   +     ++ ++G+G  G VY C         A K+V  P ++  ND+A E +Y+  L  H R++ +I  S+ D +       ++   +  ++ D+ + +K   +S + R+ +A+ V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y+ G+LLWY+  GT R P  A  Q      LW +    +RPERL    +E W LM+ACW  +PS RP
Sbjct:   64 PTIIVVGQTCFAKVCVINELLGEPVLPSVEDLEGDRSWRMIRIKYGNISNVSLVLPDSFELAAALNAYEGCWQCVPRGDLELNDEEKADPAMASAVAEISLNHALLKAGAQLVCSPSNPEGDA-ENIFSACCEDVLPILVYSIE-QDFLSDKDEAELLQIKALAPDLPI-FFVKCSRKKPDLTNSMTEYAQHEAIEEFAEARTRI-FEQLRKIGYLT------QESPEQKKALQHEVLDIRNAKAILDSVIPKSMLIENFSLFPCFLLFVRQVLQFH----LVEAATVMNDAHCRALSLFITTA---FDMAR---DMIITPRRLEYAKEKEEELFLALMETATRKQEEIKEVIKSTIENLSPQILKEVESLEFRGVECSGEQKLLNPKDLDHCTFQIQELVLGRINKAVAGNMISSVEYLRESFVGT--LQRCIDSLEKMDSDSRRNACEYTSAT--------VALKHVIDAAYQVEVTYRASSSLARLLWEKMKQAI--------QTLPGKTPPK--VD---SAWKRKVAQDMLTSLSETRLAKHICLQFRTRLIKSHESFTSCMRMLEANHTGRLEKTEEQRMKVRKSHAPKIARLALESWSLRDVVLYGMPQLSREVGRGQYGVVYACDRWAGRHPCAIKSVVPPDDKHWNDLALEFFYTRSLPLHDRVVSIIG-SVIDYSYGGGSSPAVLLVMDRLQRDLYQGIKAG-LSFRARMHVAVDVVEGIRFLHSQGLVHRDIKLKNVLLDSKNRGKITDLGFCKPEAMMSGSIVGTPIHMAPELF-SGHYDNSVDVYALGILLWYICAGTVRLP-LAFEQCASKDHLWNAVRRGVRPERLANFDEECWMLMEACWSGDPSARP 879          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG13])

HSP 1 Score: 145.976 bits (367), Expect = 1.032e-39
Identity = 72/198 (36.36%), Postives = 117/198 (59.09%), Query Frame = 2
Query: 2246 HPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESV 2839
            HP +LPL+   I      +S ++ I +  M +D+ + L R   S+++RL+I L VA AL+YLH   ++HRD+KL N+L+D+ +   L D+G CK+  +  +S VGTP  +APE+V++  Y+  VD+Y++G+L+W + EG G  PR   +      +L  +   + +PERLD      W LM+ CW   P  RP+ + +
Sbjct:   11 HPNILPLVCTVIQPGL-CNSIKVLIVSERMASDLHRALPR-LTSLRKRLEILLDVARALKYLHSLDLIHRDVKLQNVLVDEKSQGSLTDFGLCKAEGVMENSLVGTPTSMAPEMVKQN-YNKSVDVYAFGILMWRVCEGQGNQPRNIALHPIPIIMLVRNALEDRKPERLDRFMGPCWNLMERCWATVPDQRPNFQEI 205          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49816 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG14])

HSP 1 Score: 152.14 bits (383), Expect = 3.303e-38
Identity = 124/445 (27.87%), Postives = 195/445 (43.82%), Query Frame = 2
Query:   89 NLNQAIHEYRENRERLLRIQSSTKEAFSQIT---------EILKPTTAELLEC-------VNIDNIAHIASDLGVINKPTEEIEISAE-----EFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRT------EEILF--HFDLFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDL 1336
            +L +   E+R NR  L +I   T + F  I          E+++  T  L          +N++NI  +     +    +E +   AE     +FL +T               PA+ + GQ   GKS+ +N  L   VV    + CTAR+ R+TYS   YV ++  +G  LER++L    IP+++++LN +DR     +N  V AG+   FL+ GID+IDSPG SEN  L  L +N +KSILP +IYV+DG              L ++ P           D D+    + ++P++  ESK    + KL    FI          P FHG S +   ++ K  +        E LF  + D F +    L  F   +    +   C+++ +     L+  I +A  L    KE +  I  IR+ E  + E I   I   + D+
Sbjct:    3 SLEEVFKEFRRNRSSLQQIHEDTLKCFQSIEKSLADKKHEELVQEMTTTLASQQQVDGSDINLENIQLVTGGESIATNLSESLYTEAERSKVSKFLTQT---------------PALIVTGQTNCGKSSIINEFLGARVVPTKAQPCTARIVRMTYSETPYVRLVKRDGTELERRELKSNKIPREFIELNIDDRDDEKRVNATVEAGLCVDFLKAGIDVIDSPGTSENDVLDELVRNQMKSILPFVIYVVDGHN------------LLSSSPAKTDSSDEESDDDDNDESVKQAEPVQ--ESKKRKVYDKLVKKGFIIPCEGGRDAHPNFHGLSAWRIGEFNKRMKMNPAWDDSEGLFKEYMDAFHRLHTCLHDFTKSSLTACVENTCNTLTSVLSRCLSFFIKKANFLKQGKKETMVMINRIRQEELTVHENILRQIEKQRLDI 418          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGQ2])

HSP 1 Score: 117.857 bits (294), Expect = 5.882e-27
Identity = 87/293 (29.69%), Postives = 147/293 (50.17%), Query Frame = 2
Query:  371 AIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKK-LNKPTIPKKYLQLNDEDRTKRSE-INKIVRAGIKSQFLEYG-IDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIKL--------AESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITR 1216
            AI +VGQ  +GKS+ +N LL    +  A   CT+R+ R+ YS  NYVE+   NG+ ++ K+   K  IP+  + L+D+ +   +E +  +V+ G+ +  L  G ++++D+PG+SEN  L  + +  I  IL ++IYVIDG +S++  D   L  LK  +  + I +  +K+DT+        D             E+KM  A+K L     I +  +   +C  FHG S +      +  R ++I  H      FEV   SFL       +  + ++ L +  D+L +I+ R
Sbjct:   94 AILVVGQTNSGKSSLINELLGGTYLPTAEIPCTSRIVRICYSDNNYVEVQGPNGECVQGKQSFGKKRIPRDEIALDDDKKRSDAEWVRCVVKVGLNNSLLRGGHLELVDAPGMSENEVLDQIVQECIHGILQVVIYVIDGNSSLRTQDREFLFSLKERIDSIPIFFVCNKVDTNAKAAEFDRDSDDSDDDSSLDNVETKMRQAYKALVGYGLIDSDIQ-LEDCAAFHGISTH----EVRKARHKKI--HNQFTDAFEVMKSSFLTF-----LDNSLNANLGYTTDLLLRILQR 374          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO25348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWR2])

HSP 1 Score: 93.2041 bits (230), Expect = 2.310e-22
Identity = 43/128 (33.59%), Postives = 71/128 (55.47%), Query Frame = 2
Query: 2480 LDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLIL 2863
            +D+ +   L D+G CK+  +  +S VGTP  +APE+V++  Y+  VD+Y++G+L+W + EG G  PR   +      +L  +   + +PERLD      W LM+ CW   P  RP+ + +   +  IL
Sbjct:    1 VDEKSQGSLTDFGLCKAEGVMENSLVGTPTSMAPEMVKQN-YNKSVDVYAFGILMWRVCEGQGNQPRNIALHPIPIIMLVRNALEDRKPERLDRFMGPCWNLMERCWATVPDQRPNFQEIESDLQEIL 127          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:100144388])

HSP 1 Score: 198.749 bits (504), Expect = 3.992e-52
Identity = 158/600 (26.33%), Postives = 285/600 (47.50%), Query Frame = 2
Query: 1094 FGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNS---IKLFFSK-----LFGTDQIKESV--------DVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQE--MAKKTVNLPMNQ-LNDIAEEVYYSY-LFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            F +    L  F     +N+  EA + +       L   I +A  +    +     +   R+ E ELF  +  + +  + ++ + ++E L    E ++    +LE+ + I  P NG  +  + I+ C             ++I++ +   L Q   + +   V    +  +G              +LER L+S  K     +  ++  HNV    ++++LN+   +++ F        F  +QIK+ +           + EWK + A++ ++    + LA  +C        + H AF  +L    +    ++  +E++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G     A K+V  P ++  ND+A E +Y+  L +H RL+ L   S+ D +      I++   +  +  D+   LK   +S++ERL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+     YD  VD+Y++G+L WYL  G+ + P      S+  Q LW + +   RPERL    +E W+LM+ACW+ +PS+RP
Sbjct:  316 FDRLHRLLVPFTRQVLQNQQVEAANVLNGLHCRCLDLFINQAFDMQRDLQITPRRLEYTREKEGELFSSLMAIANRKQEEMKEMIVETLGSMKEQLLEDAANLEFTDVIVTP-NGEPVTSKEIKSCI------------HLIQELIVVRLNQAVANKLISSVDYLRESFVG--------------TLERCLSSLEK-----STLDSSVHNVTSNHLKQLLNAAYHVEVTFHSGSSVTRFVWEQIKQIIHRITFVNPPAITPEWKRKVAQDAIESLSAAKLARSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLHGKPRLGRELGRGQYGVVYLCESWGGHYPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVDLHG-SVIDHSYGGGSSIAVLLIMERLHRDLYTGLKAG-LSLRERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELF-TGKYDNSVDVYAFGILFWYLCTGSVKLPEAFEKCSSKDQ-LWNNVKKGARPERLPSFDEECWQLMEACWNGDPSLRP 879          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: dstyk (dual serine/threonine and tyrosine protein kinase [Source:NCBI gene;Acc:100144388])

HSP 1 Score: 152.91 bits (385), Expect = 1.646e-37
Identity = 143/600 (23.83%), Postives = 261/600 (43.50%), Query Frame = 2
Query: 1094 FGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNS---IKLFFSK-----LFGTDQIKESV--------DVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQM-AEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQE--MAKKTVNLPMNQ-LNDIAEEVYYSY-LFQHPRLLPLIAVSITDSTELDSKQISIFAPL--MKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRP 2824
            F +    L  F     +N+  EA + +       L   I +A  +    +     +   R+ E ELF  +  + +  + ++ + ++E L    E ++    +LE+ + I  P NG  +  + I+ C             ++I++ +   L Q   + +   V    +  +G              +LER L+S  K     +  ++  HNV    ++++LN+   +++ F        F  +QIK+ +           + EWK + A++ ++    + LA  +C        + H AF  +L    +    ++  +E++  ++  + AP  A L + +  ++   +     +  ++G+G  G VY C   G     A K+V  P ++  ND+A E +Y+  L +H RL+ L   S+ D +      I++   +  +  D+   LK   +S++ERL+IAL V E +++LH Q ++HRD+KL N+LLD  N   + D GFCK  A+ + S VGTP+H+APE+   A                                               RPERL    +E W+LM+ACW+ +PS+RP
Sbjct:  348 FDRLHRLLVPFTRQVLQNQQVEAANVLNGLHCRCLDLFINQAFDMQRDLQITPRRLEYTREKEGELFSSLMAIANRKQEEMKEMIVETLGSMKEQLLEDAANLEFTDVIVTP-NGEPVTSKEIKSCI------------HLIQELIVVRLNQAVANKLISSVDYLRESFVG--------------TLERCLSSLEK-----STLDSSVHNVTSNHLKQLLNAAYHVEVTFHSGSSVTRFVWEQIKQIIHRITFVNPPAITPEWKRKVAQDAIESLSAAKLARSICSQFRTRLNSSHEAFAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLHGKPRLGRELGRGQYGVVYLCESWGGHYPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVDLHG-SVIDHSYGGGSSIAVLLIMERLHRDLYTGLKAG-LSLRERLQIALDVVEGIRFLHGQGLLHRDIKLKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGA-----------------------------------------------RPERLPSFDEECWQLMEACWNGDPSLRP 866          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek6 (NIMA related kinase 6 [Source:NCBI gene;Acc:101173323])

HSP 1 Score: 106.686 bits (265), Expect = 1.018e-24
Identity = 84/271 (31.00%), Postives = 132/271 (48.71%), Query Frame = 2
Query: 2075 RYMLQGIVVNEKIGQGAQGEVYRCS--CNGQEMAKKTVN----LPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVS---KYLKRNKVSIKERL--KIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVL 2842
            R  +    V  KIG+G   EVYR     + Q +A K V     +      D  +E+       HP ++  +   I D+      +++I   L    D+S   KY K+ +  I ER   K  +Q+  AL+++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE + +  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   D+ SD+L EL+  C ++EP  RPDI  VL
Sbjct:   35 RCSMANFRVERKIGRGQFSEVYRAVRLLDRQSVALKKVQIFEMMDAKARQDCIKEIDLLKQLNHPNIIKYLDSFIEDN------ELNIVLELADAGDLSQMIKYFKKKRRLIPERTIWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGEVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLLSLCRKIEQCDYPPLPPDQYSDKLRELVSMCINSEPDQRPDIIFVL 296          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek7 (NIMA related kinase 7 [Source:NCBI gene;Acc:101170580])

HSP 1 Score: 96.6709 bits (239), Expect = 2.330e-21
Identity = 87/301 (28.90%), Postives = 143/301 (47.51%), Query Frame = 2
Query: 1985 ISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCS--CNGQEMAKKTVNLPMNQLN-----DIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKT-DVSKYL-----KRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYG---FCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESV 2839
            +S+  + + Q AE  P F     L LD+     L    + +KIG+G   EVYR     +   +A K + +  N ++     D  +E+       HP ++   A  I D+      +++I   L    D+S+ +     +R  +  K   K  +QV  AL+++H +++MHRD+K AN+ +     V L D G   F  S   + HS VGTP +++PE +R+  Y+FK DI+S G LL+ +A        F   + N+  +     + +  P   D  S EL +L+  C + +P  RPDI  V
Sbjct:    1 MSMDMQPQGQQAETPP-FQPQKPLQLDMDYS-SLANFQIEKKIGKGQFSEVYRARYILDNTPVALKKIQI-FNLMDAKARQDCIKEIDLLKQLNHPNVIKYHASFIEDN------ELNIVLELADAGDLSRMINHFKNQRRLIPEKAVWKYFVQVCRALEHMHSRRVMHRDIKPANVFVTATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERLRENGYNFKSDIWSLGCLLYEMA---ALQSPFYGDKMNLYSLCTKIQQCDYPPLPSDHYSQELRDLVDMCINPDPEKRPDITYV 289          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 94.7449 bits (234), Expect = 8.916e-20
Identity = 62/194 (31.96%), Postives = 99/194 (51.03%), Query Frame = 2
Query: 2105 EKIGQGAQGEVYRC--SCNGQEMAKKTVNL---PMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSN---HSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEG 2662
            EKIGQGA G VY       GQE+A K +NL   P  +L  I  E+      ++P +     V+  DS  +  +   +   L    ++  +    +   +   +  +V +AL++LH  Q++HRD+K  N+LL  + +V L D+GFC  +        + VGTP  +APE+V +  Y  KVDI+S G++   + EG
Sbjct:  206 EKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKEL--IINEILVMKELKNPNI-----VNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEG 392          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056697.1 (SMESG000056697.1)

HSP 1 Score: 1917.12 bits (4965), Expect = 0.000e+0
Identity = 938/940 (99.79%), Postives = 940/940 (100.00%), Query Frame = 2
Query:   56 MAVFDEDKTRQNLNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTAELLECVNIDNIAHIASDLGVINKPTEEIEISAEEFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLILENCI 2875
            MAVFDEDKTRQNLNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTAELLECVNIDNIAHIASDLGVINKPTEEIEISAEEFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLDTDDTTETEFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFL+INFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENEN+FVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLILENCI
Sbjct:    1 MAVFDEDKTRQNLNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTAELLECVNIDNIAHIASDLGVINKPTEEIEISAEEFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLDTDDTTETEFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFLMINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENRFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLILENCI 940          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056719.1 (SMESG000056719.1)

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 499/849 (58.78%), Postives = 663/849 (78.09%), Query Frame = 2
Query:   68 DEDKTRQNLNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTAELLECVNIDNIAHIASDLGVINKPTEEIEISAEEFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFK 2614
            D+ +TR+NL + I +YR+NRERL++IQSSTK+ F QITEILK  T  LL+CV+ +N+ +IA+DLG  N    +I ++ E+F  K+++EKQ     V+IGNPAIA+VGQVK+GKSTFVN LLRKNVV QA+ERCTAR+TR+TYS +N+VEI+   G +L+RK LN  TIPK++LQL +  R    EINK ++AGI S FL+ GIDIIDSPGLSEN TL NLSKNMIKSILP+MIYVIDGRTSVKQTDI+DLLELKNAVP LQIIYF+SKLDTDD +ETE +DPIKLAE KM++AFKKLQ+NNFIP +F HWSEC YFHG SLY +MDY +N RT E LFH++LF KFE  L  +LL NF+NKI E C+ +++FQM+V+TKII RA++LSDF + N + I  I++IEE+L++KIK  +  SK  L   LI+RL++ES+ I+ PI ++ YPN +++P +G+V +K+ I+QCQ +I+S++CQGLENVIK+FVE EL+QKY +AI+ Q+  RMK++I V ++   GKT Y + L+R +A  YKFN    LSN +G+N IMK M  I +SIK F       +  ++SVDVK  +WK +QAK+CL+RCD   LA+EVCK+L+++F  KHN FL  ++ EN +V KKI +S+EIR ++AEKAP FA LLML+LDVKG+Y LQ +   E+IG G+QG ++RC C+G+E+AKK   + ++ + +IAEE+YYSY F+HP LLP +AV+I D+ E+DSK+++I++PLMKTD+  YL  NK  +  R+ IA+Q+AEALQYLH   IMHRDLKLANILL+++N+VFLADYGFCKS AL+++SFVGTP+HIAPEI+ K  YD+K
Sbjct:    7 DDQRTRENLTRVIKDYRQNRERLVKIQSSTKKTFDQITEILKSDTGSLLDCVDSNNLNNIAADLG--NFEDSDI-LADEQFYLKSVFEKQ-----VEIGNPAIAVVGQVKSGKSTFVNTLLRKNVVPQAFERCTARITRVTYSMKNFVEIISNEGVILKRKSLNTTTIPKRFLQLKENVRIDEEEINKQIKAGIHSNFLKCGIDIIDSPGLSENETLNNLSKNMIKSILPVMIYVIDGRTSVKQTDISDLLELKNAVPNLQIIYFVSKLDTDDLSETENADPIKLAELKMDIAFKKLQFNNFIPLTFSHWSECNYFHGCSLYAFMDYTQNSRTPETLFHYNLFCKFEENLHHYLLQNFRNKIEEVCNFLIDFQMEVMTKIINRAQMLSDFNRINFDEINRIKRIEEKLYKKIKSAVKDSKIHLKSCLIKRLKNESDVIVKPISEIIYPNHLNIPLDGIVSEKQQIKQCQSIIISNVCQGLENVIKRFVEEELFQKYLEAIQAQIPFRMKNKISVTKS---GKTNYGLCLDRRMAEIYKFNISNNLSNLDGNNTIMKFMNVIRSSIKGFLMTGLKIEFSQKSVDVKDPKWKMKQAKKCLERCDFKILADEVCKNLLEEFYKKHNEFLAVMDLENFYVQKKIELSDEIRQKLAEKAPIFAELLMLSLDVKGKYFLQNVEEKEEIGSGSQGTIHRCICDGKELAKKKYIVNIDSIEEIAEEIYYSYSFEHPHLLPFLAVAIIDTEEIDSKEVAIYSPLMKTDLYNYLCHNKTKLSHRISIAIQIAEALQYLHSHNIMHRDLKLANILLNEDNSVFLADYGFCKSTALTHYSFVGTPLHIAPEIIMKNNYDYK 844          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056718.1 (SMESG000056718.1)

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 472/925 (51.03%), Postives = 655/925 (70.81%), Query Frame = 2
Query:   92 LNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTAELLECVNIDNIAHIASDLGVINKPTEEIEISAEEFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDP-------IKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKA-PDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVL 2842
            +NQA  EYRENR+ L+ IQ+ T+ AF  +T+ILKP+TAELLEC+NI++++   ++  ++        +  ++++        DV + V   NPAIAIVGQVKA KST +NVLLRK VVCQA+ RCTAR+TRLTYS +NYVE+ D +G +L+RK L  P IP ++++LN+ DR+   EI K V+AGI  +FL  GID+ID+PGL+E++ L+NLSK  +K+ILPIMIYVIDG TSVKQTD++DLLELKNA+P L+IIYFISKLD+D +TE   SDP       I+L+  K+ +AFK+LQ  NFIP ++ HWSECPYFHGASLY  MDY+ ++++ EILF+ +LF +FE  L  FLL++F+N I  A  S++ F MDVL KII+R   + D ++EN N I  I++IEEELFE IK V+SS K  L + LI++ + ES++I   + D EYP+SI VP++G+ ID   I  CQ  I+S +C GLE +I++FVE EL+ KYR  +E      M  ++    +K  G+ PY M L +IL  NYK N      N E  + + KL+  IL+SIK+F  K+F  + +K   DVKS +WK  Q K CL  CD S LA+ VC +LI++ +N H AF LALE E K   K I +S+ I+  + +   P F+ LLM TLD+KGRYM++ +  +E+IGQG+Q  VYRC+ NG+E+A KT  +  ++L++I++EVYYSYLF+H  LLP IA+SI    + +S Q+SIF PLMK+D   ++ +N+VS+ +RL IALQ AEALQYLH Q IMHRDLKLANILLD+ +NV+LADYG CKS A++N++ VGTP+H+APE+++ + YD K+DIYS+G+LLWYL EG G HP+   V S + +VL+ +   ++RPERL+ + DELW+LM ACWD  P +RP+ +S++
Sbjct:   15 INQASQEYRENRKALIDIQTRTRTAFLNLTDILKPSTAELLECININDLSEAFAEFTLVQNEN----VPNDKYV-------PDVEKNVSC-NPAIAIVGQVKAAKSTMINVLLRKTVVCQAFSRCTARITRLTYSEENYVELFDSDGTLLKRKLLRAPKIPARFVRLNENDRSNIKEIRKEVKAGINCKFLMSGIDLIDTPGLNEHSLLSNLSKETVKNILPIMIYVIDGNTSVKQTDLSDLLELKNAIPDLKIIYFISKLDSDISTEQ-LSDPEEIEKMKIELSIEKLSIAFKRLQNQNFIPKTYNHWSECPYFHGASLYKIMDYFNHQQSPEILFNLELFNRFENELSLFLLVHFENIITTAAYSLIYFHMDVLAKIISRGIKIKDSSEENQNQIERIKRIEEELFENIKNVLSSQKLYLKEILIKKFKTESDSIYKLVQDCEYPSSIRVPDSGITIDNNTIRLCQKFIVSIICFGLEQLIERFVEDELFSKYRSKVENHFNDNMDKKLYGKNSKFSGRNPYDMCLRKILTENYKCNFKVNPKNLEDMSSMRKLINNILSSIKIFLWKIFEVNSLKGCKDVKSQKWKHNQVKYCLLNCDFSKLADNVCINLIENLQNCHEAFNLALEIERKHFQKSIQISDNIKQSLKKNHWPVFSVLLMETLDIKGRYMMKDVKRHEEIGQGSQASVYRCTVNGKELAMKTRYVKADKLSEISDEVYYSYLFEHRHLLPFIAISI--KLQYNSAQVSIFTPLMKSDALDFIIQNEVSLVKRLMIALQTAEALQYLHNQSIMHRDLKLANILLDNEDNVYLADYGCCKSTAIANNTIVGTPIHMAPEVIQNS-YDDKIDIYSFGILLWYLVEGKGNHPKHLSVHSEVFRVLYLAAHKDVRPERLENMPDELWDLMSACWDKNPVLRPNTDSIV 923          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056716.1 (SMESG000056716.1)

HSP 1 Score: 890.182 bits (2299), Expect = 0.000e+0
Identity = 453/929 (48.76%), Postives = 638/929 (68.68%), Query Frame = 2
Query:   83 RQNLNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTAELLECVNIDNIAHIASDLGVINKPTE-EIEISAEEFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLT-ALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLIL 2863
             +NL Q I  Y+ + + +L IQ +TK AF  IT+IL P +  LLEC+N+DN+ +I +  G      + E+ ISA  + +  +      N ++   NP IAIVG VKAGKST VN+LLRKNVV QA++ CTARLTR+TYS +NYVE+++ + +++ERKKL    IPK  ++LNDEDR+   E+NK++R GIKS+FL+ GID+IDSPGL+EN  L  L  N+I  +LP+MIYVIDG+TSVKQTDI+++L LK ++P L IIYFI++LDTDD +E   +D IK A+ K++  F+KLQ +N IP +F H+SEC  FHGASLY YMDY    +++E  FH + F KFE  L   L  NF+ +I  A  S+++FQMDVLTKII+RA+   DFT ENL+ IFT+RK+EE L   +K  I++SK  LI RL++RL++ES+ II+ I D+E+P SI +PEN     K+  + CQ  I+  +C+ L+N+I  FV+ EL + + +  E  ++ ++ +++ ++  +   K+PYR+ LER L   YK++ L   + N+            I N +K   + LF +D   ++ D+ S  W+  Q K  L  CD   LA+ +C +++ D   KH+ FL+ LE E K + K+I++SE IR +++ +   F  LLM TLD++ +Y+++  V  E IGQG+QG VYRC CNG+E AKK + +P + L  I+EEVYYSYLF+HP LLPLIAV++ D+   D  +ISI+ PLMK D+  Y+K+N ++++++LKI+L+VA AL+Y+H Q IMHRDLKLANILLD+ NNV+LADYGFCKS+ALSN+SFVGT VHIAPEIVR++ YD K+DIYS+GMLLWYLA+G    P FA  QS   +VL   T  N+RPERL+ I D LW+LM  CWD  PS RP+I S++  I  +L
Sbjct:    7 HENLRQTIQLYQNDLKNVLVIQENTKTAFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTLVNLLLRKNVVRQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILSENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENK-AFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNFENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSF---------SIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLENIPDNLWDLMNECWDQNPSNRPNINSIISTIQDLL 925          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000056716.1 (SMESG000056716.1)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 453/929 (48.76%), Postives = 638/929 (68.68%), Query Frame = 2
Query:   83 RQNLNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTAELLECVNIDNIAHIASDLGVINKPTE-EIEISAEEFLNKTIYEKQDVNQKVDIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQNYVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKSQFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTDIADLLELKNAVPKLQIIYFISKLXXXXXXXXXFSDPIKLAESKMELAFKKLQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKFEVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLNHIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLEYPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKYRDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLT-ALSNTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKECLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEIRTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCNGQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDSKQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHRDLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIYDFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERLDEISDELWELMQACWDNEPSVRPDIESVLCKITLIL 2863
             +NL Q I  Y+ + + +L IQ +TK AF  IT+IL P +  LLEC+N+DN+ +I +  G      + E+ ISA  + +  +      N ++   NP IAIVG VKAGKST VN+LLRKNVV QA++ CTARLTR+TYS +NYVE+++ + +++ERKKL    IPK  ++LNDEDR+   E+NK++R GIKS+FL+ GID+IDSPGL+EN  L  L  N+I  +LP+MIYVIDG+TSVKQTDI+++L LK ++P L IIYFI++LDTDD +E   +D IK A+ K++  F+KLQ +N IP +F H+SEC  FHGASLY YMDY    +++E  FH + F KFE  L   L  NF+ +I  A  S+++FQMDVLTKII+RA+   DFT ENL+ IFT+RK+EE L   +K  I++SK  LI RL++RL++ES+ II+ I D+E+P SI +PEN     K+  + CQ  I+  +C+ L+N+I  FV+ EL + + +  E  ++ ++ +++ ++  +   K+PYR+ LER L   YK++ L   + N+            I N +K   + LF +D   ++ D+ S  W+  Q K  L  CD   LA+ +C +++ D   KH+ FL+ LE E K + K+I++SE IR +++ +   F  LLM TLD++ +Y+++  V  E IGQG+QG VYRC CNG+E AKK + +P + L  I+EEVYYSYLF+HP LLPLIAV++ D+   D  +ISI+ PLMK D+  Y+K+N ++++++LKI+L+VA AL+Y+H Q IMHRDLKLANILLD+ NNV+LADYGFCKS+ALSN+SFVGT VHIAPEIVR++ YD K+DIYS+GMLLWYLA+G    P FA  QS   +VL   T  N+RPERL+ I D LW+LM  CWD  PS RP+I S++  I  +L
Sbjct:    8 HENLRQTIQLYQNDLKNVLVIQENTKTAFQHITDILDPISENLLECINLDNLLNIFNVCGNTETLNDIELAISALRYDSGLVENSFRTNNEIHKENPTIAIVGSVKAGKSTLVNLLLRKNVVRQAHKTCTARLTRITYSEENYVELVNIHDQIIERKKLKNKPIPKYIVELNDEDRSNPDEVNKLIRVGIKSKFLKSGIDLIDSPGLNENHVLNLLISNIINKVLPVMIYVIDGQTSVKQTDISNILSLKVSIPNLNIIYFITRLDTDDVSELIENDHIKTAKDKLDFTFRKLQRSNLIPKTFNHYSECHNFHGASLYSYMDYCNKIKSQETDFHNEQFCKFESDLNRILSENFEREILTATKSLIDFQMDVLTKIISRAKQFVDFTNENLDEIFTMRKVEERLHNDLKSEINNSKPLLIDRLMKRLDNESDLIIDLIADMEFPKSIIIPENK-AFTKKNAKFCQKHIIDLICKDLDNLIDNFVQDELNKNFENCFEAHLSPKIINKLKLYSCRLSNKSPYRLCLERNLTKYYKYDLLGLKIKNSSF---------SIWNFLKNIITGLFRSDLSNDTFDINSRHWRIGQTKIILNLCDKDLLAKNICNNMLHDLNVKHDRFLMNLEKEFKVIQKEINLSETIRDKISNETSSFTLLLMRTLDLQSKYLMKDSVEKEMIGQGSQGTVYRCVCNGKEYAKKKIIVPTDLLETISEEVYYSYLFEHPNLLPLIAVTVNDNIRFDCIEISIYTPLMKIDLENYMKKNILTLEQQLKISLEVANALKYIHNQNIMHRDLKLANILLDEQNNVYLADYGFCKSLALSNYSFVGTFVHIAPEIVRQSKYDQKIDIYSFGMLLWYLAKGDCEPPLFANCQSTTVKVLLEVTNKNVRPERLENIPDNLWDLMNECWDQNPSNRPNINSIISTIQDLL 926          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DSTYK3.798e-5229.10dual serine/threonine and tyrosine protein kinase ... [more]
DSTYK2.306e-3726.36dual serine/threonine and tyrosine protein kinase ... [more]
NEK72.418e-2429.19NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK72.418e-2429.19NIMA related kinase 7 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK63.543e-2229.67NIMA related kinase 6 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frk-11.023e-2223.39Fer-related kinase 1 [Source:UniProtKB/Swiss-Prot... [more]
svh-21.011e-2125.66Tyrosine-protein kinase receptor svh-2 [Source:Un... [more]
svh-21.011e-2125.66Tyrosine-protein kinase receptor svh-2 [Source:Un... [more]
svh-21.179e-2125.66Tyrosine-protein kinase receptor svh-2 [Source:Un... [more]
svh-21.368e-2125.66Tyrosine-protein kinase receptor svh-2 [Source:Un... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PhKgamma2.174e-1828.89gene:FBgn0011754 transcript:FBtr0090002[more]
PhKgamma2.174e-1828.89gene:FBgn0011754 transcript:FBtr0343648[more]
PhKgamma2.188e-1829.78gene:FBgn0011754 transcript:FBtr0343587[more]
Pak2.294e-1830.20gene:FBgn0267698 transcript:FBtr0334539[more]
Pak2.294e-1830.20gene:FBgn0267698 transcript:FBtr0081714[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk4.339e-5028.15dual serine/threonine and tyrosine protein kinase ... [more]
dstyk5.885e-4927.74dual serine/threonine and tyrosine protein kinase ... [more]
nek66.635e-2529.43NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
matk1.052e-2127.95megakaryocyte-associated tyrosine kinase [Source:Z... [more]
matk1.083e-2127.95megakaryocyte-associated tyrosine kinase [Source:Z... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk6.855e-4727.02dual serine/threonine and tyrosine protein kinase ... [more]
dstyk8.929e-4727.02dual serine/threonine and tyrosine protein kinase ... [more]
dstyk9.905e-4727.02dual serine/threonine and tyrosine protein kinase ... [more]
dstyk1.044e-4627.02dual serine/threonine and tyrosine protein kinase ... [more]
dstyk1.246e-4627.02dual serine/threonine and tyrosine protein kinase ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dstyk1.611e-5228.92dual serine/threonine and tyrosine protein kinase ... [more]
Dstyk1.119e-3726.36dual serine/threonine and tyrosine protein kinase ... [more]
Nek72.204e-2431.00NIMA (never in mitosis gene a)-related expressed k... [more]
Nek72.204e-2431.00NIMA (never in mitosis gene a)-related expressed k... [more]
Nek67.222e-2229.63NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6XUX2|DUSTY_RAT9.871e-5329.10Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q4TVR5|DUSTY_BOVIN1.059e-5229.29Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q6XUX1|DUSTY_MOUSE1.127e-5128.92Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q20CR4|DUSTY_MACMU1.135e-5129.10Dual serine/threonine and tyrosine protein kinase ... [more]
sp|Q6XUX0|DUSTY_CHICK1.412e-5129.10Dual serine/threonine and tyrosine protein kinase ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FM292.895e-12030.73Protein kinase domain-containing protein OS=Macros... [more]
A0A267FLZ44.394e-11931.43Protein kinase domain-containing protein OS=Macros... [more]
A0A267FEQ62.286e-11530.52Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8G8Z85.672e-11230.45Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8HXC89.624e-11130.25Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk4.863e-3725.74dual serine/threonine and tyrosine protein kinase ... [more]
matk1.106e-2128.91megakaryocyte-associated tyrosine kinase [Source:N... [more]
matk1.421e-2129.30megakaryocyte-associated tyrosine kinase [Source:N... [more]
nek73.230e-2129.66NIMA related kinase 7 [Source:NCBI gene;Acc:103046... [more]
nek61.130e-2029.10NIMA-related kinase 6 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK364.058e-2030.40serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
ENSPMAT00000006100.11.466e-1925.39pep scaffold:Pmarinus_7.0:GL478927:1672:12797:-1 g... [more]
ENSPMAT00000008193.15.943e-1825.00pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
phkg1b1.112e-1726.14phosphorylase kinase, gamma 1b (muscle) [Source:ZF... [more]
MARK31.704e-1730.41microtubule affinity regulating kinase 3 [Source:H... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK33.094e-1929.33cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK15.139e-1929.27cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK21.132e-1730.10cAMP-dependent protein kinase catalytic subunit; p... [more]
SNF16.116e-1730.73AMP-activated S/T protein kinase; forms a complex ... [more]
YPL150W_mRNA6.705e-1732.98Protein kinase of unknown cellular role; binds pho... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO444583.101e-5124.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498151.032e-3936.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498163.303e-3827.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495805.882e-2729.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253482.310e-2233.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dstyk3.992e-5226.33dual serine/threonine and tyrosine protein kinase ... [more]
dstyk1.646e-3723.83dual serine/threonine and tyrosine protein kinase ... [more]
nek61.018e-2431.00NIMA related kinase 6 [Source:NCBI gene;Acc:101173... [more]
nek72.330e-2128.90NIMA related kinase 7 [Source:NCBI gene;Acc:101170... [more]
ENSORLT00000015480.28.916e-2031.96serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056697.10.000e+099.79SMESG000056697.1[more]
SMESG000056719.10.000e+058.78SMESG000056719.1[more]
SMESG000056718.10.000e+051.03SMESG000056718.1[more]
SMESG000056716.10.000e+048.76SMESG000056716.1[more]
SMESG000056716.10.000e+048.76SMESG000056716.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017847 ID=SMED30017847|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2980bp
AATGCTTTCATATTCATATTGAAATTGTACACTATTCGCTAGCATCCTAA
TTTTAATGGCAGTTTTTGACGAAGATAAAACTCGACAGAATTTAAACCAG
GCTATTCATGAATATCGTGAGAATCGAGAACGTTTGTTACGAATTCAATC
AAGTACTAAAGAAGCGTTTAGTCAAATTACTGAAATTTTAAAACCAACCA
CTGCAGAACTTTTAGAATGCGTTAATATTGATAATATAGCTCATATTGCC
TCAGATCTTGGAGTAATCAATAAGCCAACTGAGGAAATTGAAATAAGTGC
GGAGGAATTTCTTAACAAGACCATATATGAAAAACAAGATGTGAATCAAA
AAGTTGACATTGGAAATCCAGCAATTGCAATAGTTGGTCAAGTAAAAGCG
GGAAAGAGCACTTTTGTAAATGTTCTTTTGAGAAAAAATGTGGTATGTCA
AGCATATGAACGATGTACAGCTCGATTAACTAGATTAACATATAGTTCAC
AAAATTACGTTGAAATCCTAGATGAAAACGGAAAAGTTTTGGAAAGGAAA
AAATTAAACAAACCGACAATTCCGAAGAAATACTTACAATTAAATGATGA
AGACAGAACGAAACGAAGTGAGATAAATAAAATTGTCAGGGCCGGAATAA
AATCTCAGTTTCTTGAATACGGCATTGATATAATAGACTCACCAGGACTA
AGTGAAAATGCAACACTAACAAATTTATCTAAAAATATGATTAAATCAAT
TTTACCCATAATGATTTATGTAATCGACGGAAGGACCTCAGTTAAGCAAA
CAGACATAGCGGATTTATTGGAGTTGAAAAATGCGGTACCAAAGTTGCAA
ATAATTTATTTCATTTCCAAATTGGACACTGACGATACAACAGAAACGGA
ATTTTCTGATCCGATAAAATTGGCTGAATCGAAAATGGAATTAGCTTTTA
AGAAATTACAATACAATAATTTTATTCCTACAAGTTTTAAACACTGGTCT
GAGTGCCCATATTTCCATGGGGCGTCATTATACTGTTACATGGACTATTA
TAAAAACAAACGAACGGAAGAAATTTTATTTCATTTTGATCTTTTCGGTA
AATTTGAGGTTGCTTTACAAAGCTTTCTATTGATAAATTTCAAAAATAAA
ATTTTCGAAGCATGTGATTCAATGCTCAACTTTCAAATGGATGTCTTGAC
CAAAATTATAACAAGGGCCAGAGTTTTATCGGATTTCACTAAAGAAAATC
TTAATCACATATTTACCATACGAAAAATTGAGGAAGAACTCTTTGAAAAA
ATAAAAGGAGTTATTAGTAGTTCTAAAAATGATTTGATTAAGAGGCTTAT
AGAGAGATTAGAAGATGAATCCGAGGCAATAATTAACCCGATTGGGGATT
TAGAATATCCCAATTCCATTTCGGTACCAGAAAATGGAATGGTAATAGAT
AAAAGATTAATAGAACAATGTCAAGGAGTGATTATGTCAAGCCTTTGTCA
AGGTTTGGAAAATGTCATTAAGCAATTTGTTGAGTCGGAATTGTATCAAA
AATACAGAGATGCGATTGAAGTACAAGTTACATCGAGAATGAAAGATGAA
ATAGGTGTACATGAAGCTAAATGTTTGGGTAAAACACCATATCGAATGAG
CTTAGAGAGAATTTTAGCTTCAAACTACAAATTTAATTCTTTAACGGCAT
TATCGAACACAGAAGGTCACAACGTAATCATGAAATTAATGCAAGAAATT
CTCAACAGCATTAAATTATTTTTTTCAAAATTGTTTGGAACCGACCAAAT
TAAAGAATCTGTGGATGTTAAAAGTCATGAGTGGAAAACCCAACAGGCCA
AAGAATGCTTAAAGAGATGTGATCATTCGACATTGGCGGAGGAAGTTTGT
AAAAGTTTAATTGACGATTTTGAAAATAAGCACAACGCATTTTTACTGGC
ACTAGAAAATGAAAATAAATTTGTCCATAAGAAAATATCAGTTTCTGAAG
AAATTCGCACACAAATGGCTGAGAAGGCACCTGACTTTGCTGGCCTATTG
ATGCTTACGCTTGACGTTAAAGGACGTTATATGTTACAAGGAATTGTTGT
AAATGAAAAGATAGGACAAGGCGCGCAAGGTGAAGTTTATCGGTGTTCCT
GTAATGGACAAGAAATGGCAAAGAAGACTGTAAATTTGCCAATGAATCAG
TTAAATGACATTGCTGAAGAAGTTTATTACTCGTATTTATTTCAACATCC
TCGTTTACTACCCCTGATAGCAGTGTCAATTACTGATTCTACAGAATTGG
ACTCTAAACAGATTTCAATATTTGCACCTTTGATGAAAACTGATGTTTCG
AAATATTTAAAAAGAAACAAAGTATCTATTAAAGAGCGTTTGAAAATAGC
GTTACAGGTCGCTGAAGCCTTGCAATATCTGCATCGTCAACAAATAATGC
ATCGAGATCTCAAGTTGGCCAATATTCTATTAGATGATAATAATAATGTG
TTTTTGGCTGATTATGGATTTTGCAAATCTATGGCTTTATCTAATCATTC
ATTTGTCGGGACACCTGTTCATATTGCTCCGGAAATTGTTAGAAAGGCTA
TTTACGACTTCAAAGTCGATATTTACTCGTATGGAATGCTGCTATGGTAT
TTGGCCGAAGGTACGGGCCGACACCCAAGATTTGCTAGAGTTCAATCAAA
TATCGCGCAAGTTCTTTGGGCGTCAACTGAGCATAACATGCGACCAGAAA
GACTAGATGAAATTTCCGACGAATTATGGGAATTAATGCAGGCATGTTGG
GACAATGAGCCATCAGTTAGACCAGATATTGAAAGTGTTTTGTGTAAAAT
CACCTTAATTTTGGAAAATTGCATATAAACAAATACTATTCAAAAAATTG
TTAAGTTAAAGAAATTTCTTATTTTTGAATAAATAGAATTTTGATAATAA
TTGAAATAAACTATTTAAACCGTGAAAAAA
back to top

protein sequence of SMED30017847-orf-1

>SMED30017847-orf-1 ID=SMED30017847-orf-1|Name=SMED30017847-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=941bp
MAVFDEDKTRQNLNQAIHEYRENRERLLRIQSSTKEAFSQITEILKPTTA
ELLECVNIDNIAHIASDLGVINKPTEEIEISAEEFLNKTIYEKQDVNQKV
DIGNPAIAIVGQVKAGKSTFVNVLLRKNVVCQAYERCTARLTRLTYSSQN
YVEILDENGKVLERKKLNKPTIPKKYLQLNDEDRTKRSEINKIVRAGIKS
QFLEYGIDIIDSPGLSENATLTNLSKNMIKSILPIMIYVIDGRTSVKQTD
IADLLELKNAVPKLQIIYFISKLDTDDTTETEFSDPIKLAESKMELAFKK
LQYNNFIPTSFKHWSECPYFHGASLYCYMDYYKNKRTEEILFHFDLFGKF
EVALQSFLLINFKNKIFEACDSMLNFQMDVLTKIITRARVLSDFTKENLN
HIFTIRKIEEELFEKIKGVISSSKNDLIKRLIERLEDESEAIINPIGDLE
YPNSISVPENGMVIDKRLIEQCQGVIMSSLCQGLENVIKQFVESELYQKY
RDAIEVQVTSRMKDEIGVHEAKCLGKTPYRMSLERILASNYKFNSLTALS
NTEGHNVIMKLMQEILNSIKLFFSKLFGTDQIKESVDVKSHEWKTQQAKE
CLKRCDHSTLAEEVCKSLIDDFENKHNAFLLALENENKFVHKKISVSEEI
RTQMAEKAPDFAGLLMLTLDVKGRYMLQGIVVNEKIGQGAQGEVYRCSCN
GQEMAKKTVNLPMNQLNDIAEEVYYSYLFQHPRLLPLIAVSITDSTELDS
KQISIFAPLMKTDVSKYLKRNKVSIKERLKIALQVAEALQYLHRQQIMHR
DLKLANILLDDNNNVFLADYGFCKSMALSNHSFVGTPVHIAPEIVRKAIY
DFKVDIYSYGMLLWYLAEGTGRHPRFARVQSNIAQVLWASTEHNMRPERL
DEISDELWELMQACWDNEPSVRPDIESVLCKITLILENCI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
IPR000719Prot_kinase_dom
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0004713protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016324apical plasma membrane
GO:0030054cell junction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 10..30
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 762..938
e-value: 4.0E-47
score: 162.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 107..313
e-value: 3.7E-17
score: 64.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 676..748
e-value: 2.1E-7
score: 32.9
NoneNo IPR availablePANTHERPTHR46392FAMILY NOT NAMEDcoord: 11..937
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 680..934
e-value: 2.1E-37
score: 140.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 682..930
e-value: 8.6E-45
score: 153.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 680..934
score: 35.58
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 107..257
e-value: 7.6E-17
score: 61.9
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 797..809
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 678..930
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 87..313