Sorting nexin-2

Overview
NameSorting nexin-2
Smed IDSMED30017841
Length (bp)1629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorting nexin-2 (SMED30017841) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorting nexin-2 (SMED30017841) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorting nexin-2 (SMED30017841) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorting nexin-2 (SMED30017841) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017841

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017841h1SMcG0009891 Contig4400GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017841h1SMcG0022585 PL030008B20E06smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017841h1SMcG0022585 Contig4400GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30017841h1SMcG0022585 Contig49791newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017841h1SMcG0022585 Contig49791uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30017841h1SMcG0022585 dd_Smed_v4_835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017841h1SMcG0022585 dd_Smed_v4_835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017841h1SMcG0022585 dd_Smed_v4_835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017841h1SMcG0022585 dd_Smed_v4_835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017841h1SMcG0022585 dd_Smed_v4_835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017841h1SMcG0022585 dd_Smed_v4_835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017841h1SMcG0022585 dd_Smed_v4_835_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorting nexin-2 vs. Ensembl Human
Match: SNX2 (sorting nexin 2 [Source:HGNC Symbol;Acc:HGNC:11173])

HSP 1 Score: 334.339 bits (856), Expect = 9.980e-110
Identity = 178/383 (46.48%), Postives = 259/383 (67.62%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            IEI VS PEK+G GM AY  Y++ TKT+   F   E +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H S E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ ++ W++A+  L KKRE +A+  ++ K DKI     EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   25 IEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA 402          
BLAST of Sorting nexin-2 vs. Ensembl Human
Match: SNX2 (sorting nexin 2 [Source:HGNC Symbol;Acc:HGNC:11173])

HSP 1 Score: 337.806 bits (865), Expect = 2.014e-109
Identity = 197/465 (42.37%), Postives = 286/465 (61.51%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLD----EPTITRNASPPRTSVTEIS----------------NDRVPNQRKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            D +D+F EA E         E+ LD    EP ++   SP  T VT  +                 DR   + +    G    IEI VS PEK+G GM AY  Y++ TKT+   F   E +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H S E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ ++ W++A+  L KKRE +A+  ++ K DKI     EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   69 DREDLFAEATE---------EVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA 519          
BLAST of Sorting nexin-2 vs. Ensembl Human
Match: SNX1 (sorting nexin 1 [Source:HGNC Symbol;Acc:HGNC:11172])

HSP 1 Score: 296.204 bits (757), Expect = 2.003e-93
Identity = 162/383 (42.30%), Postives = 251/383 (65.54%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            + + ++ PEK+G GM AY  YK+ T+T+ P F  ++  V+RRFSDFLGL+E+L  K+   G I+PP PEK+  G TK+K+ KED +++EFLE+RRAALERYLQRI  HP ++ D D REFLE + ELP+AV TQ LSGA + K+F    DAV K+T KM++ D    +WF++K  E++  ++ L ++H   E L++ RKELA     FA++ + L   E++  L+RAL+QL+  +E+I  + + QA  +F+ L ELL DY+ ++  V+   ++R++ ++ WQ+A++ L KKRE +AR   + K DK+     EI E  ++V +   DFE+IS  ++ E+  F+  K  DFK  +IK LE ++ SQ+++   WE ++P+   IS
Sbjct:  145 LTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKE-ELPRAVGTQTLSGAGLLKMFNKATDAVSKMTIKMNESD----IWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFKNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS 522          
BLAST of Sorting nexin-2 vs. Ensembl Human
Match: SNX1 (sorting nexin 1 [Source:HGNC Symbol;Acc:HGNC:11172])

HSP 1 Score: 286.574 bits (732), Expect = 1.668e-90
Identity = 159/372 (42.74%), Postives = 243/372 (65.32%), Query Frame = 3
Query:  300 GSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            G GM AY  YK+ T+T+ P F  ++  V+RRFSDFLGL+E+L  K+   G I+PP PEK+  G TK+K+ KED +++EFLE+RRAALERYLQRI  HP ++ D D REFLE + ELP+AV TQ LSGA + K+F    DAV K+T KM++ D    +WF++K  E++  ++ L ++H   E L++ RKELA     FA++ + L   E++  L+RAL+QL+  +E+I  + + QA  +F+ L ELL DY+ ++  V+   ++R++ ++ WQ+A++ L KKRE +AR   + K DK+     EI E  ++V +   DFE+IS  ++ E+  F+  K  DFK  +IK LE ++ SQ+++   WE ++P+   IS
Sbjct:   91 GDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKE-ELPRAVGTQTLSGAGLLKMFNKATDAVSKMTIKMNESD----IWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFKNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS 457          
BLAST of Sorting nexin-2 vs. Ensembl Human
Match: SNX1 (sorting nexin 1 [Source:HGNC Symbol;Acc:HGNC:11172])

HSP 1 Score: 281.567 bits (719), Expect = 2.089e-87
Identity = 158/371 (42.59%), Postives = 243/371 (65.50%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQ 1379
            + + ++ PEK+G GM AY  YK+ T+T+ P F  ++  V+RRFSDFLGL+E+L  K+   G I+PP PEK+  G TK+K+ KED +++EFLE+RRAALERYLQRI  HP ++ D D REFLE + ELP+AV TQ LSGA + K+F    DAV K+T KM++ D    +WF++K  E++  ++ L ++H   E L++ RKELA     FA++ + L   E++  L+RAL+QL+  +E+I  + + QA  +F+ L ELL DY+ ++  V+   ++R++ ++ WQ+A++ L KKRE +AR   + K DK+     EI E  ++V +   DFE+IS  ++ E+  F+  K  DFK  +IK LE ++ SQ++   Q
Sbjct:  145 LTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKE-ELPRAVGTQTLSGAGLLKMFNKATDAVSKMTIKMNESD----IWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRWQDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIRFEKEKSKDFKNHVIKYLETLLYSQQQAGEQ 510          
BLAST of Sorting nexin-2 vs. Ensembl Celegans
Match: snx-1 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9GYJ9])

HSP 1 Score: 213.386 bits (542), Expect = 8.006e-63
Identity = 132/377 (35.01%), Postives = 221/377 (58.62%), Query Frame = 3
Query:  291 EKLGSGMAAYFIYKINTK-TNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEIS--GKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGI 1412
            EK G GM AY +YK+ T+ +    +  Q     RRFSDFLGLH ++  KYL  G +IP  PEK+    TK K + +   + E   +R   LERY+ R+ +HP +  D D R+FL  + +LPKAV T  LS   +KK+FKN      K+   M++ D+    WF+  Q ++D LD  L +++   E L++ R+++A+  +   +  S L+  EE   L+RAL+ L+   E +SA+  +QAEV+     E + +Y+ +I A+K+V  ER+R ++ WQ+A+  L +KR+QK + ++S  G+ ++      EI++ + K+D+  + F ++SK I+ E+  FD  +  D K+ +++ +E+MI +  E++H WEK+ P+   I
Sbjct:   98 EKRGDGMNAYIVYKLETEVSGVVGYTKQHYETWRRFSDFLGLHGKIVEKYLAKGIVIPQPPEKSISALTKTKTNSDPAMSREVGIQRARQLERYICRLIQHPRMRNDCDVRDFLTIESDLPKAVQTAALSSFGVKKIFKNFQVVFSKMAFHMEEGDR----WFEQVQSQVDELDEALRKLYTVTETLVASRRDMATSGEQLGKALSMLAACEESTSLSRALSSLTDVTENVSAVYGKQAEVDNSKFSESIYEYIMLISALKDVFGERVRAWQQWQDAQQTLARKRDQKTKIDLSAGGRNERSDQLKGEIEDTVQKMDQLEQHFIELSKAIREEVARFDADRKQDMKKMLVEYMESMIHTHTELLHLWEKFEPEANNI 470          
BLAST of Sorting nexin-2 vs. Ensembl Celegans
Match: snx-1 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9GYJ9])

HSP 1 Score: 213.386 bits (542), Expect = 8.006e-63
Identity = 132/377 (35.01%), Postives = 221/377 (58.62%), Query Frame = 3
Query:  291 EKLGSGMAAYFIYKINTK-TNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEIS--GKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGI 1412
            EK G GM AY +YK+ T+ +    +  Q     RRFSDFLGLH ++  KYL  G +IP  PEK+    TK K + +   + E   +R   LERY+ R+ +HP +  D D R+FL  + +LPKAV T  LS   +KK+FKN      K+   M++ D+    WF+  Q ++D LD  L +++   E L++ R+++A+  +   +  S L+  EE   L+RAL+ L+   E +SA+  +QAEV+     E + +Y+ +I A+K+V  ER+R ++ WQ+A+  L +KR+QK + ++S  G+ ++      EI++ + K+D+  + F ++SK I+ E+  FD  +  D K+ +++ +E+MI +  E++H WEK+ P+   I
Sbjct:   98 EKRGDGMNAYIVYKLETEVSGVVGYTKQHYETWRRFSDFLGLHGKIVEKYLAKGIVIPQPPEKSISALTKTKTNSDPAMSREVGIQRARQLERYICRLIQHPRMRNDCDVRDFLTIESDLPKAVQTAALSSFGVKKIFKNFQVVFSKMAFHMEEGDR----WFEQVQSQVDELDEALRKLYTVTETLVASRRDMATSGEQLGKALSMLAACEESTSLSRALSSLTDVTENVSAVYGKQAEVDNSKFSESIYEYIMLISALKDVFGERVRAWQQWQDAQQTLARKRDQKTKIDLSAGGRNERSDQLKGEIEDTVQKMDQLEQHFIELSKAIREEVARFDADRKQDMKKMLVEYMESMIHTHTELLHLWEKFEPEANNI 470          
BLAST of Sorting nexin-2 vs. Ensembl Celegans
Match: snx-6 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8])

HSP 1 Score: 85.8853 bits (211), Expect = 1.227e-17
Identity = 97/362 (26.80%), Postives = 159/362 (43.92%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK-----EDQTNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDI-LWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMI 1352
            Y ++T+T R   +  E  V R   +FL LH  L+    +AG IIPPAP K  F +++ KL K        T  EFL+ +    + Y              LQRIA HP+   D +FR FL+ + EL        + G N K+  ++      +   ++    QKD+  +F+ ++  M   + H+ +     E LI+ RK + +       +  +++  E +  LAR  AQ + A  ++  +E R +  E   L + L  +     A K++L  R+R    ++ A  NL + R          K  +IP  + E  E   K       FE+I+   K EL+   T +V  FK+ +  + E  I
Sbjct:  120 YTVHTRT-RLQEMKPETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELS-------VRGKNKKEQVESFWKRFTQSADEVLLSGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNKSLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERAR---------AKNREIPKAEAEQSEACKK-------FEEITGLSKNELKELKTRRVQAFKKNLTDLAELEI 457          
BLAST of Sorting nexin-2 vs. Ensembl Celegans
Match: snx-6 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8])

HSP 1 Score: 85.8853 bits (211), Expect = 1.227e-17
Identity = 97/362 (26.80%), Postives = 159/362 (43.92%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK-----EDQTNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDI-LWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMI 1352
            Y ++T+T R   +  E  V R   +FL LH  L+    +AG IIPPAP K  F +++ KL K        T  EFL+ +    + Y              LQRIA HP+   D +FR FL+ + EL        + G N K+  ++      +   ++    QKD+  +F+ ++  M   + H+ +     E LI+ RK + +       +  +++  E +  LAR  AQ + A  ++  +E R +  E   L + L  +     A K++L  R+R    ++ A  NL + R          K  +IP  + E  E   K       FE+I+   K EL+   T +V  FK+ +  + E  I
Sbjct:  120 YTVHTRT-RLQEMKPETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELS-------VRGKNKKEQVESFWKRFTQSADEVLLSGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNKSLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERAR---------AKNREIPKAEAEQSEACKK-------FEEITGLSKNELKELKTRRVQAFKKNLTDLAELEI 457          
BLAST of Sorting nexin-2 vs. Ensembl Celegans
Match: snx-6 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8])

HSP 1 Score: 85.1149 bits (209), Expect = 1.416e-17
Identity = 97/361 (26.87%), Postives = 156/361 (43.21%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK-----EDQTNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMI 1352
            Y ++T+T R   +  E  V R   +FL LH  L+    +AG IIPPAP K  F +++ KL K        T  EFL+ +    + Y              LQRIA HP+   D +FR FL+ + EL      +     +  K F    D V  + +   D D+    +F+ ++  M   + H+ +     E LI+ RK + +       +  +++  E +  LAR  AQ + A  ++  +E R +  E   L + L  +     A K++L  R+R    ++ A  NL + R          K  +IP  + E  E   K       FE+I+   K EL+   T +V  FK+ +  + E  I
Sbjct:   23 YTVHTRT-RLQEMKPETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELSVRGKNKKEQVESFWKRFTQSADEV--LLSGQKDVDE----FFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNKSLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERAR---------AKNREIPKAEAEQSEACKK-------FEEITGLSKNELKELKTRRVQAFKKNLTDLAELEI 360          
BLAST of Sorting nexin-2 vs. Ensembl Fly
Match: Snx1 (gene:FBgn0031534 transcript:FBtr0077517)

HSP 1 Score: 322.783 bits (826), Expect = 1.025e-104
Identity = 180/418 (43.06%), Postives = 265/418 (63.40%), Query Frame = 3
Query:  168 TITRNASPPRTSVTEISN--DRVPNQRKISKTGK-FIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQ-----TNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIP 1397
            T+ RN S    S    S+  D  P Q  ++  G  FI I VS P+K+G GM +Y  YK+ TKTN P F   E +  RRFSDFLG+H+ L  KY+  G IIPPAP KN  G+TK+K+S +          E++E RRAALER++ R A+HP+L +D DF  FLE D+ELP++VNT  LSGA + +LF  VG+ V KIT KMD+ D     WFDDK  E+++LD +L ++H + + L++ R+EL+    + A++ + LS  EEH GL+RAL+ L+  +E+I  +   QA  +F+ L E +KDYLG+ GA+K + +ER++ ++ WQ A+  L+K+RE + R E++ + DK+     E+ E   KV R ++ F+ IS  IK E+E F+ T+V DFK  IIK +E  ++ Q++I+  WE + P
Sbjct:   39 TLDRNESDLFVSALSPSSIGDIHPLQEVLTDDGDYFISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRLGRIIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPVLRVDLDFMNFLESDQELPRSVNTSALSGAGVIRLFNKVGETVNKITYKMDENDP----WFDDKITEVESLDANLQKLHNAMKSLVTSRRELSLLTGLVAKSAAMLSTCEEHTGLSRALSNLADVEEKIELLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQNWQYAQMQLSKRRENRGRFELANRADKLDQAQQEVDEWQGKVQRCQQQFDDISAEIKREMERFELTRVKDFKVNIIKYIEDQMAHQQQIVSYWEAFAP 452          
BLAST of Sorting nexin-2 vs. Ensembl Fly
Match: Snx1 (gene:FBgn0031534 transcript:FBtr0343238)

HSP 1 Score: 318.931 bits (816), Expect = 3.043e-103
Identity = 180/418 (43.06%), Postives = 265/418 (63.40%), Query Frame = 3
Query:  168 TITRNASPPRTSVTEISN--DRVPNQRKISKTGK-FIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQ-----TNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIP 1397
            T+ RN S    S    S+  D  P Q  ++  G  FI I VS P+K+G GM +Y  YK+ TKTN P F   E +  RRFSDFLG+H+ L  KY+  G IIPPAP KN  G+TK+K+S +          E++E RRAALER++ R A+HP+L +D DF  FLE D+ELP++VNT  LSGA + +LF  VG+ V KIT KMD+ D     WFDDK  E+++LD +L ++H + + L++ R+EL+    + A++ + LS  EEH GL+RAL+ L+  +E+I  +   QA  +F+ L E +KDYLG+ GA+K + +ER++ ++ WQ A+  L+K+RE + R E++ + DK+     E+ E   KV R ++ F+ IS  IK E+E F+ T+V DFK  IIK +E  ++ Q++I+  WE + P
Sbjct:   39 TLDRNESDLFVSALSPSSIGDIHPLQEVLTDDGDYFISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRLGRIIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPVLRVDLDFMNFLESDQELPRSVNTSALSGAGVIRLFNKVGETVNKITYKMDENDP----WFDDKITEVESLDANLQKLHNAMKSLVTSRRELSLLTGLVAKSAAMLSTCEEHTGLSRALSNLADVEEKIELLRSEQANSDFFILAEFIKDYLGLFGAIKCIFHERVKAFQNWQYAQMQLSKRRENRGRFELANRADKLDQAQQEVDE--GKVQRCQQQFDDISAEIKREMERFELTRVKDFKVNIIKYIEDQMAHQQQIVSYWEAFAP 450          
BLAST of Sorting nexin-2 vs. Ensembl Fly
Match: Snx6 (gene:FBgn0032005 transcript:FBtr0306170)

HSP 1 Score: 79.337 bits (194), Expect = 1.964e-15
Identity = 92/375 (24.53%), Postives = 163/375 (43.47%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK-----EDQTNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKEL-PKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKY 1391
            + ++T+T  P F  ++  V R+  +F+ LH+R++    +AG IIPP P +  F  ++ KL +      + T  EF + +      Y              L+R+A HP+  +D   + FLE D++L  K      + G  +K L K   + +   T +    D  D  +F+++   +     HL +     E +  + K++    +  +   +QLS  E+ N +   +A+ +   E I  +E R A  +   L + L+ Y     A K +L  R+R    ++ A  NL K R +          +K     LE++E         E FE +S   K EL  F   +V  FK+ ++++      S+ EI H   +Y
Sbjct:   90 FTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVR----DVND--FFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKGN-VETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKARSK----------NKDVHAPLEVQEAETAQAEACEKFESMSACGKEELIGFRNRRVAAFKKSLVEL------SELEIKHAKTQY 441          
BLAST of Sorting nexin-2 vs. Ensembl Fly
Match: Snx6 (gene:FBgn0032005 transcript:FBtr0079631)

HSP 1 Score: 75.485 bits (184), Expect = 3.030e-14
Identity = 92/375 (24.53%), Postives = 161/375 (42.93%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK-----EDQTNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKEL-PKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKY 1391
            + ++T+T  P F  ++  V R+  +F+ LH+R++    +AG IIPP P +  F  ++ KL +      + T  EF + +      Y              L+R+A HP+  +D   + FLE D++L  K      + G  +K L K   + +   T +    D  D  +F+++   +     HL +     E +  + K++    +  +   +QLS  E+ N +   +A+ +   E I  +E R A  +   L + L+ Y     A K +L  R+R    ++ A  NL K R        S   D   A   + + C        E FE +S   K EL  F   +V  FK+ ++++      S+ EI H   +Y
Sbjct:   90 FTVHTRTTLPGFSKKDNNVVRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEAEYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMAIFGGFVKSLGKTTDEILLSATVR----DVND--FFENELQFLTEYHGHLREAALRTEKMTQRHKDVGDSHQKISNALTQLSTTEKGN-VETFVAKTAEIFERIKNLETRVASDQDLKLGDTLRYYQRDSDAAKALLIRRLRCLAAYEAANRNLEKAR--------SKNKDVHAAETAQAEAC--------EKFESMSACGKEELIGFRNRRVAAFKKSLVEL------SELEIKHAKTQY 435          
BLAST of Sorting nexin-2 vs. Ensembl Fly
Match: Snx3 (gene:FBgn0038065 transcript:FBtr0082641)

HSP 1 Score: 48.9062 bits (115), Expect = 1.535e-6
Identity = 39/112 (34.82%), Postives = 58/112 (51.79%), Query Frame = 3
Query:  264 FIEISVSYP-EKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPL 596
            F+EI V  P   + +G   Y  Y++  +TN P F  +E +VRRR+SDF  L   L+     +  ++PP P K A+         E   +  F+E RR  LE ++ +IA HPL
Sbjct:   32 FLEIDVVNPLTTMAAGKKRYTDYEVRMRTNLPVFKVKESSVRRRYSDFEWLRNELERD---SKIVVPPLPGK-AWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPL 139          
BLAST of Sorting nexin-2 vs. Ensembl Zebrafish
Match: snx1a (sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-3])

HSP 1 Score: 310.071 bits (793), Expect = 2.357e-97
Identity = 168/383 (43.86%), Postives = 255/383 (66.58%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            + +S++ PEK+G GM AY +YK++T+T+   F  +  TVRRRFSDFLGL+E+L  K+   G I+PP PEK+  G TK+K+ KED +++EF+ERRRAALERYLQR+  HP L+ D D REFLE + ELP+AV+TQ LSGA   K+     DAV K+T KM++ D    +WFD+K  +++N ++ L ++H   E L++ RKEL+     FA++ + L   E++  L+RAL+QL+  ++ I  +   QA  +F+T  ELL DY+ ++GAV+   ++R++ ++ WQ+AES L KKRE +A+   + K DK+     EI E   KV +   DFE+IS T++ ++  FD  K  DFK  IIK LE+++ SQ+++I  WE ++P+   I+
Sbjct:  282 LNVSITNPEKVGDGMNAYMVYKVSTQTSLSMFRSKTFTVRRRFSDFLGLYEKLSEKHSQNGYIVPPPPEKSIMGMTKVKVGKEDPSSAEFVERRRAALERYLQRVVSHPSLLQDPDVREFLEKE-ELPRAVSTQTLSGAGFLKMLNKATDAVSKMTIKMNEQD----VWFDEKIQDVENEEQLLRKLHVMVESLVNHRKELSGNTAAFAKSVAMLGSSEDNTALSRALSQLAEVEDRIEQLHRDQAANDFFTFAELLADYIRLLGAVRGCFDQRMKAWQRWQDAESMLQKKREAEAKLLWANKPDKLQQAKDEIAEWEAKVTQYERDFERISATVQKDVIRFDKEKARDFKRQIIKYLESLLHSQQQLIKYWEAFLPEAKAIA 659          
BLAST of Sorting nexin-2 vs. Ensembl Zebrafish
Match: snx1b (sorting nexin 1b [Source:ZFIN;Acc:ZDB-GENE-050913-82])

HSP 1 Score: 275.018 bits (702), Expect = 8.713e-86
Identity = 149/348 (42.82%), Postives = 234/348 (67.24%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVI 1310
            + I+V+ PEK+G GM AY  YK++T+T  P F ++  TVRRRFSDFLGL+E++  K    GCIIPPAP+K+  G TK+K+ KED +++EF+E+RRAALERYLQR+  HP L+ D D REFLE D ELP+AVNTQ LSG  + K+     DAV K+T K+++ D     WF+ K  E++N ++ L ++H + + L++ RKEL     VF+++ + L  VEE++ L+RAL+QL+  ++++  + ++QA  +F+ L ELL DY+ ++GAV+    +R++ ++  QEA+  L KKRE +A+   + K +K+     +I E  +KV +   DFE+++ T++ E+  F+   V+
Sbjct:  147 LNIAVTNPEKIGDGMTAYMSYKVSTQTTLPMFANKTFTVRRRFSDFLGLYEKMSAKNSLMGCIIPPAPQKSVVGMTKVKVGKEDSSSAEFVEKRRAALERYLQRVVAHPSLLQDPDVREFLERD-ELPRAVNTQTLSGPGLLKMINRASDAVNKMTIKINESDN----WFESKLQEVENEEQLLRRLHAAVDSLVNHRKELCINTAVFSKSVAMLGSVEENSALSRALSQLAEVEDKMEQLHQQQAFSDFFILAELLADYVRLLGAVRCCFEQRMKVWQRLQEAQITLQKKREAEAKLLWANKPEKLQQAKDDINEWESKVSQYERDFERVTCTVRKEVLRFEVRHVV 489          
BLAST of Sorting nexin-2 vs. Ensembl Zebrafish
Match: snx1b (sorting nexin 1b [Source:ZFIN;Acc:ZDB-GENE-050913-82])

HSP 1 Score: 273.478 bits (698), Expect = 3.156e-85
Identity = 148/343 (43.15%), Postives = 232/343 (67.64%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFD 1295
            + I+V+ PEK+G GM AY  YK++T+T  P F ++  TVRRRFSDFLGL+E++  K    GCIIPPAP+K+  G TK+K+ KED +++EF+E+RRAALERYLQR+  HP L+ D D REFLE D ELP+AVNTQ LSG  + K+     DAV K+T K+++ D     WF+ K  E++N ++ L ++H + + L++ RKEL     VF+++ + L  VEE++ L+RAL+QL+  ++++  + ++QA  +F+ L ELL DY+ ++GAV+    +R++ ++  QEA+  L KKRE +A+   + K +K+     +I E  +KV +   DFE+++ T++ E+  F+
Sbjct:  147 LNIAVTNPEKIGDGMTAYMSYKVSTQTTLPMFANKTFTVRRRFSDFLGLYEKMSAKNSLMGCIIPPAPQKSVVGMTKVKVGKEDSSSAEFVEKRRAALERYLQRVVAHPSLLQDPDVREFLERD-ELPRAVNTQTLSGPGLLKMINRASDAVNKMTIKINESDN----WFESKLQEVENEEQLLRRLHAAVDSLVNHRKELCINTAVFSKSVAMLGSVEENSALSRALSQLAEVEDKMEQLHQQQAFSDFFILAELLADYVRLLGAVRCCFEQRMKVWQRLQEAQITLQKKREAEAKLLWANKPEKLQQAKDDINEWESKVSQYERDFERVTCTVRKEVLRFE 484          
BLAST of Sorting nexin-2 vs. Ensembl Zebrafish
Match: snx2 (sorting nexin 2 [Source:ZFIN;Acc:ZDB-GENE-051120-45])

HSP 1 Score: 209.534 bits (532), Expect = 9.557e-61
Identity = 144/460 (31.30%), Postives = 233/460 (50.65%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLD----EPTITRNASPPRTSVTEIS---------NDRVPNQ---RKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYL-FAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            D +D+F EA E         E+ LD    +P ++   SP  T VT +S          DR P +    + S+    I+ISVS PEK+G GM AY +YK+ TK+    F   E+ V   ++ F G      L+YL  + C++ P  E +    + +    +         +R A +  YL R  +HP L+ D D  +FLE   ELP+AV+TQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD  L ++H S E L+  RK L   +  F      L+   E+  LA+   +            +R     F     +L D   +   ++ V ++R++ +  WQ+A+  L +KRE +A+ + + K DK+     EIKE   KV +   DFE+ISK I+ E+  F+  +V DF+  ++K LE+++ +Q+++I  WE ++P+   I+
Sbjct:   62 DTEDLFAEATE---------EVSLDSPERQPILSDGPSPAITPVTPVSIGSRVELGAFDRSPEEDEDEQESRDTLDIQISVSDPEKVGDGMNAYMVYKVTTKSCLSVFSRSEVCVYTDYTIFQGCVCVCYLQYLRVSVCVLSPVFEMSVCVLSPVFEGVQLMNRINIRGKRGADISLYLMRTVKHPALLKDPDVLQFLES-SELPRAVSTQALSGAGILRMVNKAADAVNKMTIKMNEADA----WFEEKQQQFENLDLQLRKLHASVESLVCHRKALCLFLASFVSESGVLNKSFEYTSLAKFCFE-HPNVSAEMETHQRNTMALFLDESVILNDSSQLCVRIRGVFDQRMKTWAKWQDAQVMLQRKREAEAKLQYANKPDKLQQAKDEIKEWEGKVQQGERDFEQISKNIRREVGRFEKDRVKDFRIVVVKYLESLVHTQQQLIKYWEAFLPEAKAIA 506          
BLAST of Sorting nexin-2 vs. Ensembl Zebrafish
Match: snx5 (sorting nexin 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2857])

HSP 1 Score: 80.4925 bits (197), Expect = 7.420e-16
Identity = 85/362 (23.48%), Postives = 160/362 (44.20%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK-----EDQTNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKELP-KAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMI 1352
            + ++TKT   SF   + +V R+  DF+ LH+ +     +AG IIPPAP K  F   + K+ K        T  E+ + ++     Y              LQR++ HP    D +F  FLE D++L  +  N + + G   K + K   + +     ++D+       +F+ ++  + +    +       E +    K +A      +   + ++  + ++   + L +     E++  +E+R A  +   L ELL+ Y   I A K++L  R R    ++ +   L+K R       + GK   +P  +   K+CL K DR       +S++ K EL +F   +V+ F++ +I++ E  I
Sbjct:   42 FTVHTKTTLSSFQKPDFSVPRQHEDFIWLHDAIVETEEYAGLIIPPAPPKPDFEGPREKMHKLGEGESSMTKEEYAKMKQELEAEYLAVFKKTVQVHEVFLQRLSSHPSFSKDRNFHIFLEYDQDLSVRRKNAKEMFGGFFKNMVKTADEVLISGVKEVDE-------FFEQEKTFLLDYSNKIKDSTAKAEKMTRSHKNVADDYNHISGALNSVA-ADNNSAFKKHLEKCVEVFEKLRKVEDRVASDQELKLTELLRYYTRDIQAAKDLLYRRARALADYENSNKALDKAR-------LKGK--DVPQAEENQKQCLQKFDR-------LSESGKKELTSFKARRVVAFRKNLIEMTELEI 379          
BLAST of Sorting nexin-2 vs. Ensembl Xenopus
Match: SNX2 (sorting nexin 2 [Source:NCBI gene;Acc:100492702])

HSP 1 Score: 337.806 bits (865), Expect = 1.554e-109
Identity = 196/466 (42.06%), Postives = 288/466 (61.80%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLDEP----TITRNASPPRTSVTEISNDRVPNQRKISKTGKFI-------------------EISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            D +D+F EA +         E+ LD P     ++   SP  T VT  S   +P    IS +   I                   EI VS PEK+G GM AY  YK+ TKT+   F   E +VRRRFSDFLGLH +L  KY+  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AV+TQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H + E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V ++R++ ++ WQ+A+ NL KK+E +A+ +IS K DK+     EI+E   KV +   DF++ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   69 DREDLFAEATD---------EVSLDSPERDLILSSEPSPAITPVTPTSL-IMPRMETISISAPVIYDRSTDEIEEEANGDAFDVEIGVSDPEKVGDGMNAYMAYKVTTKTSLSMFNKNEFSVRRRFSDFLGLHSKLATKYMHIGYIVPPAPEKSIVGMTKVKVGKEDSSSNEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLES-SELPRAVSTQALSGAGLLRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHGNVESLVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQDQAFADFYLFTELLSDYIRLIAAVKGVFDQRMKCWQKWQDAQVNLQKKQEAEAKLQISNKPDKLQQAKDEIREWEAKVQQGERDFDQISKTIRKEVGRFEKERVRDFKSVIIKYLESLVRTQQQLIKYWEAFLPEAKAIA 519          
BLAST of Sorting nexin-2 vs. Ensembl Xenopus
Match: SNX2 (sorting nexin 2 [Source:NCBI gene;Acc:100492702])

HSP 1 Score: 326.635 bits (836), Expect = 3.307e-105
Identity = 196/470 (41.70%), Postives = 288/470 (61.28%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLDEP----TITRNASPPRTSVTEISNDRVPNQRKISKTGKFI-------------------EISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIP----AFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            D +D+F EA +         E+ LD P     ++   SP  T VT  S   +P    IS +   I                   EI VS PEK+G GM AY  YK+ TKT+   F   E +VRRRFSDFLGLH +L  KY+  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AV+TQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H + E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V ++R++ ++ WQ+A+ NL KK+E +A+ +IS K DK+         EI+E   KV +   DF++ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   69 DREDLFAEATD---------EVSLDSPERDLILSSEPSPAITPVTPTSL-IMPRMETISISAPVIYDRSTDEIEEEANGDAFDVEIGVSDPEKVGDGMNAYMAYKVTTKTSLSMFNKNEFSVRRRFSDFLGLHSKLATKYMHIGYIVPPAPEKSIVGMTKVKVGKEDSSSNEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLE-SSELPRAVSTQALSGAGLLRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHGNVESLVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQDQAFADFYLFTELLSDYIRLIAAVKGVFDQRMKCWQKWQDAQVNLQKKQEAEAKLQISNKPDKLQQAKDEIREEIEEWEAKVQQGERDFDQISKTIRKEVGRFEKERVRDFKSVIIKYLESLVRTQQQLIKYWEAFLPEAKAIA 523          
BLAST of Sorting nexin-2 vs. Ensembl Xenopus
Match: SNX2 (sorting nexin 2 [Source:NCBI gene;Acc:100492702])

HSP 1 Score: 322.783 bits (826), Expect = 9.764e-104
Identity = 191/450 (42.44%), Postives = 278/450 (61.78%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLDEP----TITRNASPPRTSVTEISNDRVPNQRKISKTGKFI-------------------EISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEE 1367
            D +D+F EA +         E+ LD P     ++   SP  T VT  S   +P    IS +   I                   EI VS PEK+G GM AY  YK+ TKT+   F   E +VRRRFSDFLGLH +L  KY+  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AV+TQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H + E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V ++R++ ++ WQ+A+ NL KK+E +A+ +IS K DK+     EI+E   KV +   DF++ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q++
Sbjct:   69 DREDLFAEATD---------EVSLDSPERDLILSSEPSPAITPVTPTSL-IMPRMETISISAPVIYDRSTDEIEEEANGDAFDVEIGVSDPEKVGDGMNAYMAYKVTTKTSLSMFNKNEFSVRRRFSDFLGLHSKLATKYMHIGYIVPPAPEKSIVGMTKVKVGKEDSSSNEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLES-SELPRAVSTQALSGAGLLRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHGNVESLVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQDQAFADFYLFTELLSDYIRLIAAVKGVFDQRMKCWQKWQDAQVNLQKKQEAEAKLQISNKPDKLQQAKDEIREWEAKVQQGERDFDQISKTIRKEVGRFEKERVRDFKSVIIKYLESLVRTQQQ 503          
BLAST of Sorting nexin-2 vs. Ensembl Xenopus
Match: SNX2 (sorting nexin 2 [Source:NCBI gene;Acc:100492702])

HSP 1 Score: 312.383 bits (799), Expect = 5.340e-100
Identity = 186/435 (42.76%), Postives = 273/435 (62.76%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLDEP----TITRNASPPRTSVTEISNDRVP----NQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEE 1367
            D +D+F EA +         E+ LD P     ++   SP  T VT  S   VP    N ++   T  F+         LG GM AY  YK+ TKT+   F   E +VRRRFSDFLGLH +L  KY+  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AV+TQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H + E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V ++R++ ++ WQ+A+ NL KK+E +A+ +IS K DK+     EI+E   KV +   DF++ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q++
Sbjct:   69 DREDLFAEATD---------EVSLDSPERDLILSSEPSPAITPVTPTSLIIVPLGVYNIKQYILTFCFL--------FLGDGMNAYMAYKVTTKTSLSMFNKNEFSVRRRFSDFLGLHSKLATKYMHIGYIVPPAPEKSIVGMTKVKVGKEDSSSNEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVSTQALSGAGLLRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHGNVESLVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQDQAFADFYLFTELLSDYIRLIAAVKGVFDQRMKCWQKWQDAQVNLQKKQEAEAKLQISNKPDKLQQAKDEIREWEAKVQQGERDFDQISKTIRKEVGRFEKERVRDFKSVIIKYLESLVRTQQQ 481          
BLAST of Sorting nexin-2 vs. Ensembl Xenopus
Match: SNX2 (sorting nexin 2 [Source:NCBI gene;Acc:100492702])

HSP 1 Score: 306.99 bits (785), Expect = 4.096e-99
Identity = 166/357 (46.50%), Postives = 244/357 (68.35%), Query Frame = 3
Query:  297 LGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEE 1367
            LG GM AY  YK+ TKT+   F   E +VRRRFSDFLGLH +L  KY+  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AV+TQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H + E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V ++R++ ++ WQ+A+ NL KK+E +A+ +IS K DK+     EI+E   KV +   DF++ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q++
Sbjct:   38 LGDGMNAYMAYKVTTKTSLSMFNKNEFSVRRRFSDFLGLHSKLATKYMHIGYIVPPAPEKSIVGMTKVKVGKEDSSSNEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVSTQALSGAGLLRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHGNVESLVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQDQAFADFYLFTELLSDYIRLIAAVKGVFDQRMKCWQKWQDAQVNLQKKQEAEAKLQISNKPDKLQQAKDEIREWEAKVQQGERDFDQISKTIRKEVGRFEKERVRDFKSVIIKYLESLVRTQQQ 389          
BLAST of Sorting nexin-2 vs. Ensembl Mouse
Match: Snx2 (sorting nexin 2 [Source:MGI Symbol;Acc:MGI:1915054])

HSP 1 Score: 338.576 bits (867), Expect = 6.377e-110
Identity = 199/472 (42.16%), Postives = 289/472 (61.23%), Query Frame = 3
Query:   72 VSTMTDDD--DIFEEAMENTDEFGVQTEIRLDEP----TITRNASPPRTSVTEIS----------------NDRVPNQRKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            V  + DDD  D+F EA E         E+ LD P     ++   SP  T VT  +                 DR  ++ +    G    IEI VS PEK+G GM AY  Y++ TKT+   F   E +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H S E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ ++ W++A+  L KKRE +A+  ++ K DKI     EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   62 VEVVLDDDREDLFAEATE---------EVSLDSPERELILSSEPSPAVTPVTPTTLIAPRIESKSISAPVIFDRSRDEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKAVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA 519          
BLAST of Sorting nexin-2 vs. Ensembl Mouse
Match: Snx1 (sorting nexin 1 [Source:MGI Symbol;Acc:MGI:1928395])

HSP 1 Score: 299.671 bits (766), Expect = 8.066e-95
Identity = 161/383 (42.04%), Postives = 252/383 (65.80%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            + + ++ PEK+G GM AY  YK+ T+T+ P F  ++  V+RRFSDFLGL+E+L  K+   G I+PP PEK+  G TK+K+ KED +++EFLE+RRAALERYLQRI  HP ++ D D REFLE + ELP+AV TQ LSGA + K+F    DAV K+T KM++ D    +WF++K  E++  ++ L ++H   E L++ RKELA    +FA++ + L   E++  L+RAL+QL+  +E+I  + + QA  +F+ L ELL DY+ ++  V+   ++R++ ++ WQ+A++ L KKRE +AR   + K DK+     EI E  ++V +   DFE+IS  ++ E+  F+  K  DFK  ++K LE ++ SQ+++   WE ++P+   IS
Sbjct:  144 LTVGITDPEKIGDGMNAYVAYKVTTQTSLPMFRSRQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKE-ELPRAVGTQALSGAGLLKMFNKATDAVSKMTIKMNESD----IWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTALFAKSLAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRWQDAQATLQKKRESEARLLWANKPDKLQQAKDEITEWESRVTQYERDFERISTVVRKEVTRFEKEKSKDFKNHVMKYLETLLHSQQQLAKYWEAFLPEAKAIS 521          
BLAST of Sorting nexin-2 vs. Ensembl Mouse
Match: Snx1 (sorting nexin 1 [Source:MGI Symbol;Acc:MGI:1928395])

HSP 1 Score: 98.5969 bits (244), Expect = 2.396e-23
Identity = 43/90 (47.78%), Postives = 64/90 (71.11%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEF 536
            + + ++ PEK+G GM AY  YK+ T+T+ P F  ++  V+RRFSDFLGL+E+L  K+   G I+PP PEK+  G TK+K+ KED +++EF
Sbjct:   96 LTVGITDPEKIGDGMNAYVAYKVTTQTSLPMFRSRQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEF 185          
BLAST of Sorting nexin-2 vs. Ensembl Mouse
Match: Snx5 (sorting nexin 5 [Source:MGI Symbol;Acc:MGI:1916428])

HSP 1 Score: 82.0333 bits (201), Expect = 2.627e-16
Identity = 88/362 (24.31%), Postives = 163/362 (45.03%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQ-----TNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKELP-KAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMI 1352
            + ++TKT   +F   E +V R+  DF+ LH+ L     +AG IIPPAP K  F   + K+ K  +     T  EF + ++     Y              LQR++ HP+L  D +F  FLE D++L  +  NT+ + G   K + K+  + +     ++DD       +F+ ++  + N    +       + +    K +A    +    C     +EE   + + L +++   E++  +E R +  E   L ELL+ Y+  I A K++L  R +    ++ +   L+K R +    +++         +   +EC  K       FE++S++ K EL  F   +V  F++ +I++ E  I
Sbjct:   47 FTVHTKTTLSTFQSPEFSVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFSGVKEVDD-------FFEQEKNFLINYYNRIKDSCAKADKMTRSHKNVADDY-IHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLA---------ETHQQECCQK-------FEQLSESAKEELINFKRKRVAAFRKNLIEMSELEI 384          
BLAST of Sorting nexin-2 vs. Ensembl Mouse
Match: Snx5 (sorting nexin 5 [Source:MGI Symbol;Acc:MGI:1916428])

HSP 1 Score: 82.0333 bits (201), Expect = 2.627e-16
Identity = 88/362 (24.31%), Postives = 163/362 (45.03%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQ-----TNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKELP-KAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMI 1352
            + ++TKT   +F   E +V R+  DF+ LH+ L     +AG IIPPAP K  F   + K+ K  +     T  EF + ++     Y              LQR++ HP+L  D +F  FLE D++L  +  NT+ + G   K + K+  + +     ++DD       +F+ ++  + N    +       + +    K +A    +    C     +EE   + + L +++   E++  +E R +  E   L ELL+ Y+  I A K++L  R +    ++ +   L+K R +    +++         +   +EC  K       FE++S++ K EL  F   +V  F++ +I++ E  I
Sbjct:   47 FTVHTKTTLSTFQSPEFSVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSTHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFSGVKEVDD-------FFEQEKNFLINYYNRIKDSCAKADKMTRSHKNVADDY-IHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLA---------ETHQQECCQK-------FEQLSESAKEELINFKRKRVAAFRKNLIEMSELEI 384          
BLAST of Sorting nexin-2 vs. UniProt/SwissProt
Match: sp|Q9CWK8|SNX2_MOUSE (Sorting nexin-2 OS=Mus musculus OX=10090 GN=Snx2 PE=1 SV=2)

HSP 1 Score: 338.576 bits (867), Expect = 4.460e-109
Identity = 199/472 (42.16%), Postives = 289/472 (61.23%), Query Frame = 3
Query:   72 VSTMTDDD--DIFEEAMENTDEFGVQTEIRLDEP----TITRNASPPRTSVTEIS----------------NDRVPNQRKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            V  + DDD  D+F EA E         E+ LD P     ++   SP  T VT  +                 DR  ++ +    G    IEI VS PEK+G GM AY  Y++ TKT+   F   E +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H S E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ ++ W++A+  L KKRE +A+  ++ K DKI     EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   62 VEVVLDDDREDLFAEATE---------EVSLDSPERELILSSEPSPAVTPVTPTTLIAPRIESKSISAPVIFDRSRDEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKAVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA 519          
BLAST of Sorting nexin-2 vs. UniProt/SwissProt
Match: sp|O60749|SNX2_HUMAN (Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2)

HSP 1 Score: 337.806 bits (865), Expect = 9.672e-109
Identity = 197/465 (42.37%), Postives = 286/465 (61.51%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLD----EPTITRNASPPRTSVTEIS----------------NDRVPNQRKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            D +D+F EA E         E+ LD    EP ++   SP  T VT  +                 DR   + +    G    IEI VS PEK+G GM AY  Y++ TKT+   F   E +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H S E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ ++ W++A+  L KKRE +A+  ++ K DKI     EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   69 DREDLFAEATE---------EVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA 519          
BLAST of Sorting nexin-2 vs. UniProt/SwissProt
Match: sp|Q5R9A9|SNX2_PONAB (Sorting nexin-2 OS=Pongo abelii OX=9601 GN=SNX2 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 1.058e-104
Identity = 197/469 (42.00%), Postives = 286/469 (60.98%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLD----EPTITRNASPPRTSVTEIS----------------NDRVPNQRKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIP----AFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            D +D+F EA E         E+ LD    EP ++   SP  T VT  +                 DR   + +    G    IEI VS PEK+G GM AY  Y++ TKT+   F   E +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H S E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ ++ W++A+  L KKRE +A+  ++ K DKI         EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   69 DREDLFAEATE---------EVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVANKPDKIQQAKNEIREEIEEWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA 523          
BLAST of Sorting nexin-2 vs. UniProt/SwissProt
Match: sp|P0C220|SNX2_MACFA (Sorting nexin-2 OS=Macaca fascicularis OX=9541 GN=SNX2 PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 1.153e-104
Identity = 197/469 (42.00%), Postives = 286/469 (60.98%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLD----EPTITRNASPPRTSVTEIS----------------NDRVPNQRKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIP----AFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            D +D+F EA E         E+ LD    EP ++   SP  T VT  +                 DR   + +    G    IEI VS PEK+G GM AY  Y++ TKT+   F   E +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +NLD+ L ++H S E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ ++ W++A+  L KKRE +A+  ++ K DKI         EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   69 DREDLFAEATE---------EVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDAQITLLKKREAEAKMMVANKPDKIQQAKNEIREEIEEWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA 523          
BLAST of Sorting nexin-2 vs. UniProt/SwissProt
Match: sp|Q2TBW7|SNX2_BOVIN (Sorting nexin-2 OS=Bos taurus OX=9913 GN=SNX2 PE=2 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 1.479e-104
Identity = 196/465 (42.15%), Postives = 286/465 (61.51%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLD----EPTITRNASPPRTSVTEIS----------------NDRVPNQRKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            D +D+F EA E         E+ LD    EP ++   SP  T VT  +                 DR  ++ +    G    IEI VS PEK+G GM AY  Y++ TKT+   F   E +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RRAALERYLQR  +HP L+ D D R+FLE   ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ + +N D+ L ++H S E L+  RKEL++    FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ ++ W++A+  L KKRE +A+  ++ K DKI     EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  IIK LE+++ +Q+++I  WE ++P+   I+
Sbjct:   69 DREDLFAEATE---------EVSLDSPEREPILSSETSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSRDEIEEEANGDVFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSVKRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALERYLQRTVKHPTLLQDPDLRQFLESS-ELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMNESDA----WFEEKQQQFENQDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRVKCWQKWEDAQITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA 519          
BLAST of Sorting nexin-2 vs. TrEMBL
Match: A0A1S3K472 (sorting nexin-2 OS=Lingula unguis OX=7574 GN=LOC106178690 PE=4 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 1.155e-123
Identity = 196/383 (51.17%), Postives = 276/383 (72.06%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            +EISV  P K G GM++Y +Y +NTKT  P+F   + +V RRFSDFLGLH++L  K+L  G I+PPAPEK+  G TK+K+SKEDQ +SEF+E+RRAALERYL R A HP+L +D DFREFLE + +LPKA NT  LSGA + +LF  VGDAVGKIT KMD+ DQ    WF++KQ ++++LD HL ++H S E L+  RK+L+     FA++ + L++ EEH  L+RA++QL+  +E+I  + E QA+ +FY   ELLKDY+ +IGAVK+V N+R++ Y+ W+EAES LNKKRE K + E++ K DKIP    EI+E   KV++ +EDFEKIS+ I+ E+  FD  +V DFK  II  LE ++++Q+++I  WE ++P+   I+
Sbjct:  150 LEISVGNPHKKGDGMSSYMVYDVNTKTTIPAFQKSDFSVTRRFSDFLGLHDKLTEKHLMLGRIVPPAPEKSVIGMTKIKMSKEDQGSSEFVEKRRAALERYLNRTAAHPVLRMDPDFREFLELNGDLPKATNTSALSGAGVMRLFNKVGDAVGKITFKMDETDQ----WFEEKQQQVESLDTHLRKLHGSVEALVVHRKDLSQMTGSFAKSAAMLANAEEHTALSRAISQLAEIEEKIEQLHEDQADTDFYVFAELLKDYVTLIGAVKDVFNQRVKVYKAWKEAESMLNKKREAKVKLELAHKSDKIPQAQSEIEEWEGKVEKGQEDFEKISENIRKEVARFDKKRVRDFKITIINYLETLMNNQQQLIKYWETFLPEAKAIA 528          
BLAST of Sorting nexin-2 vs. TrEMBL
Match: A0A023FLQ8 (Putative membrane coat complex retromer subunit vps5/snx1 sorting nexin (Fragment) OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 2.441e-123
Identity = 194/435 (44.60%), Postives = 293/435 (67.36%), Query Frame = 3
Query:  135 GVQTEIRLDEPTITRNASPPRTSVTEISND-------RVPNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSE-FXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            G + E++   P      +PPR + T  S D       +   Q+K S+  +F+EISV  P+K+G GMAAY  Y++ T+TN P F   + +V RRFSDFLGLHE+L  K+L  G I+PPAPEK+  G TK+K+SK++Q  SE F+ERRRAALER+LQR A HP L +D DFREFLE + ELP+A NT  LSGA M +L   +GD+V KITTKMD+ D     WF++KQ ++DNLD  L ++H S E+++ QR+EL+     FA++ + L + EEH GL+RAL++L+   E +  ++ RQA  +FY L EL+KDYL ++GA+K+V ++R++ Y+ WQ A+  L +KRE KA+ E++ K DKIP    E+ E   KV+R +E+F+ +S+ I+TE++ F+  ++ DF+  +++  E ++ +Q+++I  WE ++P+   I+
Sbjct:   48 GAEDEVQRSNP----EPNPPRQATTLFSPDVSTLKPAKEKEQQKASEGEEFVEISVREPQKVGEGMAAYVTYRVVTRTNAPYFRKTQFSVNRRFSDFLGLHEKLVEKHLHMGRIVPPAPEKSVLGMTKIKMSKDEQVTSEDFVERRRAALERFLQRTAAHPSLKVDPDFREFLEQEAELPRATNTSSLSGAGMFRLISRMGDSVSKITTKMDEADP----WFEEKQQQIDNLDMQLKRLHASVENMVQQRRELSQSTGAFAKSAAMLGNCEEHTGLSRALSKLAEVGERVEQLQGRQANHDFYCLAELVKDYLALVGAIKDVFHQRVKVYQTWQHAQQMLARKREAKAKLELAAKSDKIPQARQEVLEWEAKVERGQEEFDNVSRVIRTEMDRFELNRITDFRNSVVRYFEFLLDTQQQLIKYWETFLPEAKAIA 474          
BLAST of Sorting nexin-2 vs. TrEMBL
Match: A0A131XK28 (Putative sorting nexin OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 2.877e-122
Identity = 195/434 (44.93%), Postives = 293/434 (67.51%), Query Frame = 3
Query:  147 EIRLDEPTITRN---ASPPRTSVTEISND-------RVPNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSE-FXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            E R  E  + RN    +PPR + T  S D       +   Q+K S+  +F+EISV  P+K+G GMAAY  Y++ T+TN P F   + +V RRFSDFLGLHE+L  K+L  G I+PPAPEK+  G TK+K+SK++Q  SE F+ERRRAALER+LQR A HP L +D DFREFLE + ELP+A NT  LSGA M +L   +GD+V KITTKMD+ D     WF++KQ ++DNLD  L ++H S E+++ QR+EL+     FA++ + L + EEH GL+RAL++L+   E +  ++ RQA  +FY L EL+KDYL ++GA+K+V ++R++ Y+ WQ A+  L +KRE KA+ E++ K +KIP    E+ E   KV+R +E+F+ +S+ I+TE++ F+  ++ DF+  +++  E ++ +Q+++I  WE ++P+   I+
Sbjct:   69 EFRATEDEVQRNNPEPNPPRQATTLFSPDASTLKPAKEKEQQKASEGEEFVEISVREPQKVGEGMAAYVTYRVVTRTNAPYFRKTQFSVNRRFSDFLGLHEKLVEKHLHMGRIVPPAPEKSVLGMTKIKMSKDEQVTSEDFVERRRAALERFLQRTAAHPSLRVDPDFREFLEQESELPRATNTSSLSGAGMFRLISRMGDSVSKITTKMDEADP----WFEEKQQQIDNLDIQLKRLHASVENMVQQRRELSQSTGAFAKSAAMLGNCEEHTGLSRALSKLAEVGERVEQLQGRQANHDFYCLAELVKDYLSLVGAIKDVFHQRVKVYQTWQHAQQMLARKREAKAKLELAAKSEKIPQARQEVLEWEAKVERGQEEFDNVSRVIRTEMDRFELNRIADFRNSVVRYFEFLLDTQQQLIKYWETFLPEAKAIA 498          
BLAST of Sorting nexin-2 vs. TrEMBL
Match: A0A023FZP4 (Putative membrane coat complex retromer subunit vps5/snx1 sorting nexin (Fragment) OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.237e-121
Identity = 193/435 (44.37%), Postives = 292/435 (67.13%), Query Frame = 3
Query:  135 GVQTEIRLDEPTITRNASPPRTSVTEISND-------RVPNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSE-FXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            G + E++   P      + PR + T  S D       +   Q+K S+  +F+EISV  P+K+G GMAAY  Y++ T+TN P F   + +V RRFSDFLGLHE+L  K+L  G I+PPAPEK+  G TK+K+SK++Q  SE F+ERRRAALER+LQR A HP L +D DFREFLE + ELP+A NT  LSGA M +L   +GD+V KITTKMD+ D     WF++KQ ++DNLD  L ++H S E+++ QR+EL+     FA++ + L + EEH GL+RAL++L+   E +  ++ RQA  +FY L EL+KDYL ++GA+K+V ++R++ Y+ WQ A+  L +KRE KA+ E++ K DKIP    E+ E   KV+R +E+F+ +S+ I+TE++ F+  ++ DF+  +++  E ++ +Q+++I  WE ++P+   I+
Sbjct:   48 GAEDEVQRSNP----EPNSPRQATTLFSPDVSTLKPAKEKEQQKASEGEEFVEISVREPQKVGEGMAAYVTYRVVTRTNAPYFRKTQFSVNRRFSDFLGLHEKLVEKHLHMGRIVPPAPEKSVLGMTKIKMSKDEQVTSEDFVERRRAALERFLQRTAAHPSLKVDPDFREFLEQEAELPRATNTSSLSGAGMFRLISRMGDSVSKITTKMDEADP----WFEEKQQQIDNLDIQLKRLHASVENMVQQRRELSQSTGAFAKSAAMLGNCEEHTGLSRALSKLAEVGERVEQLQGRQANHDFYCLAELVKDYLALVGAIKDVFHQRVKVYQTWQHAQQMLARKREAKAKLELAAKSDKIPQARQEVLEWEAKVERGQEEFDNVSRVIRTEMDRFELNRITDFRNSVVRYFEFLLDTQQQLIKYWETFLPEAKAIA 474          
BLAST of Sorting nexin-2 vs. TrEMBL
Match: A0A131YSX6 (Sorting nexin-1/2 OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 1.410e-121
Identity = 194/434 (44.70%), Postives = 293/434 (67.51%), Query Frame = 3
Query:  147 EIRLDEPTITRN---ASPPRTSVTEISND-------RVPNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSE-FXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            E R  E  + R+    +PPR   T  S D       +   Q+K S+  +F+EISV  P+K+G GMAAY  Y++ T+TN P +   + +V RRFSDFLGLHE+L  K+L  G I+PPAPEK+  G TK+K+SK++Q  SE F+ERRRAALER+LQR A HP L +D DFREFLE + ELP+A NT  LSGA M +L   +GD+V KITTKMD+ D     WF++KQ ++DNLD  L ++H S E+++ QR+EL+     FA++ + L + EEH GL+RAL++L+   E +  ++ RQA  +FY L EL+KDYL ++GA+K+V ++R++ Y+ WQ A+  L +KRE KA+ E++ K +KIP    E+ E   KV+R +E+F+ +S+ I+TE++ F+ T++ DF+  +++  E ++ +Q+++I  WE ++P+   I+
Sbjct:   68 EFRATEDEVQRSNPEPNPPRQPTTLFSPDVSTLKPIKEKEQQKASEGEEFVEISVREPQKVGEGMAAYVTYRVVTRTNAPYYRKTQFSVNRRFSDFLGLHEKLVEKHLHMGRIVPPAPEKSVLGMTKIKMSKDEQVTSEDFVERRRAALERFLQRTAAHPSLRVDPDFREFLEQEAELPRATNTSSLSGAGMFRLISRMGDSVSKITTKMDEADP----WFEEKQQQIDNLDIQLKRLHASVENMVQQRRELSQSTGAFAKSAAMLGNCEEHTGLSRALSKLAEVGERVEQLQGRQANHDFYCLAELVKDYLSLVGAIKDVFHQRVKVYQTWQHAQQMLARKREAKAKLELAAKSEKIPQARQEVLEWEAKVERGQEEFDNVSRVIRTEMDRFELTRIADFRNSVVRYFEFLLDTQQQLIKYWETFLPEAKAIA 497          
BLAST of Sorting nexin-2 vs. Ensembl Cavefish
Match: snx1b (sorting nexin-1-like [Source:NCBI gene;Acc:103044300])

HSP 1 Score: 310.842 bits (795), Expect = 2.747e-99
Identity = 162/382 (42.41%), Postives = 256/382 (67.02%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGI 1412
            + I+V+ PEK+G GM AY  YK++T+T  P+F  +  +VRRRFSDFLGL+E+L +K+   GCIIPP P+K+  G TK+K+ KED +++EF+E+RRAALERYLQR+  HP L+ D+D +EFLE + ELP+AVNTQ LSG+   K+     DAV K+T KM++ D     WF+ K  E++N ++ L ++H S + L++ RKE+     +FA++ + L   EE++ L+RAL+QL+  ++++  + + QA  +F+ L ELL DY+ ++GAV+    +R++ ++ WQEA++ L KKRE +A+   + K DK+     ++ E   KV +   DFE+IS T++ E+  F+  K  DFK  I+K LE+++ SQ  ++  WE ++P+   I
Sbjct:  148 LNIAVTNPEKMGDGMNAYMTYKVSTQTTLPAFHIKTFSVRRRFSDFLGLYEKLSVKHHLMGCIIPPPPQKSVVGMTKVKVGKEDPSSAEFVEKRRAALERYLQRVVAHPALLQDSDVQEFLERE-ELPRAVNTQALSGSGFLKMINKASDAVNKMTIKMNESDN----WFESKLQEVENEEQLLRRLHASVDSLVNHRKEMCINTAMFAKSVAMLGSSEENSALSRALSQLAEVEDKLEQLHQEQAFSDFFILTELLADYVRLLGAVRGCFEQRMKAWQRWQEAQATLQKKREAEAKLLWANKPDKLQQAKEDLTEWEAKVGQCERDFERISSTLRKEVHRFEKEKCRDFKHHIVKYLESLLRSQHRVVKCWEAFLPEAKAI 524          
BLAST of Sorting nexin-2 vs. Ensembl Cavefish
Match: snx2 (sorting nexin 2 [Source:ZFIN;Acc:ZDB-GENE-051120-45])

HSP 1 Score: 307.375 bits (786), Expect = 3.292e-98
Identity = 187/445 (42.02%), Postives = 272/445 (61.12%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLD----EPTITRNASPPRTSVTEI----------SNDRVPNQ-RKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEI 1370
            D +D+F EA E         E+ LD    EP ++   SP  T VT              DR P++  +  + G    ++I VS PEK+G GM AY  YK+ TKT+   F   E TV+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RR+ALERYL R   HP L+ D D  +FLE   ELP+AV+TQ LSGA + ++     +AV K+T KM++ D     WF++KQ + +NLD  L ++H S E L+  RKEL+     FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ +  WQ+A+  L +KRE +A+ + + K DK+     EIKE   KV +   DFE+ISK I+ E+  F+  +V DFK  IIK LE+++ +Q+++
Sbjct:   70 DQEDLFAEATE---------EVSLDSPEREPILSDGPSPAITPVTPTVIITPRVDASMFDRSPDEDEEAEENGDTFDLQIMVSDPEKVGDGMNAYMAYKVTTKTSLNLFNRNEFTVKRRFSDFLGLHSKLASKYLHIGYIVPPAPEKSIVGMTKVKVGKEDLSSAEFVEKRRSALERYLMRTVNHPALLKDPDVIQFLES-TELPRAVSTQALSGAGILRMVNKAAEAVNKMTIKMNESDA----WFEEKQQQFENLDVQLRKLHASVESLVCHRKELSVNTASFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAYADFYLFSELLGDYVRLITAVKGVFDHRMKTWSKWQDAQVMLQRKREAEAKLQYANKPDKLQQAKEEIKEWEAKVQQGERDFEQISKNIRREVGRFEKQRVKDFKVVIIKYLESLVHTQQQV 500          
BLAST of Sorting nexin-2 vs. Ensembl Cavefish
Match: snx1b (sorting nexin-1-like [Source:NCBI gene;Acc:103044300])

HSP 1 Score: 296.59 bits (758), Expect = 5.510e-94
Identity = 163/392 (41.58%), Postives = 254/392 (64.80%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIR----------QYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGI 1412
            + I+V+ PEK+G GM AY  YK++T+T  P+F  +  +VRRRFSDFLGL+E+L +K+   GCIIPP P+K+  G TK+K+ KED +++EF+E+RRAALERYLQR+  HP L+ D+D +EFLE + ELP+AVNTQ LSG+   K+     DAV K+T KM++ D     WF+ K  E++N ++ L ++H S + L++ RKE+     +FA++ + L   EE++ L+RAL+QL+  ++++  + + QA  +F+ L ELL DY+ ++GAV+ V N               ++ WQEA++ L KKRE +A+   + K DK+     ++ E   KV +   DFE+IS T++ E+  F+  K  DFK  I+K LE+++ SQ  ++  WE ++P+   I
Sbjct:  121 LNIAVTNPEKMGDGMNAYMTYKVSTQTTLPAFHIKTFSVRRRFSDFLGLYEKLSVKHHLMGCIIPPPPQKSVVGMTKVKVGKEDPSSAEFVEKRRAALERYLQRVVAHPALLQDSDVQEFLERE-ELPRAVNTQALSGSGFLKMINKASDAVNKMTIKMNESDN----WFESKLQEVENEEQLLRRLHASVDSLVNHRKEMCINTAMFAKSVAMLGSSEENSALSRALSQLAEVEDKLEQLHQEQAFSDFFILTELLADYVRLLGAVR-VRNSLFYGTLLKYTFCCSWQRWQEAQATLQKKREAEAKLLWANKPDKLQQAKEDLTEWEAKVGQCERDFERISSTLRKEVHRFEKEKCRDFKHHIVKYLESLLRSQHRVVKCWEAFLPEAKAI 506          
BLAST of Sorting nexin-2 vs. Ensembl Cavefish
Match: snx2 (sorting nexin 2 [Source:ZFIN;Acc:ZDB-GENE-051120-45])

HSP 1 Score: 293.508 bits (750), Expect = 1.042e-92
Identity = 186/449 (41.43%), Postives = 272/449 (60.58%), Query Frame = 3
Query:   87 DDDDIFEEAMENTDEFGVQTEIRLD----EPTITRNASPPRTSVTEI----------SNDRVPNQ-RKISKTGKF--IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKI----PAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEI 1370
            D +D+F EA E         E+ LD    EP ++   SP  T VT              DR P++  +  + G    ++I VS PEK+G GM AY  YK+ TKT+   F   E TV+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KED +++EF+E+RR+ALERYL R   HP L+ D D  +FLE   ELP+AV+TQ LSGA + ++     +AV K+T KM++ D     WF++KQ + +NLD  L ++H S E L+  RKEL+     FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V + R++ +  WQ+A+  L +KRE +A+ + + K DK+         EI+E   KV +   DFE+ISK I+ E+  F+  +V DFK  IIK LE+++ +Q+++
Sbjct:   70 DQEDLFAEATE---------EVSLDSPEREPILSDGPSPAITPVTPTVIITPRVDASMFDRSPDEDEEAEENGDTFDLQIMVSDPEKVGDGMNAYMAYKVTTKTSLNLFNRNEFTVKRRFSDFLGLHSKLASKYLHIGYIVPPAPEKSIVGMTKVKVGKEDLSSAEFVEKRRSALERYLMRTVNHPALLKDPDVIQFLE-STELPRAVSTQALSGAGILRMVNKAAEAVNKMTIKMNESDA----WFEEKQQQFENLDVQLRKLHASVESLVCHRKELSVNTASFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQEQAYADFYLFSELLGDYVRLITAVKGVFDHRMKTWSKWQDAQVMLQRKREAEAKLQYANKPDKLQQAKEEIKEEIEEWEAKVQQGERDFEQISKNIRREVGRFEKQRVKDFKVVIIKYLESLVHTQQQV 504          
BLAST of Sorting nexin-2 vs. Ensembl Cavefish
Match: snx1a (sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-3])

HSP 1 Score: 273.092 bits (697), Expect = 2.039e-83
Identity = 155/383 (40.47%), Postives = 244/383 (63.71%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            + ISV+ PEK+G        +     T    F  ++  VRRRFSDFLGL+E+L  K+   G I+PP PEK+  G TK+K+ KED +++EF+ERRRAALERYLQR+  HP L+ D D REFLE + ELP+AV TQ LSGA   K+     DAV K+T KM++ D    +WF++K  E+++ D+ L ++H   + L+  RKEL+    +FA++ + L   E++  L+RAL+QL+  ++ I  + + QA  +F+   ELL DY+ ++GAV+   ++R++ ++ WQ+A++ L KKRE +A+   + K DK+     EI E   KV +   DFE++S T++ E+  ++  K  DFK+ II+ LE+++ SQ+++I  WE ++P+   I+
Sbjct:  278 LNISVTNPEKVGK-------FTPTPITTLSMFRSKQFVVRRRFSDFLGLYEKLSEKHAQNGYIVPPPPEKSILGMTKVKVGKEDPSSAEFVERRRAALERYLQRVVCHPSLLQDPDVREFLEKE-ELPRAVGTQALSGAGFLKMINKATDAVSKMTIKMNESD----VWFEEKLQEVESEDQQLRKLHAMVDSLVIHRKELSMNTAMFAKSVAMLGSSEDNTALSRALSQLAEVEDRIEQLHQDQASNDFFIFAELLADYIRLLGAVRACFDQRMKAWQRWQDAQNMLQKKRETEAKLLWANKPDKLQQAKDEIVEWEAKVSQYERDFERVSATVRKEVIRYEKEKTRDFKKQIIRYLESLLQSQQQLIKYWEAFLPEAKAIA 648          
BLAST of Sorting nexin-2 vs. Ensembl Sea Lamprey
Match: snx1a (sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-3])

HSP 1 Score: 326.25 bits (835), Expect = 1.159e-105
Identity = 166/383 (43.34%), Postives = 267/383 (69.71%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            + I+++ PEK+G GM AY  Y + T T+ P F  +E TV+RRFSDFLGL+E+L  K+  +G I+PPAPEK+  G TK+K+ K+D ++ EF+ERRRAALERYLQR ++HP L+ D DFR+FLE D ELP+AVNTQ LSGA + ++     DAV K+T KM++ D     WF++KQ+E +NL+  L ++H +FE L++ RKE++     FA++ + L + E++  L+RAL+QL+  +E+I A+ + QA  + Y   ELL DY+ ++ +++ V ++R + ++ WQ+A++NL+KKRE +A+ + + K DK+     EI+E   KV +   +FE +SKTI+ E+  F+  +V DFK GI++ +E++I++++++I  WE ++P+   I+
Sbjct:  169 LRITITNPEKVGDGMNAYMAYNVTTTTSLPMFKRKEFTVKRRFSDFLGLYEKLTEKFSHSGFIVPPAPEKSVLGMTKVKVGKDDPSSVEFVERRRAALERYLQRTSKHPTLMQDPDFRDFLERD-ELPRAVNTQALSGAGILRMVTKAADAVNKMTIKMNESDS----WFEEKQLEFENLETQLRKLHGNFEGLVNHRKEMSLNTAAFAKSAAMLGNSEDNTALSRALSQLAEVEEKIDALHQEQANADLYVFAELLADYIRLLTSIRGVFDQRAKSWQRWQDAQANLHKKRENEAKLQWANKPDKLQQAKDEIREWDAKVQQGESEFEIVSKTIRKEVMRFEKERVRDFKNGIVRYIESLINTEQQLIKYWEAFLPEAKAIA 546          
BLAST of Sorting nexin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000227.1 (pep scaffold:Pmarinus_7.0:GL480786:1217:16989:1 gene:ENSPMAG00000000197.1 transcript:ENSPMAT00000000227.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 6.597e-14
Identity = 84/367 (22.89%), Postives = 155/367 (42.23%), Query Frame = 3
Query:  324 IYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQ-----TNSEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKEL-PKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDD-CDQKDILWFD------DKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLE 1343
            ++ + TKT  P+F + ++ V R+  DF+ LH+       +AG IIPPAP +  F  ++ KL +  Q     T  EF   ++     Y              L R+A HP+L  D++ + FLE   EL  +  N + + G   + + K+  + V      +D+  + + +   D      D   + D + +    I   + H+ +    LA+Q               +   L++    ++   E+   +E R A  +   L +L + Y+    A K++L  R R    ++ A   L++ R +                D+   E   +    R  FEK+S T K EL+ F   +V+ F++G++++ E
Sbjct:   46 LFTVCTKTILPAFKNSKVCVSRQHEDFVWLHDSYVENGTYAGFIIPPAPLRPDFSASRDKLHRLGQSEGTMTKEEFSRMKQEVEAEYLVVFKKTVAMHEGFLVRLATHPVLSQDSNLQVFLEYTHELNVRGKNKKEMLGGFFRNVVKSADELVVSGVEDIDEFMEHEKVFLVDYHLRIKDATTKADKMTKAHKNIAEDYLHISASFTSLATQ---------------DSRNLSKLYLCIADVLEKTRKLEGRAASDQDLKLSDLFRYYMKDSQAAKDLLYRRTRALVDYENANKALDRARTRNK--------------DVAATESQQQTSLQR--FEKLSSTGKQELKDFRCRRVLAFRKGLVELTE 381          
BLAST of Sorting nexin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009855.1 (pep scaffold:Pmarinus_7.0:GL476399:593532:610067:1 gene:ENSPMAG00000008881.1 transcript:ENSPMAT00000009855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 4.261e-12
Identity = 78/362 (21.55%), Postives = 159/362 (43.92%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQ-----TNSEFXXXXXXXXXXYLQ--------------RIARHPLLVIDADFREFLEDDKELP-KAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQ---IKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLE 1343
            + + T T+ P+F   +++V R+  +F+ LH+       + G +IPPAP +  F +++ KL +  +     T  EF + ++     YL               R+A HP+L  D +F  FLE D+EL  +  NT+ + G  +K + K+  +    + +   D D+    +F+ +++ +      + +     + +    K ++     I  +  N  +    +E++ L+R L   S   E+    + R A  +   L +LL+ Y+    A K++L  R R     +     L+K R          K   +   +++ K  ++K       F+ +S + + EL  F   +V  F++ ++++ E
Sbjct:   49 FTVQTTTSLPTFKKGKLSVSRQHEEFIWLHDSYVENEDYGGIVIPPAPPRPDFDSSREKLQRLGEGEATMTKEEFSKMKQELEAEYLAIFKKTVAMHEVFLCRLAAHPILSQDRNFHIFLEYDQELSVRGKNTKEILGGFLKSMMKSADEV---LVSGAKDSDE----FFEHEKIFLLEYHMRVKESALKADKMTRAHKNVSEDYIGISTWLYNIGE----QEYSKLSRFLQLSSDMFEKYRKQQGRVASDQDLKLTDLLRYYVRETQAAKDLLYRRARSLVDAENTGRALDKAR---------AKGKDVQQAEMQQKLAMHK-------FDSLSTSARQELMDFKMRRVAAFRKNLVEMAE 383          
BLAST of Sorting nexin-2 vs. Ensembl Sea Lamprey
Match: snx30 (sorting nexin family member 30 [Source:NCBI gene;Acc:550496])

HSP 1 Score: 61.2326 bits (147), Expect = 1.951e-10
Identity = 41/119 (34.45%), Postives = 58/119 (48.74%), Query Frame = 3
Query:  273 ISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFL 629
            + V  PEK  + M  Y  Y++  +T R  +   E  VRRR+ DF  L  R KL+      IIPP PEK             D+   +F+  R+ AL+++L R+A HP L   + F  FL
Sbjct:   28 VRVDSPEKHVTAMETYITYRVTVRTTRSEYDGMEFVVRRRYQDFDWL--RTKLEETQPTHIIPPLPEKFVMKGVV------DRFTEDFVTTRQKALDKFLNRLANHPTLSFSSYFHSFL 138          
BLAST of Sorting nexin-2 vs. Ensembl Sea Lamprey
Match: snx6 (sorting nexin 6 [Source:ZFIN;Acc:ZDB-GENE-050913-152])

HSP 1 Score: 60.8474 bits (146), Expect = 2.783e-10
Identity = 89/362 (24.59%), Postives = 157/362 (43.37%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQ-----TNSEFXXXXXXXXXXYLQ--------------RIARHPLLVIDADFREFLEDDKELP-KAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMI 1352
            + ++TKT  P F   E +V R+  +F+ LH+  +    +AG IIPPAP +  F  ++ KL K  +     T  EF + ++     YL               R+A HPLL  D +F  FLE D++L  +  N +   G  +K + K   + +   T  +D+       +FD ++  +      +       + +    K +A      +     L   +E   L+R   + +   E+   +E R A  E   L +LL+ Y+    A K++L  R R    ++ A   L+K R +    + +    +I         C +K       FEK+S++ K EL  F T +V+ F++ ++++ E  I
Sbjct:   51 FTVHTKTTLPYFKQGEFSVVRQHEEFIWLHDAYEENEEYAGIIIPPAPPRPDFDASREKLQKLGEGEGTMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRLAAHPLLRKDHNFHVFLEYDQDLSVRGKNKKEKFGGFLKNMVKTADEVLIAGTKDVDE-------FFDHEKTFILEYHGRIKDATMKADKMTRAHKNVAEDYIRISSGVYTLG-TQEPTNLSRIFLKFTELLEKTRKLEGRVASDEDLKLSDLLRYYMKDSQAAKDLLYRRARSLIDYENANKALDKARAKNKDVQQAEAHQQI---------CCHK-------FEKLSESAKHELIDFKTRRVVAFRKNLVEMTEMEI 388          
BLAST of Sorting nexin-2 vs. Ensembl Yeast
Match: VPS5 (Nexin-1 homolog; required for localizing membrane proteins from a prevacuolar/late endosomal compartment back to late Golgi; structural component of retromer membrane coat complex; forms a retromer subcomplex with Vps17p; required for recruiting the retromer complex to the endosome membranes; VPS5 has a paralog, YKR078W, that arose from the whole genome duplication [Source:SGD;Acc:S000005595])

HSP 1 Score: 89.7373 bits (221), Expect = 2.508e-19
Identity = 102/428 (23.83%), Postives = 194/428 (45.33%), Query Frame = 3
Query:  207 TEISNDRVPNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDD---KELPK--------AVN------------TQVLSGANMKKLFKNVG-DAVG---------KITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKY 1391
            T+I +   P ++ ++      ++ V  P K+G   + +  Y + ++++     + +++  RR+ DF  L+ +L+  +   G +IPP PEK + G+ K            F+E RR  +E  L++I + P+L  D DF  FL  D    E  K        A+N             Q+L   +  ++ KN G DA               K ++ D+    +F +K+ ++D L+ +L ++  S E + + R  LA+  + F+     L+ +      +  L   +   + I +  ER +  E  T+  +L DY+  + +VK + N+R +        E+++NKK  Q  +   +   +K      E +    + + T++ ++ +   IK E + F T K+ +F+ G+   LEA I SQ+E I  WE +
Sbjct:  266 TKIGSKVPPTEKAVA-----FKVEVKDPVKVGELTSIHVEYTVISESSLLELKYAQVS--RRYRDFRWLYRQLQNNHW--GKVIPPPPEKQSVGSFK----------ENFIENRRFQMESMLKKICQDPVLQKDKDFLLFLTSDDFSSESKKRAFLTGSGAINDSNDLSEVRISEIQLLGAEDAAEVLKNGGIDAESHKGFMSISFSSLPKYNEADE----FFIEKKQKIDELEDNLKKLSKSLEMVDTSRNTLAASTEEFSSMVETLASLNVSEPNSELLNNFADVHKSIKSSLERSSLQETLTMGVMLDDYIRSLASVKAIFNQRSKLGYFLVVIENDMNKKHSQLGKLGQNIHSEKFREMRKEFQTLERRYNLTKKQWQAVGDKIKDEFQGFSTDKIREFRNGMEISLEAAIESQKECIELWETF 670          
BLAST of Sorting nexin-2 vs. Ensembl Yeast
Match: SNX4 (Sorting nexin; involved in retrieval of late-Golgi SNAREs from post-Golgi endosomes to the trans-Golgi network and in cytoplasm to vacuole transport; contains a PX phosphoinositide-binding domain; forms complexes with Snx41p and with Atg20p [Source:SGD;Acc:S000003573])

HSP 1 Score: 58.5362 bits (140), Expect = 1.258e-9
Identity = 98/413 (23.73%), Postives = 178/413 (43.10%), Query Frame = 3
Query:  264 FIEISVSYPEKL----GSGMAAYFIYKINTKTNRPSFLHQE------ITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFL-EDDKELPKAV-------NTQVLSGANMKKLFKNV-------------GDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLK-------DYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEK 1388
            + EI VS P+K     GS  + Y  Y+I+TKTN  SF          I V RR+SD L LH+ L  +  F  CIIPP P+K  F     +    D+ +  F ++R  +L+ +L+R++ HP L     F+ FL   D E  + V       N   ++ A M   FK V              D + +  TK+D    K +   D    +   L  +L ++    E +  + +ELA+++K+F +  +QLS+          L  L+   +    ++ +  E    ++ +L+K       DY  +   +   + E+      +  +    NK  E     + + + +KI   + +I     +++  ++  +   +    E++ F++ K  + K+ +  + +  I   E I+  WEK
Sbjct:   27 WFEIIVSDPQKRTGDPGSS-SGYVSYQISTKTNNTSFYDNRGDPESIIVVHRRYSDLLLLHDILLNR--FPTCIIPPLPDKKVF-----QYIAGDRFSQRFTQKRCHSLQNFLRRVSLHPDLSQSKVFKTFLVSKDWESHRKVLQDSLQPNKDEVTDAFM-NAFKTVHKQNEEFTEIREKSDKLDRTVTKIDKLFHKVVKKNDSMSEDYTKLGSNLQELQ---ELVTGENEELAAKLKIFNEGVTQLSY---------GLQDLTKYLDYEYIVDLKDLEHYIDSMRQLIKLKDQKQIDYEELSDYLTRSIKEKNNLISGYGGSNFFANKLEELAGINQEASRREKINKLEGKITSLTGELENAKKVADGFEQECLKEIDHFESVKTAEIKKSLGSLADHHIEFYERILEAWEK 418          
BLAST of Sorting nexin-2 vs. Ensembl Nematostella
Match: EDO32102 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW17])

HSP 1 Score: 353.984 bits (907), Expect = 3.777e-118
Identity = 182/383 (47.52%), Postives = 263/383 (68.67%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            +EI V+ PEK+G GM A+  Y++ TKT+ P F   E TV+RRFSDFLGLHER+  KYL  G I+PPAPEK+  G +K+K SKED  +++F+ +RRA LER+L R+A HP L  D DFR+FLE D ELP+A +T  LSG  +K+L K++GD +  +TTKM + DQ    WF++KQ +++ LD+ L ++H + E L+  RKEL+     FA++ + LS+ EEH  L+RAL QL+  +E+I A+   Q+E +F+   ELLKDY+G+I +VK    ER+R Y VWQ A+  L KKRE   + E++GK +K+P    E+KE   KV++ +EDFE ISK I+ E+  F+  +V DF+  IIK LEAM+ +Q+++I QWE ++P+   I+
Sbjct:   14 MEIKVTDPEKVGDGMNAFMSYRVITKTSMPEFNSPETTVKRRFSDFLGLHERINAKYLHLGRIVPPAPEKSVIGMSKVKFSKEDSNSTDFIGKRRAVLERFLNRVAAHPELRKDPDFRQFLEAD-ELPRAKDTAALSGGGLKRLVKSMGDTMFSLTTKMSESDQ----WFEEKQQQIETLDQQLKKLHHNVEILVMHRKELSISTASFAKSAAMLSNAEEHTSLSRALTQLAEVEEKIEALHVEQSETDFFVFSELLKDYIGLISSVKACFQERVRAYSVWQHAQQTLTKKREALVKTELAGKNEKLPQAQEEVKEWEQKVEKGQEDFEAISKMIRKEMVRFENNRVKDFRAAIIKYLEAMMDTQQQLIKQWEGFLPEAKAIA 391          
BLAST of Sorting nexin-2 vs. Ensembl Nematostella
Match: EDO46895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNQ3])

HSP 1 Score: 68.1662 bits (165), Expect = 2.234e-12
Identity = 51/130 (39.23%), Postives = 70/130 (53.85%), Query Frame = 3
Query:  243 KISKTG-KFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFL 629
            K+S T  K + I V  PEK   G   Y  Y + TKT R  F H E +VRRR+ DFL L +R++  Y     IIPP PEK++F          D+ + EFL+ R  AL +++ RIA HP++  +     FL
Sbjct:   18 KMSATHVKDLFIRVDDPEKHVGG---YVSYNVITKTTRNQFDHPEYSVRRRYQDFLWLRQRMQESY--PTHIIPPLPEKHSFTK------HFDRFSPEFLKARELALNKFMTRIADHPVMSFNDHLHVFL 136          
BLAST of Sorting nexin-2 vs. Ensembl Nematostella
Match: EDO38324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD93])

HSP 1 Score: 52.373 bits (124), Expect = 4.184e-8
Identity = 41/112 (36.61%), Postives = 57/112 (50.89%), Query Frame = 3
Query:  264 FIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQT-NSEFXXXXXXXXXXYLQRIARHPL 596
            F+EI V  PE  G G   Y  Y++  +TN P F  +E +VRRR+SDF  L   L+     +  ++P  P K       L    +D     EF+E RR  LE ++ R+A HPL
Sbjct:   34 FLEIDVVNPETHGVGKKRYTDYELRMRTNLPVFKQKESSVRRRYSDFEWLRSELERD---SKIVVPALPGKAL--KRMLPFRGDDGIFEDEFIEDRRQGLEAFINRVAGHPL 140          
BLAST of Sorting nexin-2 vs. Ensembl Nematostella
Match: EDO46810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP73])

HSP 1 Score: 48.521 bits (114), Expect = 4.978e-6
Identity = 90/372 (24.19%), Postives = 153/372 (41.13%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK-----EDQTNSEFXXXXXXXXXXYLQ--------------RIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKK----LFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLS----------HVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLE 1343
            + ++TKT  P F   + +V R   +F+ LH+R      +AG IIPPAP K  F  ++ KL K      + T  EF + ++     YL               R+A HP L  D++F+ FLE   EL        + G N K+    LFK +   V ++        QKD+  F       ++  + L + H   +  + +   +    K    NC+ +              E+ GL + L +     E    +E R A  E   +++LL+ Y+    A K +L+ R +    ++ A   L+K R +                + EI E   +     E FE +S+  + EL  F   +V  F++ + +++E
Sbjct:   36 FTVHTKTTLPDFKESDFSVVREHEEFVWLHDRCVENEEYAGIIIPPAPPKPDFDVSREKLQKLGEGEGNMTKEEFQKMKQELEAEYLATFKKTVAMHEVFLTRLASHPSLRKDSNFKVFLEYKAELN-------VRGKNKKEKLGGLFKGLAKGVDEVLL----SGQKDVDEF------FESEKKFLVEYHNKLKDSVRKGDVMTRSHK----NCADVYIKISTGIASMGTSEYTGLDKFLNKTGDYFERARKLEGRVASDEDLKMVDLLRYYMRDTEAAKNLLHRRAKCLAEYENANKALDKARMK----------------NKEIAESAQQ--NASEKFEHMSEIARQELTDFKARRVQQFRKNLTELVE 368          
BLAST of Sorting nexin-2 vs. Ensembl Medaka
Match: snx2 (sorting nexin 2 [Source:NCBI gene;Acc:101172341])

HSP 1 Score: 325.865 bits (834), Expect = 2.817e-105
Identity = 174/383 (45.43%), Postives = 257/383 (67.10%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            I ISVS PEK+G GM AY  YK+ TKT+   F  ++ +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KEDQ+++EF+E+RR+ALERYL R  +HP+L+ D D  +FLE   ELP+AVNTQ LS A + ++     +AV K+T KM++ D     WF++KQ   +NLD  L ++H S E L+  RKEL+     FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V ++R++ ++ WQ+++  L KKRE +A+ + + K DK+     EIKE   KV +   DFE+ISKTI+ E+  F+  +V DFK  I+K LE+++ +Q+++I  WE ++P+   IS
Sbjct:  132 IHISVSDPEKVGDGMNAYMAYKVTTKTSVALFKQRDFSVKRRFSDFLGLHSKLASKYLHIGYIVPPAPEKSIVGMTKVKVGKEDQSSNEFVEKRRSALERYLMRTVKHPILLKDPDVLQFLES-SELPRAVNTQALSSAGILRMVNKAAEAVNKMTIKMNESDA----WFEEKQQHFENLDAQLRKLHASVECLVCHRKELSVNTAQFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQDQANADFYLFSELLGDYVRLITAVKGVFDQRMKTWQKWQDSQMLLQKKREAEAKLQFTNKPDKLQQTKDEIKELEGKVQQGERDFEQISKTIRKEVSRFEKDRVKDFKMSIVKYLESLVQTQQQLIKYWEAFLPEAKAIS 509          
BLAST of Sorting nexin-2 vs. Ensembl Medaka
Match: snx2 (sorting nexin 2 [Source:NCBI gene;Acc:101172341])

HSP 1 Score: 313.153 bits (801), Expect = 2.381e-100
Identity = 173/387 (44.70%), Postives = 257/387 (66.41%), Query Frame = 3
Query:  267 IEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIP----AFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            I ISVS PEK+G GM AY  YK+ TKT+   F  ++ +V+RRFSDFLGLH +L  KYL  G I+PPAPEK+  G TK+K+ KEDQ+++EF+E+RR+ALERYL R  +HP+L+ D D  +FLE   ELP+AVNTQ LS A + ++     +AV K+T KM++ D     WF++KQ   +NLD  L ++H S E L+  RKEL+     FA++ + L + E+H  L+RAL+QL+  +E+I  + + QA  +FY   ELL DY+ +I AVK V ++R++ ++ WQ+++  L KKRE +A+ + + K DK+         EI+E   KV +   DFE+ISKTI+ E+  F+  +V DFK  I+K LE+++ +Q+++I  WE ++P+   IS
Sbjct:  132 IHISVSDPEKVGDGMNAYMAYKVTTKTSVALFKQRDFSVKRRFSDFLGLHSKLASKYLHIGYIVPPAPEKSIVGMTKVKVGKEDQSSNEFVEKRRSALERYLMRTVKHPILLKDPDVLQFLE-SSELPRAVNTQALSSAGILRMVNKAAEAVNKMTIKMNESDA----WFEEKQQHFENLDAQLRKLHASVECLVCHRKELSVNTAQFAKSAAMLGNSEDHTALSRALSQLAEVEEKIDQLHQDQANADFYLFSELLGDYVRLITAVKGVFDQRMKTWQKWQDSQMLLQKKREAEAKLQFTNKPDKLQQTKDEIKEEIEELEGKVQQGERDFEQISKTIRKEVSRFEKDRVKDFKMSIVKYLESLVQTQQQLIKYWEAFLPEAKAIS 513          
BLAST of Sorting nexin-2 vs. Ensembl Medaka
Match: snx1a (sorting nexin-1 [Source:NCBI gene;Acc:101163736])

HSP 1 Score: 285.419 bits (729), Expect = 7.687e-88
Identity = 161/381 (42.26%), Postives = 249/381 (65.35%), Query Frame = 3
Query:  273 ISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIS 1415
            +SV  PEK+G GM AY  YK++T+T  P F ++  TVRRRFSDFLGL+++L  K+   G I+PP PEK+  G TK+K+ KED ++++FLERRR ALERYLQR+  HPLL+ D D REFLE D ELP+AV+TQ LSGA   K+     DAV K+T KM++ D     WF++K  E+++ D+H  ++H   E L+  RKEL+     FA++ + L   E++  L+RAL+QL+  +++I  + + QA  + ++  EL+ DY+ ++GAV+   + RI+ ++ WQ+A++ L KKRE +A+   + K DK+     EI E   +V +   DFE++S T++ E+  F+  +  +FK  I K LE ++ SQ+++I  WE ++P+   I+
Sbjct:  293 VSVKDPEKVGDGMNAYMAYKVSTETTLPMFRNKLFTVRRRFSDFLGLYQKLSEKHGPNGLIVPPPPEKSILGMTKVKVGKEDSSSADFLERRRGALERYLQRVVNHPLLLQDPDVREFLEKD-ELPRAVSTQTLSGAGFLKMINKATDAVSKMTIKMNESD----AWFEEKLQEVESADQHFRKLHALVESLVVHRKELSLNTANFAKSAAMLGSAEDNTALSRALSQLAEVEDKIEQLHQDQAAYDTFSFAELIADYIRLLGAVRGSFDHRIKAWQRWQDAQAMLQKKREMEAKLLWANKPDKLQQAKEEIVEWEARVTQFERDFERVSATVRKEVLRFEKQRTKNFKRQITKYLELLLQSQQQLIKYWEAFLPEAKAIA 668          
BLAST of Sorting nexin-2 vs. Ensembl Medaka
Match: snx1b (sorting nexin 1b [Source:ZFIN;Acc:ZDB-GENE-050913-82])

HSP 1 Score: 213.772 bits (543), Expect = 1.005e-64
Identity = 126/293 (43.00%), Postives = 190/293 (64.85%), Query Frame = 3
Query:  492 TKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEI 1370
            TK+K+  +D ++ EF+ERRRAALERYLQR+  HP LV D D REFLE D +LP+AVNTQ LSGA   K+     DAV K+T KM++ D     WF+DK  E++  ++ L ++H   + L++ RKEL     +FA++ + L + E++  L+RAL+QL+  ++++  + + QA  +F+ L ELL DY+ ++GAV+  L++R+R ++ WQEA+S L KKRE +A+   + K DK+     EI E   KV +   DF++I  T++ E   F+  K  DFK  IIK LEAM+ SQ+ +
Sbjct:    2 TKVKVGMDDPSSVEFVERRRAALERYLQRVVSHPSLVQDPDVREFLEKD-DLPRAVNTQTLSGAGFLKMINRASDAVNKMTIKMNESD----TWFEDKLQEVEAEEQQLRKLHSVVDSLVNHRKELCGNTAIFAKSMAMLGNSEDNTALSRALSQLAEVEDKMEQLHQEQAASDFFILAELLADYIRLLGAVRGCLDQRMRAWQRWQEAQSTLQKKRETEAKLLWANKPDKLQQAKDEITEWETKVTQYERDFDRIGMTVRKEFLRFEKDKAKDFKSQIIKYLEAMMKSQQRV 289          
BLAST of Sorting nexin-2 vs. Ensembl Medaka
Match: snx6 (sorting nexin 6 [Source:NCBI gene;Acc:101159712])

HSP 1 Score: 78.9518 bits (193), Expect = 2.478e-15
Identity = 93/363 (25.62%), Postives = 156/363 (42.98%), Query Frame = 3
Query:  327 YKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQ-----TNSEFXXXXXXXXXXYLQ--------------RIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKK----LFKN-VGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLE 1343
            + ++TK+  P+F   E +V R+  +F+ LH+       +AG IIPPAP +  F  ++ KL K  +     T  EF + ++     YL               R+A HP+L  D +F  FLE +++L        + G N K+     FKN V  A G +   + D D     +F+ ++  +      +       + +I   K  A  +   A +   L   ++   L +   ++S   E+   IE R A  E   L +LLK YL    A K++L  R R    ++ A   L+K R                A + ++ +  N        FEKIS++ K EL  F T +V  F++ ++++ E
Sbjct:   49 FTVHTKSTLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPVLRKDLNFHVFLEYNQDLS-------VRGKNKKEKLEDFFKNVVKSADGVLVAGVKDVDD----FFEHEKTFLLEYHNRVKDSSAKCDRMIRSHKNAADDMNRIASSLYTLG-TQDSTDLCKFFLKVSELFEKTRKIEARVAADEDLKLADLLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKAR----------------AKNRDVMQAENNQQLCCHKFEKISESAKQELIDFKTRRVAAFRKNLVELAE 383          
BLAST of Sorting nexin-2 vs. Planmine SMEST
Match: SMESG000016192.1 (SMESG000016192.1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 441/446 (98.88%), Postives = 442/446 (99.10%), Query Frame = 3
Query:   81 MTDDDDIFEEAMENTDEFGVQTEIRLDEPTITRNASPPRTSVTEISNDRVPNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLXXXXXXXXXXXXRQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIST 1418
            MTDDDDIFEEAMENTDEFGVQTEIRLDEPTITRNASPPRTSVTEISNDRVPNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFLERRRAALERYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQ    WFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLSAAKEEISAIEERQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCE+SGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIST
Sbjct:    1 MTDDDDIFEEAMENTDEFGVQTEIRLDEPTITRNASPPRTSVTEISNDRVPNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFLERRRAALERYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDCDQ----WFDDKQVEMDNLDRHLSQIHCSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLSAAKEEISAIEERQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNLNKKREQKARCELSGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTELEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIST 442          
BLAST of Sorting nexin-2 vs. Planmine SMEST
Match: SMESG000066985.1 (SMESG000066985.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.622e-10
Identity = 47/162 (29.01%), Postives = 79/162 (48.77%), Query Frame = 3
Query:  324 IYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK--EDQTN---SEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDC 752
            ++ ++TKT    F ++E +V+R+  +F+ LH++L+    +AG I PPAP K  F +++ KL K  E + N    +F + +      Y              LQR+A HP+L  D +F  FLE D  L        + G + K+ F      + ++T  MD+ 
Sbjct:   58 VFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIFPPAPPKPDFDDSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLS-------VRGKSRKEKFTGF---IKQVTATMDET 209          
BLAST of Sorting nexin-2 vs. Planmine SMEST
Match: SMESG000066985.1 (SMESG000066985.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.762e-10
Identity = 47/162 (29.01%), Postives = 79/162 (48.77%), Query Frame = 3
Query:  324 IYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSK--EDQTN---SEFXXXXXXXXXXY--------------LQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSGANMKKLFKNVGDAVGKITTKMDDC 752
            ++ ++TKT    F ++E +V+R+  +F+ LH++L+    +AG I PPAP K  F +++ KL K  E + N    +F + +      Y              LQR+A HP+L  D +F  FLE D  L        + G + K+ F      + ++T  MD+ 
Sbjct:   59 VFTVHTKTTLKQFKNKEFSVKRQHEEFVWLHDQLEETEDYAGVIFPPAPPKPDFDDSRDKLMKLSEAENNMPKDQFDKMKAELEAEYLATFKKTVAMHEVFLQRLAAHPILQNDVNFSIFLEYDSNLS-------VRGKSRKEKFTGF---IKQVTATMDET 210          
BLAST of Sorting nexin-2 vs. Planmine SMEST
Match: SMESG000075553.1 (SMESG000075553.1)

HSP 1 Score: 49.2914 bits (116), Expect = 4.984e-6
Identity = 40/114 (35.09%), Postives = 63/114 (55.26%), Query Frame = 3
Query:  291 EKLGSGMAAYFIYKINTKTN-RPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNSEFXXXXXXXXXXYLQRIARHPLLVIDADFREFL 629
            +K  S +  + +Y I T  N RP       +V RR++DF  L +RL  +Y  A  I+PP P+K+        L+  ++ +  F+E RR ALE++LQR+  H +L +D +F  FL
Sbjct:   48 KKASSFLETFIVYTIQTTGNFRP------YSVERRYNDFQWLFQRLSDRYPMA--IVPPLPDKH-------NLTAIERFSGIFIELRRNALEKFLQRLTDHKILSLDKEFWAFL 146          
The following BLAST results are available for this feature:
BLAST of Sorting nexin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX29.980e-11046.48sorting nexin 2 [Source:HGNC Symbol;Acc:HGNC:11173... [more]
SNX22.014e-10942.37sorting nexin 2 [Source:HGNC Symbol;Acc:HGNC:11173... [more]
SNX12.003e-9342.30sorting nexin 1 [Source:HGNC Symbol;Acc:HGNC:11172... [more]
SNX11.668e-9042.74sorting nexin 1 [Source:HGNC Symbol;Acc:HGNC:11172... [more]
SNX12.089e-8742.59sorting nexin 1 [Source:HGNC Symbol;Acc:HGNC:11172... [more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx-18.006e-6335.01Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9GYJ9... [more]
snx-18.006e-6335.01Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9GYJ9... [more]
snx-61.227e-1726.80Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8... [more]
snx-61.227e-1726.80Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8... [more]
snx-61.416e-1726.87Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:D9PTP8... [more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snx11.025e-10443.06gene:FBgn0031534 transcript:FBtr0077517[more]
Snx13.043e-10343.06gene:FBgn0031534 transcript:FBtr0343238[more]
Snx61.964e-1524.53gene:FBgn0032005 transcript:FBtr0306170[more]
Snx63.030e-1424.53gene:FBgn0032005 transcript:FBtr0079631[more]
Snx31.535e-634.82gene:FBgn0038065 transcript:FBtr0082641[more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx1a2.357e-9743.86sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-... [more]
snx1b8.713e-8642.82sorting nexin 1b [Source:ZFIN;Acc:ZDB-GENE-050913-... [more]
snx1b3.156e-8543.15sorting nexin 1b [Source:ZFIN;Acc:ZDB-GENE-050913-... [more]
snx29.557e-6131.30sorting nexin 2 [Source:ZFIN;Acc:ZDB-GENE-051120-4... [more]
snx57.420e-1623.48sorting nexin 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX21.554e-10942.06sorting nexin 2 [Source:NCBI gene;Acc:100492702][more]
SNX23.307e-10541.70sorting nexin 2 [Source:NCBI gene;Acc:100492702][more]
SNX29.764e-10442.44sorting nexin 2 [Source:NCBI gene;Acc:100492702][more]
SNX25.340e-10042.76sorting nexin 2 [Source:NCBI gene;Acc:100492702][more]
SNX24.096e-9946.50sorting nexin 2 [Source:NCBI gene;Acc:100492702][more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snx26.377e-11042.16sorting nexin 2 [Source:MGI Symbol;Acc:MGI:1915054... [more]
Snx18.066e-9542.04sorting nexin 1 [Source:MGI Symbol;Acc:MGI:1928395... [more]
Snx12.396e-2347.78sorting nexin 1 [Source:MGI Symbol;Acc:MGI:1928395... [more]
Snx52.627e-1624.31sorting nexin 5 [Source:MGI Symbol;Acc:MGI:1916428... [more]
Snx52.627e-1624.31sorting nexin 5 [Source:MGI Symbol;Acc:MGI:1916428... [more]
back to top
BLAST of Sorting nexin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CWK8|SNX2_MOUSE4.460e-10942.16Sorting nexin-2 OS=Mus musculus OX=10090 GN=Snx2 P... [more]
sp|O60749|SNX2_HUMAN9.672e-10942.37Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE... [more]
sp|Q5R9A9|SNX2_PONAB1.058e-10442.00Sorting nexin-2 OS=Pongo abelii OX=9601 GN=SNX2 PE... [more]
sp|P0C220|SNX2_MACFA1.153e-10442.00Sorting nexin-2 OS=Macaca fascicularis OX=9541 GN=... [more]
sp|Q2TBW7|SNX2_BOVIN1.479e-10442.15Sorting nexin-2 OS=Bos taurus OX=9913 GN=SNX2 PE=2... [more]
back to top
BLAST of Sorting nexin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K4721.155e-12351.17sorting nexin-2 OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A023FLQ82.441e-12344.60Putative membrane coat complex retromer subunit vp... [more]
A0A131XK282.877e-12244.93Putative sorting nexin OS=Hyalomma excavatum OX=25... [more]
A0A023FZP41.237e-12144.37Putative membrane coat complex retromer subunit vp... [more]
A0A131YSX61.410e-12144.70Sorting nexin-1/2 OS=Rhipicephalus appendiculatus ... [more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx1b2.747e-9942.41sorting nexin-1-like [Source:NCBI gene;Acc:1030443... [more]
snx23.292e-9842.02sorting nexin 2 [Source:ZFIN;Acc:ZDB-GENE-051120-4... [more]
snx1b5.510e-9441.58sorting nexin-1-like [Source:NCBI gene;Acc:1030443... [more]
snx21.042e-9241.43sorting nexin 2 [Source:ZFIN;Acc:ZDB-GENE-051120-4... [more]
snx1a2.039e-8340.47sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-... [more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx1a1.159e-10543.34sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-... [more]
ENSPMAT00000000227.16.597e-1422.89pep scaffold:Pmarinus_7.0:GL480786:1217:16989:1 ge... [more]
ENSPMAT00000009855.14.261e-1221.55pep scaffold:Pmarinus_7.0:GL476399:593532:610067:1... [more]
snx301.951e-1034.45sorting nexin family member 30 [Source:NCBI gene;A... [more]
snx62.783e-1024.59sorting nexin 6 [Source:ZFIN;Acc:ZDB-GENE-050913-1... [more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
VPS52.508e-1923.83Nexin-1 homolog; required for localizing membrane ... [more]
SNX41.258e-923.73Sorting nexin; involved in retrieval of late-Golgi... [more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO321023.777e-11847.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468952.234e-1239.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383244.184e-836.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468104.978e-624.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorting nexin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx22.817e-10545.43sorting nexin 2 [Source:NCBI gene;Acc:101172341][more]
snx22.381e-10044.70sorting nexin 2 [Source:NCBI gene;Acc:101172341][more]
snx1a7.687e-8842.26sorting nexin-1 [Source:NCBI gene;Acc:101163736][more]
snx1b1.005e-6443.00sorting nexin 1b [Source:ZFIN;Acc:ZDB-GENE-050913-... [more]
snx62.478e-1525.62sorting nexin 6 [Source:NCBI gene;Acc:101159712][more]
back to top
BLAST of Sorting nexin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016192.10.000e+098.88SMESG000016192.1[more]
SMESG000066985.11.622e-1029.01SMESG000066985.1[more]
SMESG000066985.11.762e-1029.01SMESG000066985.1[more]
SMESG000075553.14.984e-635.09SMESG000075553.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017841 ID=SMED30017841|Name=Sorting nexin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1629bp
TTTTTTTATTTATTTCAAATTTCGGAAAAAAGTTTTGACTTTAAAGTTTT
ATTTAATAAAATAAAATTATTGTTTCCACAATGACTGATGATGATGATAT
TTTTGAAGAAGCTATGGAAAATACAGATGAATTTGGAGTTCAGACCGAAA
TAAGGTTAGATGAGCCAACTATTACGAGGAATGCATCACCTCCGAGAACC
AGTGTGACTGAAATATCAAATGATAGAGTACCTAACCAAAGAAAAATATC
TAAAACTGGAAAATTCATTGAGATTTCTGTCAGTTACCCAGAAAAACTTG
GATCGGGAATGGCCGCATATTTCATTTATAAAATTAATACTAAAACTAAT
CGGCCTTCATTTCTCCATCAGGAAATCACAGTTCGCCGTAGATTCTCTGA
TTTTCTAGGCTTGCATGAGCGATTGAAATTGAAGTACTTATTTGCCGGCT
GTATCATTCCTCCGGCTCCGGAAAAAAATGCCTTTGGCAATACAAAGTTG
AAGCTGTCGAAGGAAGACCAGACAAACAGCGAATTCCTGGAGAGGCGTCG
AGCTGCACTTGAGCGATATTTACAACGAATTGCTCGTCATCCGTTGCTTG
TTATTGACGCCGATTTCAGGGAGTTCCTGGAGGATGACAAGGAGCTACCG
AAGGCTGTCAACACTCAGGTGCTCTCGGGGGCAAACATGAAGAAACTCTT
CAAAAATGTTGGAGATGCTGTCGGTAAAATCACTACAAAAATGGACGATT
GCGATCAGAAGGACATTTTGTGGTTCGATGACAAACAGGTTGAGATGGAT
AATCTTGATCGCCATCTCAGTCAAATTCACTGCAGTTTCGAACACTTGAT
CAGCCAAAGAAAAGAACTTGCCTCACAGATCAAAGTATTTGCCCAAAACT
GTTCCCAGTTGTCACACGTTGAAGAACACAACGGATTGGCCAGAGCTCTG
GCACAATTGTCAGCTGCCAAAGAAGAAATAAGCGCCATTGAAGAACGCCA
AGCAGAAGTGGAATTTTACACACTTCTCGAACTGTTAAAAGACTATTTGG
GAATGATTGGTGCTGTAAAGGAGGTATTGAACGAGAGGATCCGCCAGTAT
CGAGTCTGGCAGGAAGCGGAATCGAATTTGAATAAGAAACGCGAGCAGAA
AGCGAGATGTGAAATATCGGGGAAGGTCGATAAAATTCCAGCGTTCGATT
TGGAAATCAAGGAGTGCCTCAACAAGGTCGACAGAACGAGAGAAGACTTT
GAAAAAATCTCCAAGACTATCAAAACGGAATTGGAAGCATTCGACACAAC
AAAAGTGATCGATTTCAAGGAAGGAATAATCAAGGTGCTCGAGGCAATGA
TTTCGAGTCAGGAAGAAATTATCCACCAATGGGAGAAATACATTCCCGAC
ACTGCCGGAATATCTACATGAACCCGTTGTTCCAGTTGAATCCAGTACAT
TTGACTATCTATACTACTGATTAATATTTACATTTGTCAGTAGTATAAAT
AGCTTTATTTTTACAAAATATAAGTTGAAATTGAAATATTTATTTGTTTA
TCGATTGATTAATTGATTGGAATTTGAAATTAGTATTGATCGATTTATTA
TTGAGTTTCAATATTTCAATAAATCACTG
back to top

protein sequence of SMED30017841-orf-1

>SMED30017841-orf-1 ID=SMED30017841-orf-1|Name=SMED30017841-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=447bp
MTDDDDIFEEAMENTDEFGVQTEIRLDEPTITRNASPPRTSVTEISNDRV
PNQRKISKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEIT
VRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQTNS
EFLERRRAALERYLQRIARHPLLVIDADFREFLEDDKELPKAVNTQVLSG
ANMKKLFKNVGDAVGKITTKMDDCDQKDILWFDDKQVEMDNLDRHLSQIH
CSFEHLISQRKELASQIKVFAQNCSQLSHVEEHNGLARALAQLSAAKEEI
SAIEERQAEVEFYTLLELLKDYLGMIGAVKEVLNERIRQYRVWQEAESNL
NKKREQKARCEISGKVDKIPAFDLEIKECLNKVDRTREDFEKISKTIKTE
LEAFDTTKVIDFKEGIIKVLEAMISSQEEIIHQWEKYIPDTAGIST*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0006897endocytosis
GO:0042147retrograde transport, endosome to Golgi
Vocabulary: cellular component
TermDefinition
GO:0030904retromer complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036871PX_dom_sf
IPR027267AH/BAR_dom_sf
IPR028660SNX1
IPR039358Sorting_nexin-like
IPR001683Phox
IPR015404Vps5_C
Vocabulary: molecular function
TermDefinition
GO:0035091phosphatidylinositol binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 286..306
IPR001683Phox homologous domainSMARTSM00312PX_2coord: 60..186
e-value: 3.9E-31
score: 119.4
IPR001683Phox homologous domainPFAMPF00787PXcoord: 61..185
e-value: 2.5E-27
score: 95.1
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 61..189
score: 19.952
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 61..186
e-value: 4.0E-41
score: 141.9
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 61..186
IPR015404Sorting nexin Vps5-like, C-terminalPFAMPF09325Vps5coord: 204..439
e-value: 2.4E-67
score: 226.9
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 218..444
e-value: 8.9E-58
score: 197.6
IPR028660Sorting nexin-1PANTHERPTHR10555:SF129SORTING NEXIN-1coord: 52..444
IPR039358Sorting nexin-likePANTHERPTHR10555SORTING NEXINcoord: 52..444