Paired box protein Pax-6

Overview
NamePaired box protein Pax-6
Smed IDSMED30017839
Length (bp)2032
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Paired box protein Pax-6 (SMED30017839) t-SNE clustered cells

Violin plots show distribution of expression levels for Paired box protein Pax-6 (SMED30017839) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Paired box protein Pax-6 (SMED30017839) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Paired box protein Pax-6 (SMED30017839) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017839

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017839SMESG000077501.1 SmedASXL_019743SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30017839SMESG000077501.1 SmedASXL_002494SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30017839SMESG000077501.1 SmedASXL_003306SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30017839SMESG000077501.1 dd_Smed_v6_35892_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30017839SMESG000077501.1 dd_Smed_v6_28804_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30017839SMESG000077501.1 KJ934811smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Paired box protein Pax-6 vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 200.29 bits (508), Expect = 8.639e-58
Identity = 90/113 (79.65%), Postives = 101/113 (89.38%), Query Frame = 2
Query:  287 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            KGHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    4 KGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 116          

HSP 2 Score: 106.301 bits (264), Expect = 2.625e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  206 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 271          
BLAST of Paired box protein Pax-6 vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 197.208 bits (500), Expect = 7.374e-56
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.842 bits (268), Expect = 2.516e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 197.593 bits (501), Expect = 7.417e-56
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 2.713e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 197.208 bits (500), Expect = 8.622e-56
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 2.882e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Human
Match: PAX6 (paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620])

HSP 1 Score: 197.208 bits (500), Expect = 8.622e-56
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 2.882e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Celegans
Match: vab-3 (MAB-18 [Source:UniProtKB/TrEMBL;Acc:G5EE71])

HSP 1 Score: 193.356 bits (490), Expect = 2.339e-54
Identity = 81/112 (72.32%), Postives = 100/112 (89.29%), Query Frame = 2
Query:  290 GHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            GH+G+NQLGG+FVNGRPLPD TRQRI++L+  G RPCDISR+LQVSNGCVSKILCRYYE+G+I+P+AIGGSKPRVAT+ VV K+  YK++ PS+FAWEIRD+LL D +CN +
Sbjct:    5 GHTGVNQLGGVFVNGRPLPDATRQRIVDLAHKGCRPCDISRLLQVSNGCVSKILCRYYESGTIRPRAIGGSKPRVATSDVVEKIEDYKRDQPSIFAWEIRDKLLADNICNNE 116          

HSP 2 Score: 112.849 bits (281), Expect = 3.008e-26
Identity = 54/83 (65.06%), Postives = 66/83 (79.52%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSN 1435
            ++ +K QR+RTSFT  QI  LEKEFERTHYPDVF+RE+L+Q +++ E RIQVWFSNRRAKWRREEK   N  S+G + S LSN
Sbjct:  212 RLKRKLQRNRTSFTQVQIESLEKEFERTHYPDVFARERLAQKIQLPEARIQVWFSNRRAKWRREEKM-RNKRSSGTMDSSLSN 293          
BLAST of Paired box protein Pax-6 vs. Ensembl Celegans
Match: pax-2 (PAX (Paired box) transcription factor [Source:UniProtKB/TrEMBL;Acc:U4PCL3])

HSP 1 Score: 167.548 bits (423), Expect = 8.968e-47
Identity = 77/140 (55.00%), Postives = 104/140 (74.29%), Query Frame = 2
Query:  209 IFRNIVFKMVFSSSSDENMKINRKLRKG-HSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            I+RN  +    +  S  N +++  L  G H+G+NQLGG+FVNGRPLPD  R +I+E+SQ G RPCDISR L+VS+GCVSKIL RYY TGS++P  IGGSKP+VAT  VV  +  YK+ +P+MFAWEIR +L++D +C ++
Sbjct:    4 IWRNYSYS---TYPSHHNFQLDPLLSDGSHTGVNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEE 140          
BLAST of Paired box protein Pax-6 vs. Ensembl Celegans
Match: pax-2 (PAX (Paired box) transcription factor [Source:UniProtKB/TrEMBL;Acc:U4PCL3])

HSP 1 Score: 164.851 bits (416), Expect = 4.826e-45
Identity = 70/111 (63.06%), Postives = 91/111 (81.98%), Query Frame = 2
Query:  293 HSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            H+G+NQLGG+FVNGRPLPD  R +I+E+SQ G RPCDISR L+VS+GCVSKIL RYY TGS++P  IGGSKP+VAT  VV  +  YK+ +P+MFAWEIR +L++D +C ++
Sbjct:   92 HTGVNQLGGVFVNGRPLPDTIRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEE 202          
BLAST of Paired box protein Pax-6 vs. Ensembl Celegans
Match: egl-38 (PAX protein [Source:UniProtKB/TrEMBL;Acc:G5ED14])

HSP 1 Score: 162.54 bits (410), Expect = 5.904e-45
Identity = 75/140 (53.57%), Postives = 101/140 (72.14%), Query Frame = 2
Query:  209 IFRNIVFKMVFSSSSDENMKINRKLRKG-HSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            I+RN  +    +     N + +  L  G H+G+NQLGG+FVNGRPL D  R +I+E+SQ G RPCDISR L+VS+GCVSKIL RYY TGS++P  IGGSKP+VAT  VV  +  YK+ +P+MFAWEIR +L++D +C ++
Sbjct:    4 IWRNYPYP---TYPGHHNFQFDPLLSDGSHTGVNQLGGVFVNGRPLADTVRAQIVEMSQHGTRPCDISRQLKVSHGCVSKILGRYYSTGSVRPGVIGGSKPKVATPRVVECIAGYKRANPTMFAWEIRQKLIEDQICGEE 140          
BLAST of Paired box protein Pax-6 vs. Ensembl Celegans
Match: pax-1 (PAX (Paired box) transcription factor [Source:UniProtKB/TrEMBL;Acc:Q21272])

HSP 1 Score: 139.428 bits (350), Expect = 5.166e-37
Identity = 62/107 (57.94%), Postives = 80/107 (74.77%), Query Frame = 2
Query:  302 INQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQ 622
            +NQLGG+FVNGRPLP   R +I+ELS+ G RPCDISR L++S+GCVSKIL R+ E G+I P  IGGS+PRV T  VV  +   K+  P +FAWEIRDRL+   +C++
Sbjct:   65 VNQLGGVFVNGRPLPFEMRCKIVELSRQGTRPCDISRQLKISHGCVSKILTRFSENGTIMPGTIGGSRPRVTTPKVVEYIRSLKRSDPGIFAWEIRDRLISADICDR 171          
BLAST of Paired box protein Pax-6 vs. Ensembl Fly
Match: toy (gene:FBgn0019650 transcript:FBtr0339509)

HSP 1 Score: 202.216 bits (513), Expect = 7.823e-57
Identity = 90/112 (80.36%), Postives = 101/112 (90.18%), Query Frame = 2
Query:  290 GHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            GHSGINQLGG++VNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSIKP+AIGGSKPRVAT  VV+K+  YK+E PS+FAWEIRDRLL + VCN D
Sbjct:   29 GHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSD 140          

HSP 2 Score: 100.908 bits (250), Expect = 5.304e-22
Identity = 50/90 (55.56%), Postives = 66/90 (73.33%), Query Frame = 2
Query: 1115 NDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            +D  SD NS+  S  ++  S    ++ +K QR+RTSF+N+QI+ LEKEFERTHYPDVF+RE+L+  + + E    VWFSNRRAKWRREEK
Sbjct:  237 HDSTSDGNSEHNSSGDED-SQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPE----VWFSNRRAKWRREEK 321          
BLAST of Paired box protein Pax-6 vs. Ensembl Fly
Match: toy (gene:FBgn0019650 transcript:FBtr0089185)

HSP 1 Score: 202.216 bits (513), Expect = 9.554e-57
Identity = 90/112 (80.36%), Postives = 101/112 (90.18%), Query Frame = 2
Query:  290 GHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            GHSGINQLGG++VNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSIKP+AIGGSKPRVAT  VV+K+  YK+E PS+FAWEIRDRLL + VCN D
Sbjct:   29 GHSGINQLGGVYVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSD 140          

HSP 2 Score: 112.849 bits (281), Expect = 8.302e-26
Identity = 53/90 (58.89%), Postives = 69/90 (76.67%), Query Frame = 2
Query: 1115 NDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            +D  SD NS+  S  ++  S    ++ +K QR+RTSF+N+QI+ LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  237 HDSTSDGNSEHNSSGDED-SQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREEK 325          
BLAST of Paired box protein Pax-6 vs. Ensembl Fly
Match: ey (gene:FBgn0005558 transcript:FBtr0089236)

HSP 1 Score: 201.06 bits (510), Expect = 1.759e-54
Identity = 89/114 (78.07%), Postives = 101/114 (88.60%), Query Frame = 2
Query:  284 RKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
             KGHSG+NQLGG+FV GRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K++ YK+E PS+FAWEIRDRLLQ+ VC  D
Sbjct:   35 HKGHSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTND 148          

HSP 2 Score: 113.62 bits (283), Expect = 1.271e-25
Identity = 56/101 (55.45%), Postives = 71/101 (70.30%), Query Frame = 2
Query: 1082 ETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ETG G G   N    +  N++   +++ R       + +K QR+RTSFTNDQI+ LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  379 ETGSGEGENSNGGASNIGNTE---DDQARL-----ILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 471          
BLAST of Paired box protein Pax-6 vs. Ensembl Fly
Match: ey (gene:FBgn0005558 transcript:FBtr0100395)

HSP 1 Score: 197.208 bits (500), Expect = 4.425e-53
Identity = 87/111 (78.38%), Postives = 99/111 (89.19%), Query Frame = 2
Query:  293 HSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            HSG+NQLGG+FV GRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K++ YK+E PS+FAWEIRDRLLQ+ VC  D
Sbjct:   57 HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTND 167          

HSP 2 Score: 113.62 bits (283), Expect = 1.269e-25
Identity = 56/101 (55.45%), Postives = 71/101 (70.30%), Query Frame = 2
Query: 1082 ETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ETG G G   N    +  N++   +++ R       + +K QR+RTSFTNDQI+ LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  398 ETGSGEGENSNGGASNIGNTE---DDQARL-----ILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 490          
BLAST of Paired box protein Pax-6 vs. Ensembl Fly
Match: ey (gene:FBgn0005558 transcript:FBtr0100396)

HSP 1 Score: 196.823 bits (499), Expect = 6.944e-53
Identity = 87/111 (78.38%), Postives = 99/111 (89.19%), Query Frame = 2
Query:  293 HSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            HSG+NQLGG+FV GRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K++ YK+E PS+FAWEIRDRLLQ+ VC  D
Sbjct:   98 HSGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTND 208          

HSP 2 Score: 113.235 bits (282), Expect = 1.493e-25
Identity = 56/101 (55.45%), Postives = 71/101 (70.30%), Query Frame = 2
Query: 1082 ETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ETG G G   N    +  N++   +++ R       + +K QR+RTSFTNDQI+ LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  439 ETGSGEGENSNGGASNIGNTE---DDQARL-----ILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 531          
BLAST of Paired box protein Pax-6 vs. Ensembl Zebrafish
Match: pax6a (paired box 6a [Source:NCBI gene;Acc:30567])

HSP 1 Score: 192.971 bits (489), Expect = 5.535e-58
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   20 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTND 134          
BLAST of Paired box protein Pax-6 vs. Ensembl Zebrafish
Match: pax6a (paired box 6a [Source:NCBI gene;Acc:30567])

HSP 1 Score: 196.823 bits (499), Expect = 1.192e-55
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   20 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTND 134          

HSP 2 Score: 107.071 bits (266), Expect = 3.092e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  224 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 289          
BLAST of Paired box protein Pax-6 vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 196.823 bits (499), Expect = 1.229e-55
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   20 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTND 134          

HSP 2 Score: 107.071 bits (266), Expect = 3.420e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  224 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 289          
BLAST of Paired box protein Pax-6 vs. Ensembl Zebrafish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 196.823 bits (499), Expect = 1.229e-55
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   20 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTND 134          

HSP 2 Score: 107.071 bits (266), Expect = 3.420e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  224 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 289          
BLAST of Paired box protein Pax-6 vs. Ensembl Zebrafish
Match: pax6a (paired box 6a [Source:NCBI gene;Acc:30567])

HSP 1 Score: 189.119 bits (479), Expect = 8.790e-53
Identity = 89/127 (70.08%), Postives = 101/127 (79.53%), Query Frame = 2
Query:  287 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            +GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQ              VSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   12 EGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKRECPSIFAWEIRDRLLSEGVCTND 138          

HSP 2 Score: 107.071 bits (266), Expect = 3.345e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  228 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 293          
BLAST of Paired box protein Pax-6 vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 198.364 bits (503), Expect = 1.157e-56
Identity = 89/112 (79.46%), Postives = 100/112 (89.29%), Query Frame = 2
Query:  290 GHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   11 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 122          

HSP 2 Score: 75.485 bits (184), Expect = 6.543e-14
Identity = 32/52 (61.54%), Postives = 42/52 (80.77%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQV 1342
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQV
Sbjct:  214 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQV 265          
BLAST of Paired box protein Pax-6 vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 198.749 bits (504), Expect = 2.976e-56
Identity = 89/112 (79.46%), Postives = 100/112 (89.29%), Query Frame = 2
Query:  290 GHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   11 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 122          

HSP 2 Score: 107.457 bits (267), Expect = 2.967e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  214 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 279          
BLAST of Paired box protein Pax-6 vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 196.823 bits (499), Expect = 1.241e-55
Identity = 88/111 (79.28%), Postives = 99/111 (89.19%), Query Frame = 2
Query:  293 HSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 111          

HSP 2 Score: 107.457 bits (267), Expect = 2.820e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  203 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 268          
BLAST of Paired box protein Pax-6 vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 196.438 bits (498), Expect = 3.487e-55
Identity = 88/111 (79.28%), Postives = 99/111 (89.19%), Query Frame = 2
Query:  293 HSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   24 HSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 134          

HSP 2 Score: 107.071 bits (266), Expect = 4.734e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  226 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 291          
BLAST of Paired box protein Pax-6 vs. Ensembl Xenopus
Match: pax6 (paired box 6 [Source:NCBI gene;Acc:448447])

HSP 1 Score: 191.815 bits (486), Expect = 1.024e-53
Identity = 86/109 (78.90%), Postives = 97/109 (88.99%), Query Frame = 2
Query:  299 GINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            G+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:   15 GVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 123          

HSP 2 Score: 107.457 bits (267), Expect = 3.199e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  215 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 280          
BLAST of Paired box protein Pax-6 vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 197.208 bits (500), Expect = 7.725e-56
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 2.352e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 197.208 bits (500), Expect = 7.725e-56
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 2.352e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 197.208 bits (500), Expect = 7.725e-56
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 2.352e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 197.208 bits (500), Expect = 7.725e-56
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 2.352e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Mouse
Match: Pax6 (paired box 6 [Source:MGI Symbol;Acc:MGI:97490])

HSP 1 Score: 184.882 bits (468), Expect = 8.267e-55
Identity = 88/129 (68.22%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQ              VSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 129          
BLAST of Paired box protein Pax-6 vs. UniProt/SwissProt
Match: sp|P63016|PAX6_RAT (Paired box protein Pax-6 OS=Rattus norvegicus OX=10116 GN=Pax6 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 4.590e-55
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 1.630e-23
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. UniProt/SwissProt
Match: sp|P47238|PAX6_COTJA (Paired box protein Pax-6 OS=Coturnix japonica OX=93934 GN=PAX6 PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 5.227e-55
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 1.386e-23
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. UniProt/SwissProt
Match: sp|P55864|PAX6_XENLA (Paired box protein Pax-6 OS=Xenopus laevis OX=8355 GN=pax6 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.241e-55
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVNKIAHYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 108.997 bits (271), Expect = 4.879e-24
Identity = 56/103 (54.37%), Postives = 70/103 (67.96%), Query Frame = 2
Query: 1076 QSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            Q + GVG     N + IS  N +   E + R      ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  178 QPQEGVGE----NTNSISS-NGEDSDEAQMRL-----QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. UniProt/SwissProt
Match: sp|Q1LZF1|PAX6_BOVIN (Paired box protein Pax-6 OS=Bos taurus OX=9913 GN=PAX6 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.349e-55
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 1.601e-23
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. UniProt/SwissProt
Match: sp|P63015|PAX6_MOUSE (Paired box protein Pax-6 OS=Mus musculus OX=10090 GN=Pax6 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.404e-55
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC  D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTND 115          

HSP 2 Score: 107.457 bits (267), Expect = 1.646e-23
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. TrEMBL
Match: Q8T392 (Pax-6B protein OS=Dugesia japonica OX=6161 GN=pax-6B PE=2 SV=1)

HSP 1 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 512/579 (88.43%), Postives = 545/579 (94.13%), Query Frame = 2
Query:  233 MVFSSSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDXXXXXXXXXXXXXXXANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDXXXXXXXXXXXXXXXXXXXINTWPPTSAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSNMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSLFQPPIGWYNSESFSKLNPEPDSYKLSLFPCCKPFSRPPNPFYLTPDPNL-NNKIDEKSHKRENSPNEFNQSYSNFFYQNLDQTKSLSIIGQDFQRK-SPVDDSNSSFQSPKWWPNNSM-NDHYEQVYPA 1960
            MVFS+ S+ENMKINRKLRKGHSGINQLGGMFVNGRPLPD+TRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYY TGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDNLPSISSINRILRSLANESP++N TFKS++SNSHQL+L SQNNG SSCLPQYDSFNT+ NNNFNLLN+ S FINTWPPTSAPPVFPNWYSQ+GISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARL+ NS+HES+R+S MKSL   E+G+ N LK+NNDKISDFNSDRESE E+RYSN ESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNL NG+I SD+SN+E  SGVS  SNDSI+NTN+NFFSDCFRGNF SM EDIR+  NSFGSSLFQPPIGWYN+ESFSKLNPE DSYKL+LFPCCKPFSRPPNPFY+TPDPN+ +NKID KSHKRENSPNEFNQSY+NFFYQNLDQTKSLS IGQ+FQRK SPV+DSNSSFQSPKWW NNSM NDHYEQVYPA
Sbjct:    1 MVFSNCSEENMKINRKLRKGHSGINQLGGMFVNGRPLPDVTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYGTGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDNLPSISSINRILRSLANESPSSNQTFKSTLSNSHQLSLVSQNNGASSCLPQYDSFNTTANNNFNLLNTPSNFINTWPPTSAPPVFPNWYSQTGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLIANSNHESIRDSTMKSLFTPESGIVNSLKMNNDKISDFNSDRESETERRYSNPESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLPNGMIHSDISNIEPGSGVSATSNDSIINTNTNFFSDCFRGNFPSMTEDIRNRGNSFGSSLFQPPIGWYNTESFSKLNPEQDSYKLNLFPCCKPFSRPPNPFYITPDPNISHNKIDNKSHKRENSPNEFNQSYTNFFYQNLDQTKSLSTIGQEFQRKSSPVEDSNSSFQSPKWWSNNSMNNDHYEQVYPA 579          
BLAST of Paired box protein Pax-6 vs. TrEMBL
Match: O96756 (DtPax-6 protein OS=Girardia tigrina OX=6162 GN=dtPax-6 PE=2 SV=1)

HSP 1 Score: 951.814 bits (2459), Expect = 0.000e+0
Identity = 493/577 (85.44%), Postives = 543/577 (94.11%), Query Frame = 2
Query:  233 MVFSSSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDXXXXXXXXXXXXXXXANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDXXXXXXXXXXXXXXXXXXXINTWPPTSAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSNMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSLFQPPIGWYNSESFSKLNPEPDSYKLSLFPCCKPFSRPPNPFYLTPDPNLNNKIDEKSHKRENSPNEFNQSYSNFFYQNLDQTKSLSIIGQDFQRK-SPVDDSNSSFQSPKWWPNNSMNDHYEQVYPA 1960
            MVFS+ S+ENMKINRKLRKGHSGINQLGG+FVNGRPLPD+TRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDR LQDGVCNQDNLPSISSINRILRSLANESP++N TFKSS+SNSHQL+L++Q+NGT+SCLPQY+ FN+STNNNFNLL++ STFIN W P++APPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHF DYSSSQI FEDSK RL+ NS H+S+R+S MKSLLQSETG+ NGLK+N++KISDFNSDRESEN++RYSN+ESK++KKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENN+SN + RS++SNME  SGVS ASNDSILNTN+NFFSDCFRGNFTSM +DIRSSWN+FG+SLFQPPIGWYNS+SF KLN E DSYKLSLFPCCKPF+RP N  Y+ PD NL +KI+ K +KRENSPNEFNQSY+NFFYQNLDQTKSLS + Q+FQRK SPVDDSNSSFQSPKWWPNN++NDHYEQVYPA
Sbjct:    1 MVFSNCSEENMKINRKLRKGHSGINQLGGIFVNGRPLPDVTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRPLQDGVCNQDNLPSISSINRILRSLANESPSSNQTFKSSLSNSHQLSLSNQSNGTNSCLPQYEPFNSSTNNNFNLLHTPSTFINIWSPSNAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFPDYSSSQIGFEDSKNRLLTNSGHDSLRDSTMKSLLQSETGLPNGLKVNSEKISDFNSDRESENDRRYSNTESKLSKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNMSNVMARSEMSNMEPTSGVSAASNDSILNTNTNFFSDCFRGNFTSMTDDIRSSWNTFGTSLFQPPIGWYNSDSFGKLNQEQDSYKLSLFPCCKPFTRPLNSLYIPPDANLPHKIEGKLNKRENSPNEFNQSYTNFFYQNLDQTKSLSTVSQEFQRKSSPVDDSNSSFQSPKWWPNNAINDHYEQVYPA 577          
BLAST of Paired box protein Pax-6 vs. TrEMBL
Match: T1DF72 (Pax6B OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 370/578 (64.01%), Postives = 454/578 (78.55%), Query Frame = 2
Query:  245 SSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDXXXXXXXXXXXXXXXANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDXXXXXXXXXXXXXXXXXXXINTWPPTSAPP--VFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSNMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSLFQPPIGWYNSESFSKLNPEPDSYKLSLFPCCKPFSRPPNPFYLTPDPNLNNKIDEKSHKRENSPNE--FNQSYSNF----FYQNLDQTKSLSIIGQDFQRKSPVDDSNSSFQSPKWWPNNSMNDHYEQVY 1954
            S S E +K +RK+RKGHSGINQLGGMFVNGRPLPD+TRQRIIELSQSGARPCDISRILQVSNGCVSKILCR+YETGSIKPKAIGGSKPRVATN+VVRKVT+YKQESPSMFAWEIRDRLLQDGVCNQDN+PSISSINRILRSL+NE+ T +  FK  ++N HQL++ + +N ++    QY+  N ST  NFNLL+S S+F+N WP   +PP  VFP+WYSQSGISSLCHSTLFGYN  NYY  HF DY+      E+SK RL + ++    RE ++KS + S       +K++++K S++NSDRESE +K+YSNS SK+ KKSQRSRTSFTNDQI+LLEKEF+RTHYPDVFSREKLS  LKVAETRIQVWFSNRRAKWRREEK+E+N  SN   RSD+  M     ++  SNDS +N N+NFFS+CFRGNF SMP+D+RSSWN+FG+S FQP IG YN+ES SKL+ + D YKLS  PCCK   RPPNPFY + D N N K+++KS+K E + ++    Q++++F    ++ NLDQ+K++S +G   ++ SP+DD    FQ+ KWW NNS+ D YE +Y
Sbjct:   13 SHSGEEIKNHRKMRKGHSGINQLGGMFVNGRPLPDVTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRFYETGSIKPKAIGGSKPRVATNSVVRKVTVYKQESPSMFAWEIRDRLLQDGVCNQDNIPSISSINRILRSLSNETNTNSTPFKPPLNNCHQLSIVNPHNSSNQSHSQYNPINNSTTTNFNLLHSPSSFMNNWP---SPPTAVFPHWYSQSGISSLCHSTLFGYNGTNYYPPHFQDYT----HLEESKTRLNSITNQ---REPSVKSTVHSVNEDTANIKMDSEKTSEYNSDRESEVDKKYSNSCSKLTKKSQRSRTSFTNDQISLLEKEFDRTHYPDVFSREKLSHKLKVAETRIQVWFSNRRAKWRREEKAEDNINSNMSQRSDIP-MNSGGLITATSNDSNINNNTNFFSECFRGNFPSMPDDLRSSWNTFGTSFFQPSIGLYNAESISKLSHDNDPYKLSFLPCCKSLPRPPNPFYSSTDCNTNEKVEDKSNKNEGALSKVPLTQNFTSFNYTGYHPNLDQSKNMSFVGS--RKSSPIDDHPYFFQNSKWWSNNSIVDQYETLY 577          
BLAST of Paired box protein Pax-6 vs. TrEMBL
Match: Q7YTC0 (Pax6 OS=Saccoglossus kowalevskii OX=10224 PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 6.716e-84
Identity = 165/365 (45.21%), Postives = 205/365 (56.16%), Query Frame = 2
Query:  290 GHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDXXXXXXXXXXXXXXXANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDXXXXXXXXXXXXXXXXXXXINTWPPTSAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  +K+E PS+FAWEIRDRLLQ+ VC QD                      N    SSI N     LA++ NG     P +D                     TWP T        WYS +G   + H      N P                        ++ +       S+ + L+ S+  +  G      +ISD     ++  +   + +  ++ +K QR+RTSFT  QI  LEKEFERTHYPDVF+RE+L+Q + + E RIQVWFSNRRAKWRREEK
Sbjct:   11 GHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPPVVGKIAQFKRECPSIFAWEIRDRLLQEQVCTQD----------------------NIPSVSSI-NRVLRTLAAEKNGPMGGEPVFDKLRLLNG-------------QTWPRTGP------WYS-TGPPPIPH------NVP------------------------ISTNGTTPTNTSSTEGLVCSKKDIDAG------EISDHKDGTDASGDDDEAQARLRLKRKLQRNRTSFTQYQIETLEKEFERTHYPDVFARERLAQKIDLPEARIQVWFSNRRAKWRREEK 296          
BLAST of Paired box protein Pax-6 vs. TrEMBL
Match: A0A433U7U4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_002326 PE=4 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 6.153e-83
Identity = 171/397 (43.07%), Postives = 214/397 (53.90%), Query Frame = 2
Query:  236 VFSSSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDXXXXXXXXXXXXXXXANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDXXXXXXXXXXXXXXXXXXXINTWPPTSAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK--SEENNLSNGLIR 1420
              + +S   +K+ R     HSG+NQLGG+FVNGRPLPD TRQRI+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVATN VV ++  YK+E PS+FAWEIRDRLL +G+CNQ+          +   L N  P+  P  + S  N     LAS+N         YD         ++         N W   S PP                  + G   P+ YS   S               L+     ES    +  S    + G                   E++ + R      ++ +K QR+RTSFT  QI  LEKEFERTHYPDVF+RE+L+Q + + E RIQVWFSNRRAKWRREEK  ++   + NG  R
Sbjct:  148 AVTCASGAGVKVER-----HSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATNDVVGRIAHYKRECPSIFAWEIRDRLLSEGICNQE----NIPSVSLGPVLVNNLPSVCPPLQVSSINRVLRNLASENQKAMGQGSMYDKLGLLNGQGWHRP-------NPWYSPSVPP------------------MGGLPHPSAYSPAASAQPPPHHHHHHHHHHLMAEKKSESGAAGSTGSQSDGQAG-------------------ETDEQMRM-----RLKRKLQRNRTSFTAGQIESLEKEFERTHYPDVFARERLAQKIDLPEARIQVWFSNRRAKWRREEKLRNQRREVCNGSTR 486          
BLAST of Paired box protein Pax-6 vs. Ensembl Cavefish
Match: pax6a (paired box 6 [Source:NCBI gene;Acc:103044317])

HSP 1 Score: 197.208 bits (500), Expect = 7.421e-56
Identity = 87/113 (76.99%), Postives = 101/113 (89.38%), Query Frame = 2
Query:  287 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            +GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  +K+E PS+FAWEIRDRLL +G+C  D
Sbjct:   12 EGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQFKRECPSIFAWEIRDRLLSEGICTND 124          

HSP 2 Score: 107.457 bits (267), Expect = 1.703e-24
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 2
Query: 1097 NGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            +G   N + IS    D E E + R      ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  190 DGGAENTNSISSNGEDSE-EAQMRL-----QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 279          
BLAST of Paired box protein Pax-6 vs. Ensembl Cavefish
Match: pax6b (paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1])

HSP 1 Score: 196.438 bits (498), Expect = 8.859e-56
Identity = 87/115 (75.65%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK E PS+FAWEIRDRLL +G+C+ D
Sbjct:    1 MQNSHSGVNQLGGVFVNGRPLPDTTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQYKHECPSIFAWEIRDRLLSEGICSND 115          

HSP 2 Score: 106.686 bits (265), Expect = 3.057e-24
Identity = 46/66 (69.70%), Postives = 56/66 (84.85%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  205 QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 270          
BLAST of Paired box protein Pax-6 vs. Ensembl Cavefish
Match: pax6a (paired box 6 [Source:NCBI gene;Acc:103044317])

HSP 1 Score: 197.208 bits (500), Expect = 1.055e-55
Identity = 87/113 (76.99%), Postives = 101/113 (89.38%), Query Frame = 2
Query:  287 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            +GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  +K+E PS+FAWEIRDRLL +G+C  D
Sbjct:   30 EGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQFKRECPSIFAWEIRDRLLSEGICTND 142          

HSP 2 Score: 107.457 bits (267), Expect = 2.371e-24
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 2
Query: 1097 NGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            +G   N + IS    D E E + R      ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  208 DGGAENTNSISSNGEDSE-EAQMRL-----QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 297          
BLAST of Paired box protein Pax-6 vs. Ensembl Cavefish
Match: pax6a (paired box 6 [Source:NCBI gene;Acc:103044317])

HSP 1 Score: 187.578 bits (475), Expect = 3.721e-52
Identity = 87/127 (68.50%), Postives = 101/127 (79.53%), Query Frame = 2
Query:  287 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            +GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQ              VSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  +K+E PS+FAWEIRDRLL +G+C  D
Sbjct:   30 EGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTQADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQFKRECPSIFAWEIRDRLLSEGICTND 156          

HSP 2 Score: 107.457 bits (267), Expect = 2.798e-24
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 2
Query: 1097 NGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            +G   N + IS    D E E + R      ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  222 DGGAENTNSISSNGEDSE-EAQMRL-----QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 311          
BLAST of Paired box protein Pax-6 vs. Ensembl Cavefish
Match: pax6a (paired box 6 [Source:NCBI gene;Acc:103044317])

HSP 1 Score: 187.578 bits (475), Expect = 3.721e-52
Identity = 87/127 (68.50%), Postives = 101/127 (79.53%), Query Frame = 2
Query:  287 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQ--------------VSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            +GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQ              VSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  +K+E PS+FAWEIRDRLL +G+C  D
Sbjct:   30 EGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTQADAKVQVLDNENVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVGKIAQFKRECPSIFAWEIRDRLLSEGICTND 156          

HSP 2 Score: 107.457 bits (267), Expect = 2.798e-24
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 2
Query: 1097 NGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            +G   N + IS    D E E + R      ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  222 DGGAENTNSISSNGEDSE-EAQMRL-----QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 311          
BLAST of Paired box protein Pax-6 vs. Ensembl Sea Lamprey
Match: pax9 (paired box 9 [Source:ZFIN;Acc:ZDB-GENE-980526-399])

HSP 1 Score: 161.384 bits (407), Expect = 6.403e-46
Identity = 73/107 (68.22%), Postives = 86/107 (80.37%), Query Frame = 2
Query:  302 INQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQ 622
            +NQLGG+FVNGRPLP+  R RI+E++Q G RPCDISR L+VS+GCVSKIL RY ETGSI P AIGGSKPRV T  VV  +  YKQ  P +FAWEIRD+LL DGVC++
Sbjct:    7 VNQLGGVFVNGRPLPNAIRLRIVEMAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVNHIRTYKQRDPGIFAWEIRDKLLADGVCDK 113          
BLAST of Paired box protein Pax-6 vs. Ensembl Sea Lamprey
Match: pax1a (paired box 1a [Source:ZFIN;Acc:ZDB-GENE-070112-182])

HSP 1 Score: 161.77 bits (408), Expect = 8.995e-45
Identity = 75/107 (70.09%), Postives = 87/107 (81.31%), Query Frame = 2
Query:  302 INQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQ 622
            +NQLGG+FVNGRPLP+  R RI+EL+Q G RPCDISR L+VS+GCVSKIL RY ETGSI P AIGGSKPRV T  VV+ +  YKQ  P +FAWEIRDRLL DGVC++
Sbjct:   68 VNQLGGVFVNGRPLPNPIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVKHIRDYKQRDPGIFAWEIRDRLLADGVCDK 174          
BLAST of Paired box protein Pax-6 vs. Ensembl Sea Lamprey
Match: dmbx1b (diencephalon/mesencephalon homeobox 1b [Source:NCBI gene;Acc:550288])

HSP 1 Score: 80.4925 bits (197), Expect = 1.418e-16
Identity = 33/61 (54.10%), Postives = 47/61 (77.05%), Query Frame = 2
Query: 1205 QRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKS 1387
            +RSRT+FT  Q+  LEK F++THYPDV  RE+L+    + E R+QVWF NRRAK+R++++S
Sbjct:   44 RRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRS 104          
BLAST of Paired box protein Pax-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010761.1 (pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-1 gene:ENSPMAG00000009746.1 transcript:ENSPMAT00000010761.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 3.751e-15
Identity = 30/60 (50.00%), Postives = 45/60 (75.00%), Query Frame = 2
Query: 1193 NKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWR 1372
            N+K +R RT+FT  Q+++LE  F +T YPD+F RE+++  + + E+R+QVWF NRRAK R
Sbjct:    3 NRKQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 62          
BLAST of Paired box protein Pax-6 vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 61.2326 bits (147), Expect = 1.480e-11
Identity = 24/61 (39.34%), Postives = 44/61 (72.13%), Query Frame = 2
Query: 1196 KKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRRE 1378
            KK +++RT+F++ Q+  LE+ FER  Y  V  R +L+ +L +++T+++ W+ NRR KW+R+
Sbjct:    3 KKPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQ 63          
BLAST of Paired box protein Pax-6 vs. Ensembl Nematostella
Match: PAXB (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN74])

HSP 1 Score: 194.126 bits (492), Expect = 2.666e-54
Identity = 83/114 (72.81%), Postives = 98/114 (85.96%), Query Frame = 2
Query:  284 RKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++GH G+NQLGG+FVNGRPLPD+ RQRI+EL+QSG RPCDISR L+VS+GCVSKILCR+YETGSIKP  IGGSKP+VAT  VV K+  YK  +P+MFAWEIRDRLL +GVC  D
Sbjct:    5 KQGHGGVNQLGGVFVNGRPLPDVVRQRIVELAQSGVRPCDISRQLRVSHGCVSKILCRFYETGSIKPGVIGGSKPKVATGNVVTKIAEYKLANPTMFAWEIRDRLLSEGVCTSD 118          

HSP 2 Score: 97.8265 bits (242), Expect = 1.908e-21
Identity = 42/67 (62.69%), Postives = 57/67 (85.07%), Query Frame = 2
Query: 1184 SKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            S+ +K S+R RT+FT++QI  LEK FE+THYPDVF+RE+L+Q + ++E RIQVW+SNRRAKWR+E K
Sbjct:  220 SQRSKMSRRQRTNFTDEQIEKLEKVFEKTHYPDVFTREELAQQVNLSEARIQVWYSNRRAKWRKEGK 286          
BLAST of Paired box protein Pax-6 vs. Ensembl Nematostella
Match: PAXC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCC8])

HSP 1 Score: 176.792 bits (447), Expect = 1.710e-48
Identity = 76/113 (67.26%), Postives = 96/113 (84.96%), Query Frame = 2
Query:  287 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            +GH G+NQLGG FVNGRPLPD  R RII+L+  G RPC+ISR L VS+GCVSKIL RYYETGSI+P +IGGSKP+VAT  VV K+  YKQ++P++FAWEIRDRL+++G+C++D
Sbjct:   21 QGHGGLNQLGGAFVNGRPLPDYIRHRIIQLATYGVRPCEISRRLLVSHGCVSKILGRYYETGSIRPGSIGGSKPKVATPPVVNKILQYKQQNPTIFAWEIRDRLVEEGICDRD 133          

HSP 2 Score: 96.2857 bits (238), Expect = 4.662e-21
Identity = 44/88 (50.00%), Postives = 67/88 (76.14%), Query Frame = 2
Query: 1127 SDFNSDRESENEKRYSNSESKINKKSQ--RSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            SD N++  S +++R  + +   N+K +  R+RT+FT DQ+ +LEKEFE++HYPDV +RE+L+  + ++E R+QVWFSNRRAKWRR +K
Sbjct:  302 SDTNANDASTDDERGKDEDPATNQKRKLRRNRTTFTPDQLEMLEKEFEKSHYPDVATREELANKIDMSEARVQVWFSNRRAKWRRHQK 389          
BLAST of Paired box protein Pax-6 vs. Ensembl Nematostella
Match: PAXA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S916])

HSP 1 Score: 164.466 bits (415), Expect = 2.728e-43
Identity = 73/113 (64.60%), Postives = 90/113 (79.65%), Query Frame = 2
Query:  284 RKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQ 622
             +G  G+NQLGG+FVNGRPLPD  R RI+EL+  G RP +ISR L VS+GCVSKIL RYYETGS++P AIGGSKP+VAT  VV K+  YK ++P +FAWEIR+ LL DGVC++
Sbjct:    3 HRGPGGVNQLGGVFVNGRPLPDYMRHRIVELAHCGVRPSEISRQLLVSHGCVSKILGRYYETGSVRPGAIGGSKPKVATPKVVSKILEYKDKNPCIFAWEIRNNLLADGVCDK 115          
BLAST of Paired box protein Pax-6 vs. Ensembl Nematostella
Match: EDO36623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI38])

HSP 1 Score: 140.198 bits (352), Expect = 3.287e-39
Identity = 65/112 (58.04%), Postives = 88/112 (78.57%), Query Frame = 2
Query:  290 GHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGG-SKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQ 622
            G   +NQLGG+F+NGRPLP + R++IIEL+Q G RPCDISR L+VS+GCVSKIL R+ +TGSI+P AI G S PR  T  +  K+  Y++E+P MF+WE+RDRL++D VC++
Sbjct:    2 GQGRVNQLGGVFINGRPLPLVLRKQIIELAQLGVRPCDISRRLRVSHGCVSKILYRFQQTGSIEPGAIAGSSTPRNVTPEIEEKIDEYRRENPGMFSWEVRDRLVKDNVCSR 113          
BLAST of Paired box protein Pax-6 vs. Ensembl Nematostella
Match: EDO32510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUW0])

HSP 1 Score: 130.954 bits (328), Expect = 6.595e-36
Identity = 53/107 (49.53%), Postives = 85/107 (79.44%), Query Frame = 2
Query:  302 INQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQ 622
            +NQLGG +VNG+PLP   R +IIEL++SG RPC+ISR L++++GC+SK+L ++ +TGS++P  +   +PRV T+ + +K+  Y+ E P +F+WEIRD+LLQ+G+C++
Sbjct:    1 VNQLGGGYVNGKPLPREIRIQIIELARSGVRPCEISRRLKITHGCISKLLAKFQKTGSLEPGTVYKGRPRVVTSQIEKKIDQYRAEQPGIFSWEIRDQLLQEGICDR 107          
BLAST of Paired box protein Pax-6 vs. Ensembl Medaka
Match: ENSORLT00000001038.2 (paired box protein Pax-6 [Source:NCBI gene;Acc:101173141])

HSP 1 Score: 198.364 bits (503), Expect = 1.721e-56
Identity = 88/114 (77.19%), Postives = 102/114 (89.47%), Query Frame = 2
Query:  284 RKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++ HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC+ D
Sbjct:    6 KQSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLAEGVCSND 119          

HSP 2 Score: 111.309 bits (277), Expect = 7.371e-26
Identity = 59/125 (47.20%), Postives = 78/125 (62.40%), Query Frame = 2
Query: 1010 KARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            K +++N       R S       S TG  NG+ +N+      +++   E + R      ++ +K QR+RTSFT DQI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  152 KLKMLNVHTSWGGRSSWYAGTTLSSTGRENGISVNS------STEDSEETQMRL-----QLKRKLQRNRTSFTQDQIEALEKEFERTHYPDVFARERLANKIDLPEARIQVWFSNRRAKWRREEK 265          
BLAST of Paired box protein Pax-6 vs. Ensembl Medaka
Match: ENSORLT00000033584.1 (paired box protein Pax-6 [Source:NCBI gene;Acc:101173141])

HSP 1 Score: 197.978 bits (502), Expect = 3.922e-56
Identity = 88/115 (76.52%), Postives = 102/115 (88.70%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC+ D
Sbjct:   20 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLAEGVCSND 134          

HSP 2 Score: 108.612 bits (270), Expect = 7.701e-25
Identity = 53/99 (53.54%), Postives = 69/99 (69.70%), Query Frame = 2
Query: 1088 GVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            G  NG+ +N+      +++   E + R      ++ +K QR+RTSFT DQI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  199 GRENGISVNS------STEDSEETQMRL-----QLKRKLQRNRTSFTQDQIEALEKEFERTHYPDVFARERLANKIDLPEARIQVWFSNRRAKWRREEK 286          
BLAST of Paired box protein Pax-6 vs. Ensembl Medaka
Match: ENSORLT00000038302.1 (paired box protein Pax-6 [Source:NCBI gene;Acc:101173141])

HSP 1 Score: 197.593 bits (501), Expect = 6.180e-56
Identity = 88/115 (76.52%), Postives = 102/115 (88.70%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +GVC+ D
Sbjct:   20 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLAEGVCSND 134          

HSP 2 Score: 108.612 bits (270), Expect = 9.289e-25
Identity = 53/99 (53.54%), Postives = 69/99 (69.70%), Query Frame = 2
Query: 1088 GVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            G  NG+ +N+      +++   E + R      ++ +K QR+RTSFT DQI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  201 GRENGISVNS------STEDSEETQMRL-----QLKRKLQRNRTSFTQDQIEALEKEFERTHYPDVFARERLANKIDLPEARIQVWFSNRRAKWRREEK 288          
BLAST of Paired box protein Pax-6 vs. Ensembl Medaka
Match: pax6b (paired box 6 [Source:NCBI gene;Acc:100049356])

HSP 1 Score: 196.823 bits (499), Expect = 1.218e-55
Identity = 87/115 (75.65%), Postives = 101/115 (87.83%), Query Frame = 2
Query:  281 LRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            ++  HSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQVSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +G+C  D
Sbjct:   20 MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLSEGICTND 134          

HSP 2 Score: 108.227 bits (269), Expect = 1.162e-24
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 2
Query: 1097 NGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            +G   N + IS    D E E + R      ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  200 DGAGENTNSISSNGEDSE-ETQMRL-----QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 289          
BLAST of Paired box protein Pax-6 vs. Ensembl Medaka
Match: pax6b (paired box 6 [Source:NCBI gene;Acc:100049356])

HSP 1 Score: 190.274 bits (482), Expect = 4.617e-53
Identity = 88/125 (70.40%), Postives = 101/125 (80.80%), Query Frame = 2
Query:  287 KGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQ------------VSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            +GHSG+NQLGG+FVNGRPLPD TRQ+I+EL+ SGARPCDISRILQ            VSNGCVSKIL RYYETGSI+P+AIGGSKPRVAT  VV K+  YK+E PS+FAWEIRDRLL +G+C  D
Sbjct:   30 EGHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHDEVQVLDSEKVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVAKIAQYKRECPSIFAWEIRDRLLSEGICTND 154          

HSP 2 Score: 107.842 bits (268), Expect = 1.809e-24
Identity = 54/96 (56.25%), Postives = 67/96 (69.79%), Query Frame = 2
Query: 1097 NGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEK 1384
            +G   N + IS    D E E + R      ++ +K QR+RTSFT +QI  LEKEFERTHYPDVF+RE+L+  + + E RIQVWFSNRRAKWRREEK
Sbjct:  220 DGAGENTNSISSNGEDSE-ETQMRL-----QLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 309          
BLAST of Paired box protein Pax-6 vs. Planmine SMEST
Match: SMESG000077501.1 (SMESG000077501.1)

HSP 1 Score: 1100.5 bits (2845), Expect = 0.000e+0
Identity = 576/576 (100.00%), Postives = 576/576 (100.00%), Query Frame = 2
Query:  233 MVFSSSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDXXXXXXXXXXXXXXXANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDXXXXXXXXXXXXXXXXXXXINTWPPTSAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSNMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSLFQPPIGWYNSESFSKLNPEPDSYKLSLFPCCKPFSRPPNPFYLTPDPNLNNKIDEKSHKRENSPNEFNQSYSNFFYQNLDQTKSLSIIGQDFQRKSPVDDSNSSFQSPKWWPNNSMNDHYEQVYPA 1960
            MVFSSSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDNLPSISSINRILRSLANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDSFNTSTNNNFNLLNSSSTFINTWPPTSAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSNMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSLFQPPIGWYNSESFSKLNPEPDSYKLSLFPCCKPFSRPPNPFYLTPDPNLNNKIDEKSHKRENSPNEFNQSYSNFFYQNLDQTKSLSIIGQDFQRKSPVDDSNSSFQSPKWWPNNSMNDHYEQVYPA
Sbjct:    1 MVFSSSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQDNLPSISSINRILRSLANESPTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDSFNTSTNNNFNLLNSSSTFINTWPPTSAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYSSSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISDFNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSNMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSLFQPPIGWYNSESFSKLNPEPDSYKLSLFPCCKPFSRPPNPFYLTPDPNLNNKIDEKSHKRENSPNEFNQSYSNFFYQNLDQTKSLSIIGQDFQRKSPVDDSNSSFQSPKWWPNNSMNDHYEQVYPA 576          
BLAST of Paired box protein Pax-6 vs. Planmine SMEST
Match: SMESG000039056.1 (SMESG000039056.1)

HSP 1 Score: 228.409 bits (581), Expect = 2.314e-66
Identity = 100/129 (77.52%), Postives = 118/129 (91.47%), Query Frame = 2
Query:  239 FSSSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
             + S++E +K  +K+++GHSGINQLGGMFVNGRPLPD TRQRI+EL+ SGARPCDISRILQVSNGCVSKILCRYYETGSI+PKAIGGSKPRVAT++VV K+  YK+E PS+F+WEIRDRLLQ+GVCNQD
Sbjct:    1 MTESNEEEIKNKKKVKRGHSGINQLGGMFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILCRYYETGSIRPKAIGGSKPRVATSSVVSKIAAYKRECPSIFSWEIRDRLLQEGVCNQD 129          

HSP 2 Score: 110.153 bits (274), Expect = 5.709e-25
Identity = 61/136 (44.85%), Postives = 79/136 (58.09%), Query Frame = 2
Query: 1187 KINKKSQRSRTSFTNDQINLLEKEFERTHYPDVFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLSNMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSLFQPP 1594
            K+ +K QR+RTSF+ DQ++ LEKEFERTHYPDVF+REKL+  + + E RIQVWFSNRRAKWRREEK          +R    N+   S  + ++ D+ + TN N       G  +     I    N FG    Q P
Sbjct:  281 KLKRKLQRNRTSFSTDQLDSLEKEFERTHYPDVFAREKLADKISLPEARIQVWFSNRRAKWRREEK----------LRRQRQNLMLGSNGASSTADTNVTTNGNTQCLSTTGQNSMGFSGINDIRNQFGDVGMQTP 406          
BLAST of Paired box protein Pax-6 vs. Planmine SMEST
Match: SMESG000004009.1 (SMESG000004009.1)

HSP 1 Score: 179.104 bits (453), Expect = 7.481e-48
Identity = 80/123 (65.04%), Postives = 96/123 (78.05%), Query Frame = 2
Query:  257 ENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQD 625
            EN K+      GH G+NQLGG+FVNGRPLP+  RQ+I+EL+  G RPCDISR L+VS+GCVSKIL R+YETGSIKP  IGGSKP+VAT  VV  +  YK E+P+MFAWEIRD LL D VC+Q+
Sbjct:   39 ENGKLKTNDINGHGGVNQLGGLFVNGRPLPNSVRQQIVELAHRGVRPCDISRQLRVSHGCVSKILGRFYETGSIKPGVIGGSKPKVATPEVVEAICKYKAENPTMFAWEIRDMLLNDRVCSQE 161          
BLAST of Paired box protein Pax-6 vs. Planmine SMEST
Match: SMESG000066574.1 (SMESG000066574.1)

HSP 1 Score: 139.043 bits (349), Expect = 3.876e-35
Identity = 67/123 (54.47%), Postives = 83/123 (67.48%), Query Frame = 2
Query:  254 DENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQ 622
            D N KI  K   G   INQ G  F NGRPLP+  R  I++L+    RPCDISR L VS+GCVSKIL RY +TGSI P  IGGSKP+V T  +V +V IYK  +P ++AWEIR +L++D VC +
Sbjct:   61 DNNQKIINKASNGQ-NINQYGRCFTNGRPLPEELRLEILKLAMENVRPCDISRQLCVSHGCVSKILNRYVKTGSINPGQIGGSKPKVTTPDIVDRVRIYKLNNPQIYAWEIRQKLIEDQVCTE 182          
BLAST of Paired box protein Pax-6 vs. Planmine SMEST
Match: SMESG000080212.1 (SMESG000080212.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.829e-32
Identity = 58/107 (54.21%), Postives = 78/107 (72.90%), Query Frame = 2
Query:  302 INQLGGMFVNGRPLPDMTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVVRKVTIYKQESPSMFAWEIRDRLLQDGVCNQ 622
            +NQ G +F NGRPLP+  R +I++++    RPC+ISR LQVS+GCVSKIL RY  TGSI P  IGGSKP+V T  +V  V  Y++++P +FAWEIR RL+ +G C +
Sbjct:  131 VNQYGRVFTNGRPLPEDLRLKILKMAMENVRPCEISRQLQVSHGCVSKILNRYSRTGSINPGQIGGSKPKVTTPEIVSLVKSYREKNPQIFAWEIRQRLVDEGACTE 237          
The following BLAST results are available for this feature:
BLAST of Paired box protein Pax-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAX68.639e-5879.65paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX67.374e-5676.52paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX67.417e-5676.52paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX68.622e-5676.52paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
PAX68.622e-5676.52paired box 6 [Source:HGNC Symbol;Acc:HGNC:8620][more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-32.339e-5472.32MAB-18 [Source:UniProtKB/TrEMBL;Acc:G5EE71][more]
pax-28.968e-4755.00PAX (Paired box) transcription factor [Source:Uni... [more]
pax-24.826e-4563.06PAX (Paired box) transcription factor [Source:Uni... [more]
egl-385.904e-4553.57PAX protein [Source:UniProtKB/TrEMBL;Acc:G5ED14][more]
pax-15.166e-3757.94PAX (Paired box) transcription factor [Source:Uni... [more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
toy7.823e-5780.36gene:FBgn0019650 transcript:FBtr0339509[more]
toy9.554e-5780.36gene:FBgn0019650 transcript:FBtr0089185[more]
ey1.759e-5478.07gene:FBgn0005558 transcript:FBtr0089236[more]
ey4.425e-5378.38gene:FBgn0005558 transcript:FBtr0100395[more]
ey6.944e-5378.38gene:FBgn0005558 transcript:FBtr0100396[more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax6a5.535e-5876.52paired box 6a [Source:NCBI gene;Acc:30567][more]
pax6a1.192e-5576.52paired box 6a [Source:NCBI gene;Acc:30567][more]
pax6b1.229e-5576.52paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6b1.229e-5576.52paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6a8.790e-5370.08paired box 6a [Source:NCBI gene;Acc:30567][more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax61.157e-5679.46paired box 6 [Source:NCBI gene;Acc:448447][more]
pax62.976e-5679.46paired box 6 [Source:NCBI gene;Acc:448447][more]
pax61.241e-5579.28paired box 6 [Source:NCBI gene;Acc:448447][more]
pax63.487e-5579.28paired box 6 [Source:NCBI gene;Acc:448447][more]
pax61.024e-5378.90paired box 6 [Source:NCBI gene;Acc:448447][more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pax67.725e-5676.52paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax67.725e-5676.52paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax67.725e-5676.52paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax67.725e-5676.52paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
Pax68.267e-5568.22paired box 6 [Source:MGI Symbol;Acc:MGI:97490][more]
back to top
BLAST of Paired box protein Pax-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63016|PAX6_RAT4.590e-5576.52Paired box protein Pax-6 OS=Rattus norvegicus OX=1... [more]
sp|P47238|PAX6_COTJA5.227e-5576.52Paired box protein Pax-6 OS=Coturnix japonica OX=9... [more]
sp|P55864|PAX6_XENLA5.241e-5576.52Paired box protein Pax-6 OS=Xenopus laevis OX=8355... [more]
sp|Q1LZF1|PAX6_BOVIN5.349e-5576.52Paired box protein Pax-6 OS=Bos taurus OX=9913 GN=... [more]
sp|P63015|PAX6_MOUSE5.404e-5576.52Paired box protein Pax-6 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Paired box protein Pax-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8T3920.000e+088.43Pax-6B protein OS=Dugesia japonica OX=6161 GN=pax-... [more]
O967560.000e+085.44DtPax-6 protein OS=Girardia tigrina OX=6162 GN=dtP... [more]
T1DF720.000e+064.01Pax6B OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
Q7YTC06.716e-8445.21Pax6 OS=Saccoglossus kowalevskii OX=10224 PE=2 SV=... [more]
A0A433U7U46.153e-8343.07Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax6a7.421e-5676.99paired box 6 [Source:NCBI gene;Acc:103044317][more]
pax6b8.859e-5675.65paired box 6b [Source:ZFIN;Acc:ZDB-GENE-001031-1][more]
pax6a1.055e-5576.99paired box 6 [Source:NCBI gene;Acc:103044317][more]
pax6a3.721e-5268.50paired box 6 [Source:NCBI gene;Acc:103044317][more]
pax6a3.721e-5268.50paired box 6 [Source:NCBI gene;Acc:103044317][more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pax96.403e-4668.22paired box 9 [Source:ZFIN;Acc:ZDB-GENE-980526-399][more]
pax1a8.995e-4570.09paired box 1a [Source:ZFIN;Acc:ZDB-GENE-070112-182... [more]
dmbx1b1.418e-1654.10diencephalon/mesencephalon homeobox 1b [Source:NCB... [more]
ENSPMAT00000010761.13.751e-1550.00pep scaffold:Pmarinus_7.0:GL476415:928307:936594:-... [more]
barhl21.480e-1139.34BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
PAXB2.666e-5472.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
PAXC1.710e-4867.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
PAXA2.728e-4364.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366233.287e-3958.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325106.595e-3649.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Paired box protein Pax-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001038.21.721e-5677.19paired box protein Pax-6 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000033584.13.922e-5676.52paired box protein Pax-6 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000038302.16.180e-5676.52paired box protein Pax-6 [Source:NCBI gene;Acc:101... [more]
pax6b1.218e-5575.65paired box 6 [Source:NCBI gene;Acc:100049356][more]
pax6b4.617e-5370.40paired box 6 [Source:NCBI gene;Acc:100049356][more]
back to top
BLAST of Paired box protein Pax-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077501.10.000e+0100.00SMESG000077501.1[more]
SMESG000039056.12.314e-6677.52SMESG000039056.1[more]
SMESG000004009.17.481e-4865.04SMESG000004009.1[more]
SMESG000066574.13.876e-3554.47SMESG000066574.1[more]
SMESG000080212.11.829e-3254.21SMESG000080212.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017839 ID=SMED30017839|Name=Paired box protein Pax-6|organism=Schmidtea mediterranea sexual|type=transcript|length=2032bp
CCGATCTTAGTGACAGAAAACTCATTCAACTGTATTGACATTATTGCACT
TCGTCAGCGTCATTGACGATTTGTCGTTTTTATTAATAGTGAACTGTAAA
AATATCCGAAGATCGATAATTATTTCTACTTCAAAGTCAATTCGGTCAGG
TGTAACTTTTTGATTGATTTATTAAACTGGACGAAGTTGACAGATACGTT
TTCATTTCATCTTTAGAAACATTGTATTCAAAATGGTATTTTCCAGTTCT
TCGGATGAAAACATGAAAATCAACAGGAAATTACGAAAAGGACACTCGGG
AATTAATCAGCTTGGTGGAATGTTTGTCAATGGACGACCACTTCCTGACA
TGACTCGTCAACGAATAATTGAATTGTCTCAATCCGGTGCAAGGCCTTGT
GATATTTCTCGAATTCTTCAAGTGTCAAATGGCTGCGTCAGTAAAATCCT
ATGTCGATACTATGAAACAGGTTCAATTAAACCCAAAGCTATAGGTGGCA
GCAAACCTAGAGTCGCTACGAACACAGTTGTACGCAAAGTCACTATTTAC
AAACAGGAAAGTCCATCAATGTTTGCTTGGGAAATCCGTGATCGCTTATT
ACAAGATGGAGTTTGTAACCAGGACAATTTGCCCAGCATTTCATCAATTA
ATAGAATTCTGCGAAGTTTAGCAAATGAATCGCCAACGACTAACCCAACT
TTTAAATCCTCAATAAGCAATTCTCATCAGTTGGCTCTTGCAAGTCAAAA
CAATGGAACAAGTTCTTGCCTACCTCAATATGATTCATTCAATACTTCAA
CAAATAACAATTTCAACTTGCTAAATTCTTCCTCGACATTTATTAATACA
TGGCCGCCCACAAGTGCACCGCCAGTTTTCCCAAATTGGTACTCTCAATC
AGGAATTTCTTCCCTGTGCCATTCAACGTTATTTGGATATAATACACCAA
ATTACTATTCAGCACATTTTTCCGATTATTCTTCATCTCAAATTTCTTTT
GAAGATTCAAAGGCCAGGCTGGTTAACAATTCACACCATGAATCAGTTCG
AGAATCGGCTATGAAATCACTCCTTCAATCCGAGACCGGGGTAGGAAATG
GCTTAAAGATCAATAACGATAAGATTTCTGATTTTAATTCTGATCGTGAG
TCTGAGAACGAAAAAAGGTACTCAAATTCTGAATCTAAAATCAACAAAAA
ATCTCAAAGAAGCCGGACATCATTTACGAATGACCAAATAAATTTGCTGG
AAAAAGAATTTGAACGAACTCATTACCCAGATGTTTTTTCAAGAGAGAAA
TTGTCACAAAATCTCAAAGTCGCGGAGACGAGAATTCAAGTTTGGTTTTC
CAATCGCCGAGCAAAATGGAGAAGAGAAGAAAAAAGTGAAGAGAATAATT
TATCCAATGGATTAATTCGGTCTGATTTATCAAACATGGAACAAGTCTCA
GGAGTTTCAATCGCTTCCAATGATTCAATATTAAACACAAATTCTAATTT
CTTTTCCGATTGCTTTCGAGGAAATTTTACGTCCATGCCCGAAGACATTC
GAAGCAGCTGGAATTCGTTTGGCTCATCATTGTTCCAGCCACCAATTGGG
TGGTATAATAGTGAATCATTTAGCAAGCTGAATCCTGAGCCAGATTCCTA
TAAACTTAGTTTATTTCCTTGCTGTAAACCCTTTTCTCGTCCTCCAAACC
CATTTTACTTAACACCAGATCCAAACTTAAACAACAAAATAGATGAAAAA
TCACACAAACGTGAAAATTCACCGAATGAATTCAATCAGAGTTATTCGAA
TTTTTTTTATCAAAATCTCGATCAAACAAAATCTTTATCCATTATTGGTC
AAGATTTTCAACGAAAATCTCCCGTAGACGACTCAAATTCTTCTTTTCAA
TCACCAAAATGGTGGCCTAATAATTCCATGAATGATCATTATGAACAAGT
TTATCCGGCATGAGAGTATATAAATTCCAAATCGAAATATTAAGCATTTC
TAAAACCAGATATATAAACTTACAGACAGATC
back to top

protein sequence of SMED30017839-orf-1

>SMED30017839-orf-1 ID=SMED30017839-orf-1|Name=SMED30017839-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=577bp
MVFSSSSDENMKINRKLRKGHSGINQLGGMFVNGRPLPDMTRQRIIELSQ
SGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPRVATNTVV
RKVTIYKQESPSMFAWEIRDRLLQDGVCNQDNLPSISSINRILRSLANES
PTTNPTFKSSISNSHQLALASQNNGTSSCLPQYDSFNTSTNNNFNLLNSS
STFINTWPPTSAPPVFPNWYSQSGISSLCHSTLFGYNTPNYYSAHFSDYS
SSQISFEDSKARLVNNSHHESVRESAMKSLLQSETGVGNGLKINNDKISD
FNSDRESENEKRYSNSESKINKKSQRSRTSFTNDQINLLEKEFERTHYPD
VFSREKLSQNLKVAETRIQVWFSNRRAKWRREEKSEENNLSNGLIRSDLS
NMEQVSGVSIASNDSILNTNSNFFSDCFRGNFTSMPEDIRSSWNSFGSSL
FQPPIGWYNSESFSKLNPEPDSYKLSLFPCCKPFSRPPNPFYLTPDPNLN
NKIDEKSHKRENSPNEFNQSYSNFFYQNLDQTKSLSIIGQDFQRKSPVDD
SNSSFQSPKWWPNNSMNDHYEQVYPA*
back to top
Aliases
The feature 'Paired box protein Pax-6' has the following synonyms
Synonym
pax6b-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR043182PAIRED_DNA_bd_dom
IPR001523Paired_dom
IPR001356Homeobox_dom
IPR011991WHTH_DNA-bd_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001523Paired domainPRINTSPR00027PAIREDBOXcoord: 62..79
score: 84.64
coord: 24..39
score: 83.36
coord: 42..60
score: 69.31
coord: 80..97
score: 75.16
IPR001523Paired domainSMARTSM00351pax3coord: 20..144
e-value: 7.6E-89
score: 311.1
IPR001523Paired domainPFAMPF00292PAXcoord: 20..144
e-value: 8.3E-65
score: 216.4
IPR001523Paired domainPROSITEPS51057PAIRED_2coord: 20..146
score: 60.132
IPR001523Paired domainCDDcd00131PAXcoord: 20..147
e-value: 3.87875E-83
score: 253.496
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 324..386
e-value: 4.1E-24
score: 96.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 326..381
e-value: 3.6E-20
score: 71.6
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 322..382
score: 19.888
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 326..383
e-value: 1.30369E-20
score: 83.4468
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 13..88
e-value: 2.9E-40
score: 137.8
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 89..153
e-value: 1.2E-30
score: 106.9
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 309..394
e-value: 2.5E-25
score: 89.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..331
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..324
NoneNo IPR availablePANTHERPTHR45636:SF5PAIRED BOX PROTEIN PAX-6coord: 20..491
NoneNo IPR availablePANTHERPTHR45636FAMILY NOT NAMEDcoord: 20..491
IPR043182Paired DNA-binding domainPROSITEPS00034PAIRED_1coord: 54..70
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 357..380
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 22..145
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 321..384