Phosphoinositide phospholipase C

Overview
NamePhosphoinositide phospholipase C
Smed IDSMED30017837
Length (bp)3465
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoinositide phospholipase C (SMED30017837) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoinositide phospholipase C (SMED30017837) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoinositide phospholipase C (SMED30017837) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoinositide phospholipase C (SMED30017837) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017837

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30017837SMESG000046236.1 SMESG000046214.1 SMESG000046192.1 SMESG000046181.1 SMESG000046159.1 dd_Smed_v4_6102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017837SMESG000046236.1 SMESG000046214.1 SMESG000046192.1 SMESG000046181.1 SMESG000046159.1 dd_Smed_v4_6102_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCL2 (phospholipase C like 2 [Source:HGNC Symbol;Acc:HGNC:9064])

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 438/1063 (41.20%), Postives = 650/1063 (61.15%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDD-KNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS-RQKVSRTRKISNAP--KMKLMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            KKTVSFSS P E  K I S  DC++ M  GS++ K+  N R Y R F LD     +RW PS K   KAKI I  I+E+R G        +GI   +SE CAF+++YG  ++SL L+A SA+ AN+W+ GL  LI+    +   D+L+  ++  R  W+ ++FSE D  N G +   + +Q +++LN G+ T +I+ K KE+   +      +T EEF+ VF E+ TRPEI+FLL+++S+N EFL  +DL++FLEAEQG+  I +E  +E+I  YEPS EG++KG L IDGFT+YL+S +C IFDPE+  VCQDM QPL HYFI +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S YPLI+ +ENHCS++QQ ++   +K  LG  +Y  +PN  E   PSPD LK +I++  KKL    ++ C  +G E         G V++EDE  E S R       + +N P  + +L   LS++  I     F  F                   +   +   W  EV   +E+ A + ANE+   F+ +NK  L  V+P+  R+DSSN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N   P+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FEC+QTGYRH+ L + TGEV+ +A LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I  +DEVFK A P +++  ++R+   +A+ + +E C L   +N+ QC+ A+          SP                                    + P+ +   SE +P   +        +P+ LKK +  +D ++ + K++ + +D++ EKI  C+K AMEF+E L  +     +K RK  +A E+F WN+ +++GQ+DL+   + + + +L+       + G+
Sbjct:  119 KKTVSFSSMPTE--KKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLIS--YGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDVLKGKILIKAKKL----SSNC--SGVE---------GDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQFKEFQ------------------VSFQVQKYW--EVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAV----------SPRFLGP------------------------------DNTPLVVLNLSEQYPTMELQ-----GIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGL 1097          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCL2 (phospholipase C like 2 [Source:HGNC Symbol;Acc:HGNC:9064])

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 438/1063 (41.20%), Postives = 650/1063 (61.15%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDD-KNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS-RQKVSRTRKISNAP--KMKLMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            KKTVSFSS P E  K I S  DC++ M  GS++ K+  N R Y R F LD     +RW PS K   KAKI I  I+E+R G        +GI   +SE CAF+++YG  ++SL L+A SA+ AN+W+ GL  LI+    +   D+L+  ++  R  W+ ++FSE D  N G +   + +Q +++LN G+ T +I+ K KE+   +      +T EEF+ VF E+ TRPEI+FLL+++S+N EFL  +DL++FLEAEQG+  I +E  +E+I  YEPS EG++KG L IDGFT+YL+S +C IFDPE+  VCQDM QPL HYFI +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S YPLI+ +ENHCS++QQ ++   +K  LG  +Y  +PN  E   PSPD LK +I++  KKL    ++ C  +G E         G V++EDE  E S R       + +N P  + +L   LS++  I     F  F                   +   +   W  EV   +E+ A + ANE+   F+ +NK  L  V+P+  R+DSSN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N   P+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FEC+QTGYRH+ L + TGEV+ +A LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I  +DEVFK A P +++  ++R+   +A+ + +E C L   +N+ QC+ A+          SP                                    + P+ +   SE +P   +        +P+ LKK +  +D ++ + K++ + +D++ EKI  C+K AMEF+E L  +     +K RK  +A E+F WN+ +++GQ+DL+   + + + +L+       + G+
Sbjct:  119 KKTVSFSSMPTE--KKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLIS--YGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDVLKGKILIKAKKL----SSNC--SGVE---------GDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQFKEFQ------------------VSFQVQKYW--EVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAV----------SPRFLGP------------------------------DNTPLVVLNLSEQYPTMELQ-----GIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGL 1097          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCL2 (phospholipase C like 2 [Source:HGNC Symbol;Acc:HGNC:9064])

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 428/1049 (40.80%), Postives = 640/1049 (61.01%), Query Frame = 2
Query:  134 KNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDD-KNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS-RQKVSRTRKISNAP--KMKLMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            K I S  DC++ M  GS++ K+  N R Y R F LD     +RW PS K   KAKI I  I+E+R G        +GI   +SE CAF+++YG  ++SL L+A SA+ AN+W+ GL  LI+    +   D+L+  ++  R  W+ ++FSE D  N G +   + +Q +++LN G+ T +I+ K KE+   +      +T EEF+ VF E+ TRPEI+FLL+++S+N EFL  +DL++FLEAEQG+  I +E  +E+I  YEPS EG++KG L IDGFT+YL+S +C IFDPE+  VCQDM QPL HYFI +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S YPLI+ +ENHCS++QQ ++   +K  LG  +Y  +PN  E   PSPD LK +I++  KKL    ++ C  +G E         G V++EDE  E S R       + +N P  + +L   LS++  I     F  F                   +   +   W  EV   +E+ A + ANE+   F+ +NK  L  V+P+  R+DSSN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N   P+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FEC+QTGYRH+ L + TGEV+ +A LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I  +DEVFK A P +++  ++R+   +A+ + +E C L   +N+ QC+ A+          SP                                    + P+ +   SE +P   +        +P+ LKK +  +D ++ + K++ + +D++ EKI  C+K AMEF+E L  +     +K RK  +A E+F WN+ +++GQ+DL+   + + + +L+       + G+
Sbjct:    5 KKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLIS--YGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDVLKGKILIKAKKL----SSNC--SGVE---------GDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQFKEFQ------------------VSFQVQKYW--EVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAV----------SPRFLGP------------------------------DNTPLVVLNLSEQYPTMELQ-----GIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGL 971          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCL2 (phospholipase C like 2 [Source:HGNC Symbol;Acc:HGNC:9064])

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 428/1049 (40.80%), Postives = 640/1049 (61.01%), Query Frame = 2
Query:  134 KNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDD-KNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS-RQKVSRTRKISNAP--KMKLMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            K I S  DC++ M  GS++ K+  N R Y R F LD     +RW PS K   KAKI I  I+E+R G        +GI   +SE CAF+++YG  ++SL L+A SA+ AN+W+ GL  LI+    +   D+L+  ++  R  W+ ++FSE D  N G +   + +Q +++LN G+ T +I+ K KE+   +      +T EEF+ VF E+ TRPEI+FLL+++S+N EFL  +DL++FLEAEQG+  I +E  +E+I  YEPS EG++KG L IDGFT+YL+S +C IFDPE+  VCQDM QPL HYFI +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S YPLI+ +ENHCS++QQ ++   +K  LG  +Y  +PN  E   PSPD LK +I++  KKL    ++ C  +G E         G V++EDE  E S R       + +N P  + +L   LS++  I     F  F                   +   +   W  EV   +E+ A + ANE+   F+ +NK  L  V+P+  R+DSSN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N   P+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FEC+QTGYRH+ L + TGEV+ +A LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I  +DEVFK A P +++  ++R+   +A+ + +E C L   +N+ QC+ A+          SP                                    + P+ +   SE +P   +        +P+ LKK +  +D ++ + K++ + +D++ EKI  C+K AMEF+E L  +     +K RK  +A E+F WN+ +++GQ+DL+   + + + +L+       + G+
Sbjct:    5 KKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLIS--YGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDVLKGKILIKAKKL----SSNC--SGVE---------GDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQFKEFQ------------------VSFQVQKYW--EVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAV----------SPRFLGP------------------------------DNTPLVVLNLSEQYPTMELQ-----GIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGL 971          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Match: PLCL1 (phospholipase C like 1 (inactive) [Source:HGNC Symbol;Acc:HGNC:9063])

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 421/1055 (39.91%), Postives = 629/1055 (59.62%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS--LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGI-PDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            KKTVSFSS P E  K I S  DC+ +M  G ++ K+ PN R Y R F LD     +RW PS K   KAK+ I  I+EIR G        +G+      +CAF+I++G  ++SL L+A SA+ AN+W++GL R +  RS++    +  ++N  R  WL+ VF  AD    G + E   ++L+K LN  +   +I+ K KE+   +     R+T EEF   F E+ TRPE++FLL++ S N E+L   DL+LFLEAEQG+T IT++ C+++I+ YE S EG+QKG L IDGFT YLLS  CDIFDPE   V QDM QPL HY+I AS+NTYL+EDQ +GP+ +NG+IRAL +GCR +++D  DG+++EPI+ + N +T+ ++ R  +E I+K+AFV+S YPLI+ + NHCS+ QQ ++   +K   G  +Y   P  SE   PSP++LK  II+ GKKL   P          D+  G      V++EDE  E SR+            +++L   LSD+  I                  + Q    + S+ S    E+   SE  A R+ANE+ + F+ +NK  L  +YP+  R+DSSN NPQD WNCGCQIVA+N+QT G MMDL  G+F +NG CGYVL+P IMR ++     +  GI P + P  LHI++IS Q  PKP+G+ +KG+VIDPYV I++ G P DCSE++T+TV  N+ NP+FDE+FEF+V + ++A++RF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L +  G+++ +  LFVH+AITN+ GGGK  KR +SV+   K +    ++ +G+  ID++FK A   L+E  +MR+   +A+ +++E C LP  +++KQC+  + +  I++ ++                                        P    +  + FP     +      +PD  KK +  +D ++   + + +++D++QEKI  C+K  MEF+E L  L     +K RK  +A E+F WN+ +++GQ DL+   + +A+ +++  +    + G+
Sbjct:   17 KKTVSFSSMPSE--KKISSANDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADVANIWVSGL-RYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDICLDIIRRYELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIEDQFRGPADINGYIRALKMGCRSVELDVSDGSDNEPILCNRNNMTTHVSFRSVIEVINKFAFVASEYPLILCLGNHCSLPQQKVMAQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVKGKKLPSDP----------DVLEGE-----VTDEDEEAEMSRRMSVDYN--GEQKQIRLCRELSDLVSI----------------CKSVQYRDFELSMKSQNYWEMCSFSETEASRIANEYPEDFVNYNKKFLSRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGILPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQQNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVSIKELCGLPPIASLKQCLLTLSSRLITSDNT----------------------------------------PSVSLVMKDSFP-----YLEPLGAIPDVQKKMLTAYDLMIQESRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIENMKQIQLACLSCGL 990          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: pll-1 (Phosphoinositide phospholipase C [Source:UniProtKB/TrEMBL;Acc:Q8IA76])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 424/1068 (39.70%), Postives = 619/1068 (57.96%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS--------LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDI-QRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWD----GANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEW------PSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMF--YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSE-DFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGML 3229
            +KTVSFSS        I +  DC +YM  GSD +K+    RQ++R F LD   + +RW P+NKK +KA+I ID+IREIR G     + S          EC F+I+YG  +++L LIA+S ++AN+W+ GL  L + + +   S         R++W++ VF E D +  G LDE    + +  +NS ++  R+  KLKEV I     +RG++    FV+++KEI TRPE++FL++RY+N  ++LS +DL LFLE EQGM G+T + C  LI+ YEP SE ++   + +DGFTS+L S +C +FDP + VV  DM QP   YFI++S  +YL+EDQL GPSS +GF  AL   CR+++ D WD      + EP++ +G T TSK+ +   L  I ++AF  S YPL++ +  HCS   Q +   L+   LG  +Y+   + + W      P+P   + RI++VGKKL D P                T+ G VSEED+++       S TR+ S   +++L   LSD+   + N    +D L         A  S T+    N      ++ ++E   +RL + ++  F    ++  V V+PN +RVDSSN NPQ+ WN G Q+V LNYQT GLMMDL  G FS NG CGYVLKP++M+  + +     D +P   PQ LH+R++S QQLP+PRGS +KG+  DP+VV+++ G P DC+EE+TRTV  ++ NP FDESF+F+V+V ++ALVRFLVLDDD IGDDFIGQYTI FEC+Q GYRHI LLNN G+ + +A LFVHVAITN+RGGGK  KRG+SVK R   + +  +K +GI  +D+ FK A   L E   +R    +AM + +E C L     I+Q IR I +  I+      L  NS+                          + +S  P+ +  + E  +P  +         LPD L++S      ++  C +    SD L  KI+   ++  E +E L +LC    +K +KATRAAENF WN+RL++ Q +L++K +++A + +    +TG   G+L
Sbjct:   51 RKTVSFSSK--NSDAKISNVSDCWNYMQTGSDFVKLRGTNRQFRRFFSLDADLSYIRWTPTNKKPHKARIAIDEIREIRLGKNTELLRSSDEVFTDLQEECLFSIIYGDNYETLDLIASSGDDANIWVTGLMALTSNKYECKPSS--SQFATLRERWIESVFDEFDTKKNGHLDEQTAFKAILHINSRISHHRLTNKLKEVTIGAEESERGKIEKSHFVDLYKEIGTRPEVYFLMVRYANK-DYLSCQDLRLFLETEQGMVGVTTDNCETLIEQYEPCSEARENNLMTVDGFTSFLFSPDCGVFDPNHRVVTMDMKQPFSRYFISSSRKSYLVEDQL-GPSSSDGFSSALKRNCRFLEFDIWDPNEADGDTEPMVQNGQTATSKITISSALRIIREFAFERSRYPLLLKVSVHCSTDWQKVAAMLIVTHLGTRLYLPKNDPTNWDDEKNCPTPWDFQNRILIVGKKL-DNP---------------DTDSGEVSEEDDSL------ASTTRRKSK--RIQLCKELSDLVPVFFNVKTLNDLLST-------APGSTTMSSRKN------LASVTESTCLRLMHTYATEFGQATRNYCVRVFPNPSRVDSSNLNPQEFWNNGVQMVCLNYQTPGLMMDLQEGKFSDNGGCGYVLKPQVMKDDMFVP---SDRVP-TSPQILHLRILSGQQLPRPRGSNAKGDSADPFVVVEVFGLPGDCAEERTRTVRNDSINPSFDESFQFQVSVPELALVRFLVLDDDYIGDDFIGQYTIPFECLQPGYRHIYLLNNEGDPLEHATLFVHVAITNRRGGGKAKKRGMSVK-RKNSRISSGMKLVGIKSVDDQFKVAVVPLAESTAIRNRLENAMIDWQEECGLGPAGTIRQGIRLIHSRMIT------LAVNSSPPPS-----------------PTTSSAESSVTPLFIIDSDEHGYPAIVTMGT-----LPDQLQRSFNKLKNLIAHCVTTLSQSDQLLSKIEDSIRRISECHEELSKLCAEAGLKGQKATRAAENFTWNLRLLKAQLNLMNKSQEEAQDVVTQVFDTGGVLGVL 1042          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: pll-1 (Phosphoinositide phospholipase C [Source:UniProtKB/TrEMBL;Acc:Q8IA76])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 424/1068 (39.70%), Postives = 619/1068 (57.96%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS--------LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDI-QRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWD----GANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEW------PSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMF--YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSE-DFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGML 3229
            +KTVSFSS        I +  DC +YM  GSD +K+    RQ++R F LD   + +RW P+NKK +KA+I ID+IREIR G     + S          EC F+I+YG  +++L LIA+S ++AN+W+ GL  L + + +   S         R++W++ VF E D +  G LDE    + +  +NS ++  R+  KLKEV I     +RG++    FV+++KEI TRPE++FL++RY+N  ++LS +DL LFLE EQGM G+T + C  LI+ YEP SE ++   + +DGFTS+L S +C +FDP + VV  DM QP   YFI++S  +YL+EDQL GPSS +GF  AL   CR+++ D WD      + EP++ +G T TSK+ +   L  I ++AF  S YPL++ +  HCS   Q +   L+   LG  +Y+   + + W      P+P   + RI++VGKKL D P                T+ G VSEED+++       S TR+ S   +++L   LSD+   + N    +D L         A  S T+    N      ++ ++E   +RL + ++  F    ++  V V+PN +RVDSSN NPQ+ WN G Q+V LNYQT GLMMDL  G FS NG CGYVLKP++M+  + +     D +P   PQ LH+R++S QQLP+PRGS +KG+  DP+VV+++ G P DC+EE+TRTV  ++ NP FDESF+F+V+V ++ALVRFLVLDDD IGDDFIGQYTI FEC+Q GYRHI LLNN G+ + +A LFVHVAITN+RGGGK  KRG+SVK R   + +  +K +GI  +D+ FK A   L E   +R    +AM + +E C L     I+Q IR I +  I+      L  NS+                          + +S  P+ +  + E  +P  +         LPD L++S      ++  C +    SD L  KI+   ++  E +E L +LC    +K +KATRAAENF WN+RL++ Q +L++K +++A + +    +TG   G+L
Sbjct:   58 RKTVSFSSK--NSDAKISNVSDCWNYMQTGSDFVKLRGTNRQFRRFFSLDADLSYIRWTPTNKKPHKARIAIDEIREIRLGKNTELLRSSDEVFTDLQEECLFSIIYGDNYETLDLIASSGDDANIWVTGLMALTSNKYECKPSS--SQFATLRERWIESVFDEFDTKKNGHLDEQTAFKAILHINSRISHHRLTNKLKEVTIGAEESERGKIEKSHFVDLYKEIGTRPEVYFLMVRYANK-DYLSCQDLRLFLETEQGMVGVTTDNCETLIEQYEPCSEARENNLMTVDGFTSFLFSPDCGVFDPNHRVVTMDMKQPFSRYFISSSRKSYLVEDQL-GPSSSDGFSSALKRNCRFLEFDIWDPNEADGDTEPMVQNGQTATSKITISSALRIIREFAFERSRYPLLLKVSVHCSTDWQKVAAMLIVTHLGTRLYLPKNDPTNWDDEKNCPTPWDFQNRILIVGKKL-DNP---------------DTDSGEVSEEDDSL------ASTTRRKSK--RIQLCKELSDLVPVFFNVKTLNDLLST-------APGSTTMSSRKN------LASVTESTCLRLMHTYATEFGQATRNYCVRVFPNPSRVDSSNLNPQEFWNNGVQMVCLNYQTPGLMMDLQEGKFSDNGGCGYVLKPQVMKDDMFVP---SDRVP-TSPQILHLRILSGQQLPRPRGSNAKGDSADPFVVVEVFGLPGDCAEERTRTVRNDSINPSFDESFQFQVSVPELALVRFLVLDDDYIGDDFIGQYTIPFECLQPGYRHIYLLNNEGDPLEHATLFVHVAITNRRGGGKAKKRGMSVK-RKNSRISSGMKLVGIKSVDDQFKVAVVPLAESTAIRNRLENAMIDWQEECGLGPAGTIRQGIRLIHSRMIT------LAVNSSPPPS-----------------PTTSSAESSVTPLFIIDSDEHGYPAIVTMGT-----LPDQLQRSFNKLKNLIAHCVTTLSQSDQLLSKIEDSIRRISECHEELSKLCAEAGLKGQKATRAAENFTWNLRLLKAQLNLMNKSQEEAQDVVTQVFDTGGVLGVL 1049          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: plc-4 (Phosphoinositide phospholipase C [Source:UniProtKB/TrEMBL;Acc:Q21754])

HSP 1 Score: 202.986 bits (515), Expect = 4.650e-54
Identity = 127/398 (31.91%), Postives = 214/398 (53.77%), Query Frame = 2
Query:  299 IPIDDIREIRHGIAKSGI------YSLSECA-----FTIVYG---IEFDSLCLIAASAEEANVWIAGLTRLIA-GRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYS-NNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQL-GIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWP--SPDQLKYRIILVGKKL 1435
            + + ++ E+R G     +      Y   E A     F++++        S+   A S E  + W++ LT LI+  + QR         N+T   WL + F +AD    G L   +V  L+K +N  ++    K   +E + +   D  +L  +EF+N F+ ++ RP++ F++ + S +N E L++ DL  FL  EQG   +  +   +++ T+E + + KQK +L G+ G    + S   ++F P +  + QDM+QPL HYF+ +S+NTYL   Q+KG ++V G+I AL  G R +++D +DG + EP+I H  T    + LR +LE I + AF +S YP+I+ +ENH    QQ ++  L K  LG  +Y+   +S   P  SP++LK + +L GKK+
Sbjct:   74 VALSELLEVRSGYQTDNLQRASKKYEFQELAPESRCFSVIFSHAKFLHKSVDFSADSKETRDKWVSVLTHLISVAKHQRVVF------NET--AWLIDKFQQADTNKNGLLSFDEVWNLLKRMNLQISERYAKAIFRESEFENSRD-NKLNEKEFLNFFERLTDRPDLRFVMTQASSDNVETLTVADLQRFLTEEQGFENVDLKKAEQILTTFEQTVQDKQKEKLMGLMGMRRLMQSRWGNVFKPGHESIFQDMDQPLTHYFVNSSHNTYLTGLQVKGEATVEGYISALRKGARLLELDLFDGEHGEPVITHKRTFIESITLRNSLEAIKRTAFETSPYPVILTLENHVGFVQQAVMADLFKEILGDSLYIPPKDSHRHPLSSPNKLKRKFLLRGKKI 462          

HSP 2 Score: 151.369 bits (381), Expect = 3.218e-37
Identity = 88/221 (39.82%), Postives = 128/221 (57.92%), Query Frame = 2
Query: 1802 HNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGI-PDILPQ---TLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSI-GDDFIGQYTISFECIQTGYRHIRLLNNTG---EVIPNAYLFVHVAI 2440
            +    LV  YP   R DSSN +P   W CG Q VA+N+QT G  +DL+AG F  NGNCGYVLKP  +           DG+ P  + +    L I + SAQ LPK   S     +IDPYV +Q+ G P D ++ KTR +  N +NP + ++F F ++  ++A++RF V D DS   +DF+G+++I    ++TG+  I+L  NTG    + P+A LFV +A+
Sbjct:  542 YTAERLVKSYPKGLRQDSSNMHPMVSWLCGIQSVAMNFQTAGEELDLNAGLFRINGNCGYVLKPSCLL----------DGVDPRSMAKPKLKLGIGLFSAQYLPK---SEPGKEIIDPYVSVQIFGIPRDETKAKTRIIKDNGFNPEWRDNFYFTLSCPELAIIRFCVKDFDSTSSNDFVGEFSIPVMSLRTGFSQIQL--NTGYQHTLDPSASLFVRIAM 747          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: plc-1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFI8])

HSP 1 Score: 154.451 bits (389), Expect = 1.822e-37
Identity = 77/193 (39.90%), Postives = 118/193 (61.14%), Query Frame = 2
Query:  779 SNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQ-DMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFI 1354
            ++    L+ + L  F+   Q M  I ++  ++LIQ +EP    +QK Q+  +GFT +L       F PE +   + D+  PL HY+I +S+NTYL   QLKGPSS   + + L  GCR +++DCWDG +  P+IYHG+TL SK+  R+ +E I K AF++S  P+I++IENHCS++QQ  +  + K  LG  +
Sbjct:  854 TSRSSMLTPQMLRAFVNTHQ-MEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAFVPETIEPDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLL 1045          

HSP 2 Score: 116.701 bits (291), Expect = 5.902e-26
Identity = 73/241 (30.29%), Postives = 122/241 (50.62%), Query Frame = 2
Query: 1733 EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHH---KDGIP---DILPQT---LHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFV 2428
            +V+ L+E  A +L   H    + + + +L+  YP+    DSSN+NP + W  G Q+VALN+QT  ++M ++   F ++GNCGY LKP     + L D  H      +P   DI   +   L++ +IS Q +          +    YV I++ G   DC  EK++ V  N+ NP+++ + +  +A   +A +R  V D    G   +    +  +CI+ G+RH+ L   T   I NA +F+
Sbjct: 1314 QVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQLKP-----RCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHV------YPNTHYASLYVEIEVIGIHNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNG-RVVAHRVVPVKCIRPGFRHLPLRTPTNLPIDNAMIFL 1542          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Match: plc-1 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFI8])

HSP 1 Score: 154.066 bits (388), Expect = 1.879e-37
Identity = 77/193 (39.90%), Postives = 118/193 (61.14%), Query Frame = 2
Query:  779 SNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQ-DMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFI 1354
            ++    L+ + L  F+   Q M  I ++  ++LIQ +EP    +QK Q+  +GFT +L       F PE +   + D+  PL HY+I +S+NTYL   QLKGPSS   + + L  GCR +++DCWDG +  P+IYHG+TL SK+  R+ +E I K AF++S  P+I++IENHCS++QQ  +  + K  LG  +
Sbjct:  843 TSRSSMLTPQMLRAFVNTHQ-MEQIDEQTAIKLIQDHEPDGICRQKNQMSFEGFTRFLCDPVNFAFVPETIEPDEEDLRYPLSHYYINSSHNTYLTGHQLKGPSSSEMYRQVLLTGCRCVELDCWDGDDGLPLIYHGHTLVSKIGFRQVVEIIKKSAFITSDLPVILSIENHCSLQQQAKMAQMFKTVLGDLL 1034          

HSP 2 Score: 116.701 bits (291), Expect = 5.457e-26
Identity = 73/241 (30.29%), Postives = 122/241 (50.62%), Query Frame = 2
Query: 1733 EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHH---KDGIP---DILPQT---LHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFV 2428
            +V+ L+E  A +L   H    + + + +L+  YP+    DSSN+NP + W  G Q+VALN+QT  ++M ++   F ++GNCGY LKP     + L D  H      +P   DI   +   L++ +IS Q +          +    YV I++ G   DC  EK++ V  N+ NP+++ + +  +A   +A +R  V D    G   +    +  +CI+ G+RH+ L   T   I NA +F+
Sbjct: 1303 QVTSLNENAAKKLMKRHPAKCVSYTRDHLIRTYPSAKHYDSSNFNPINCWAHGMQMVALNFQTPDVIMAVNQAMFEQSGNCGYQLKP-----RCLWDESHLLYNKFLPLSKDIAGHSALLLNLTIISGQHV------YPNTHYASLYVEIEVIGIHNDCVREKSKVVQRNSVNPIWNHTTQLRIACVDLAFLRIAVCDSGQNG-RVVAHRVVPVKCIRPGFRHLPLRTPTNLPIDNAMIFL 1531          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: Plc21C (gene:FBgn0004611 transcript:FBtr0078050)

HSP 1 Score: 159.844 bits (403), Expect = 3.059e-39
Identity = 112/380 (29.47%), Postives = 183/380 (48.16%), Query Frame = 2
Query:  293 AKIPIDDIREIRHGIAKSGIYSLSECAFTIVYGIEFDSLCLI---AASAEEANVWIAGLTRLIAGRSQRGESDVL-------------DDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEI--FFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEF--------CMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFI 1354
            AK P D+  ++R  +      +L E   T+ +G +F ++  +       + A +W  GL +L    +Q   S ++             D   +   K + ++F++     K     LDV      L SG        K+  + +       +   E+F N++K ++ R E+   F  I  ++  + +SI  L+ FL   Q    + +            ELIQ YEP+    QKGQL +DGF  YL+  +  I  P  L +C DM+QP+ HYFI +S+NTYL   QL G SSV  + + L  GCR +++D W+G  +EP+I HG T   ++  +  LE I++ AF +S YP+I++ ENHC+ RQQ  + +  +   G  +
Sbjct:   76 AKRPKDN--KLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCTRRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNKEDRKRVEKALDVT----GLPSG--------KVDSISV------SKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRKCMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRYLMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCRCVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQAKIANYCREIFGDML 435          

HSP 2 Score: 143.665 bits (361), Expect = 3.088e-34
Identity = 89/243 (36.63%), Postives = 126/243 (51.85%), Query Frame = 2
Query: 1733 EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQ-LLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEK--TRTVNGNAYNPVFDES-FEF-EVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            E+S   E  A  L  E    F+ +NK  L  VYP  TR DSSN+ PQ  WN GCQ+VALN+QT+ L M L+ G F  N   GY+LKPE MR     LD   +  +  I+  T+ I V+S Q L   R +T        +V + + G P D   +K  T+TV  N  NP++DE  F F +V + ++A +R    ++   G   IG   +    +  GYRH+ L +  G+ I  A LF+ V + +
Sbjct:  625 EMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRRLDPFAESTVDGIIAGTVSITVLSGQFLTDKRANT--------FVEVDMYGLPADTVRKKFRTKTVRDNGMNPLYDEEPFVFKKVVLPELASIRIAAYEE---GGKLIGHRVLPVIGLCPGYRHVNLRSEVGQPIALASLFLCVVVKD 856          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: Plc21C (gene:FBgn0004611 transcript:FBtr0078048)

HSP 1 Score: 159.844 bits (403), Expect = 3.123e-39
Identity = 112/380 (29.47%), Postives = 183/380 (48.16%), Query Frame = 2
Query:  293 AKIPIDDIREIRHGIAKSGIYSLSECAFTIVYGIEFDSLCLI---AASAEEANVWIAGLTRLIAGRSQRGESDVL-------------DDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEI--FFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEF--------CMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFI 1354
            AK P D+  ++R  +      +L E   T+ +G +F ++  +       + A +W  GL +L    +Q   S ++             D   +   K + ++F++     K     LDV      L SG        K+  + +       +   E+F N++K ++ R E+   F  I  ++  + +SI  L+ FL   Q    + +            ELIQ YEP+    QKGQL +DGF  YL+  +  I  P  L +C DM+QP+ HYFI +S+NTYL   QL G SSV  + + L  GCR +++D W+G  +EP+I HG T   ++  +  LE I++ AF +S YP+I++ ENHC+ RQQ  + +  +   G  +
Sbjct:   76 AKRPKDN--KLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCTRRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNKEDRKRVEKALDVT----GLPSG--------KVDSISV------SKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRKCMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRYLMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCRCVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQAKIANYCREIFGDML 435          

HSP 2 Score: 143.665 bits (361), Expect = 3.526e-34
Identity = 89/243 (36.63%), Postives = 126/243 (51.85%), Query Frame = 2
Query: 1733 EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQ-LLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEK--TRTVNGNAYNPVFDES-FEF-EVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            E+S   E  A  L  E    F+ +NK  L  VYP  TR DSSN+ PQ  WN GCQ+VALN+QT+ L M L+ G F  N   GY+LKPE MR     LD   +  +  I+  T+ I V+S Q L   R +T        +V + + G P D   +K  T+TV  N  NP++DE  F F +V + ++A +R    ++   G   IG   +    +  GYRH+ L +  G+ I  A LF+ V + +
Sbjct:  625 EMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRRLDPFAESTVDGIIAGTVSITVLSGQFLTDKRANT--------FVEVDMYGLPADTVRKKFRTKTVRDNGMNPLYDEEPFVFKKVVLPELASIRIAAYEE---GGKLIGHRVLPVIGLCPGYRHVNLRSEVGQPIALASLFLCVVVKD 856          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: Plc21C (gene:FBgn0004611 transcript:FBtr0078047)

HSP 1 Score: 159.844 bits (403), Expect = 3.123e-39
Identity = 112/380 (29.47%), Postives = 183/380 (48.16%), Query Frame = 2
Query:  293 AKIPIDDIREIRHGIAKSGIYSLSECAFTIVYGIEFDSLCLI---AASAEEANVWIAGLTRLIAGRSQRGESDVL-------------DDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEI--FFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEF--------CMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFI 1354
            AK P D+  ++R  +      +L E   T+ +G +F ++  +       + A +W  GL +L    +Q   S ++             D   +   K + ++F++     K     LDV      L SG        K+  + +       +   E+F N++K ++ R E+   F  I  ++  + +SI  L+ FL   Q    + +            ELIQ YEP+    QKGQL +DGF  YL+  +  I  P  L +C DM+QP+ HYFI +S+NTYL   QL G SSV  + + L  GCR +++D W+G  +EP+I HG T   ++  +  LE I++ AF +S YP+I++ ENHC+ RQQ  + +  +   G  +
Sbjct:   76 AKRPKDN--KLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCTRRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNKEDRKRVEKALDVT----GLPSG--------KVDSISV------SKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRKCMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRYLMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCRCVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQAKIANYCREIFGDML 435          

HSP 2 Score: 143.665 bits (361), Expect = 3.526e-34
Identity = 89/243 (36.63%), Postives = 126/243 (51.85%), Query Frame = 2
Query: 1733 EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQ-LLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEK--TRTVNGNAYNPVFDES-FEF-EVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            E+S   E  A  L  E    F+ +NK  L  VYP  TR DSSN+ PQ  WN GCQ+VALN+QT+ L M L+ G F  N   GY+LKPE MR     LD   +  +  I+  T+ I V+S Q L   R +T        +V + + G P D   +K  T+TV  N  NP++DE  F F +V + ++A +R    ++   G   IG   +    +  GYRH+ L +  G+ I  A LF+ V + +
Sbjct:  625 EMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRRLDPFAESTVDGIIAGTVSITVLSGQFLTDKRANT--------FVEVDMYGLPADTVRKKFRTKTVRDNGMNPLYDEEPFVFKKVVLPELASIRIAAYEE---GGKLIGHRVLPVIGLCPGYRHVNLRSEVGQPIALASLFLCVVVKD 856          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: Plc21C (gene:FBgn0004611 transcript:FBtr0330674)

HSP 1 Score: 159.458 bits (402), Expect = 4.086e-39
Identity = 112/380 (29.47%), Postives = 183/380 (48.16%), Query Frame = 2
Query:  293 AKIPIDDIREIRHGIAKSGIYSLSECAFTIVYGIEFDSLCLI---AASAEEANVWIAGLTRLIAGRSQRGESDVL-------------DDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEI--FFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEF--------CMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFI 1354
            AK P D+  ++R  +      +L E   T+ +G +F ++  +       + A +W  GL +L    +Q   S ++             D   +   K + ++F++     K     LDV      L SG        K+  + +       +   E+F N++K ++ R E+   F  I  ++  + +SI  L+ FL   Q    + +            ELIQ YEP+    QKGQL +DGF  YL+  +  I  P  L +C DM+QP+ HYFI +S+NTYL   QL G SSV  + + L  GCR +++D W+G  +EP+I HG T   ++  +  LE I++ AF +S YP+I++ ENHC+ RQQ  + +  +   G  +
Sbjct:   76 AKRPKDN--KLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCTRRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNKEDRKRVEKALDVT----GLPSG--------KVDSISV------SKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRKCMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRYLMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCRCVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQAKIANYCREIFGDML 435          

HSP 2 Score: 143.665 bits (361), Expect = 3.307e-34
Identity = 89/243 (36.63%), Postives = 126/243 (51.85%), Query Frame = 2
Query: 1733 EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQ-LLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEK--TRTVNGNAYNPVFDES-FEF-EVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            E+S   E  A  L  E    F+ +NK  L  VYP  TR DSSN+ PQ  WN GCQ+VALN+QT+ L M L+ G F  N   GY+LKPE MR     LD   +  +  I+  T+ I V+S Q L   R +T        +V + + G P D   +K  T+TV  N  NP++DE  F F +V + ++A +R    ++   G   IG   +    +  GYRH+ L +  G+ I  A LF+ V + +
Sbjct:  625 EMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRRLDPFAESTVDGIIAGTVSITVLSGQFLTDKRANT--------FVEVDMYGLPADTVRKKFRTKTVRDNGMNPLYDEEPFVFKKVVLPELASIRIAAYEE---GGKLIGHRVLPVIGLCPGYRHVNLRSEVGQPIALASLFLCVVVKD 856          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Match: Plc21C (gene:FBgn0004611 transcript:FBtr0078049)

HSP 1 Score: 159.458 bits (402), Expect = 4.104e-39
Identity = 112/380 (29.47%), Postives = 183/380 (48.16%), Query Frame = 2
Query:  293 AKIPIDDIREIRHGIAKSGIYSLSECAFTIVYGIEFDSLCLI---AASAEEANVWIAGLTRLIAGRSQRGESDVL-------------DDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEI--FFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEF--------CMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFI 1354
            AK P D+  ++R  +      +L E   T+ +G +F ++  +       + A +W  GL +L    +Q   S ++             D   +   K + ++F++     K     LDV      L SG        K+  + +       +   E+F N++K ++ R E+   F  I  ++  + +SI  L+ FL   Q    + +            ELIQ YEP+    QKGQL +DGF  YL+  +  I  P  L +C DM+QP+ HYFI +S+NTYL   QL G SSV  + + L  GCR +++D W+G  +EP+I HG T   ++  +  LE I++ AF +S YP+I++ ENHC+ RQQ  + +  +   G  +
Sbjct:   76 AKRPKDN--KLRQIVTLGPQDTLEEKTVTVCHGSDFVNMTFVNFCCTRRDIAQLWTDGLIKLAYSLAQLNGSAIMFLQKAHTKLCLQVDKSGRIPVKNIIKLFAQNKEDRKRVEKALDVT----GLPSG--------KVDSISV------SKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRKCMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRYLMGDDNPIMAPSKLDLCDDMDQPMSHYFINSSHNTYLTGHQLTGKSSVEIYRQCLLAGCRCVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAESAFKTSEYPVILSFENHCNPRQQAKIANYCREIFGDML 435          

HSP 2 Score: 143.665 bits (361), Expect = 3.464e-34
Identity = 89/243 (36.63%), Postives = 126/243 (51.85%), Query Frame = 2
Query: 1733 EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQ-LLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEK--TRTVNGNAYNPVFDES-FEF-EVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            E+S   E  A  L  E    F+ +NK  L  VYP  TR DSSN+ PQ  WN GCQ+VALN+QT+ L M L+ G F  N   GY+LKPE MR     LD   +  +  I+  T+ I V+S Q L   R +T        +V + + G P D   +K  T+TV  N  NP++DE  F F +V + ++A +R    ++   G   IG   +    +  GYRH+ L +  G+ I  A LF+ V + +
Sbjct:  625 EMSSFDEKQATTLLKERPIEFVNYNKHQLSRVYPAGTRFDSSNFMPQLFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRSDRRLDPFAESTVDGIIAGTVSITVLSGQFLTDKRANT--------FVEVDMYGLPADTVRKKFRTKTVRDNGMNPLYDEEPFVFKKVVLPELASIRIAAYEE---GGKLIGHRVLPVIGLCPGYRHVNLRSEVGQPIALASLFLCVVVKD 856          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plcl2 (phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-120426-4])

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 424/1046 (40.54%), Postives = 625/1046 (59.75%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQ---KVSRTRKISNAPKMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLR 3193
            KKTVSFSS P E  K I S  DC++ M +GS++ K+  N R Y R F LD     +RW PS K+ +KAKI +  I+E+R G        +GI   +SE CAF+I+YG  ++SL L+A SA+ AN+W+ GL  LI+   +   + +   ++  R  WL E+F EAD   +  +     +QL+K L+ G+  ++I+ K KE+   +      +T EEF+ VF ++ TRPEI+FLL+++S+N EFL  +DL++FLEAEQGM  ++++  +E+IQ YEPS EG+ KG L +DGFT+YL+S +C IFDPE   VCQDMNQPL HY+I +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S +PL + +ENHCS++QQ ++   LK  LG  ++   PN  +   P  L  +  ++  K   +P+N     G             V++EDE  E S++   + S  + +    K +L   LSD+  +    +F D  M   N                  W  E+   +E+ A R A +H   F+ +NK  L  VYP+  R+DSSN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR Q+     + KD +P + PQ LHI++IS   LPKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FECIQ G+RHI L + TGEV+P+A++FVHVAITN+RGGGK  KRG+SV+   + +    ++ L I  +DEVFK A   L+E  ++R+   +A+   +E C L   +N+KQCI A+    I    S                                        P  +    E +P          + LP+ LK+++  +D V       TQ+S             AMEF+E L ++     +K RK  ++ E+F WN+ +++GQ+DL+   R + + +L+
Sbjct:   33 KKTVSFSSMPTE--KKISSASDCINSMVDGSELRKVRSNSRVYHRYFLLDADMQSLRWEPSKKESDKAKIDVKSIKEVRTGKNTDTFRTNGISDQISEDCAFSIIYGENYESLDLVANSADVANIWVTGLRYLIS-YGKHTLNMIQSSQDNMRASWLGELFDEADAIGRKSISLCTAVQLIKKLSPGVKNVKIELKFKELHKSKDKSSSDVTKEEFIEVFHDLCTRPEIYFLLVQFSSNKEFLDTKDLMIFLEAEQGMAKVSEDISVEVIQKYEPSKEGQLKGWLSLDGFTNYLMSADCHIFDPEQKTVCQDMNQPLSHYYINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRNVIDIINKYAFAASEFPLFLCLENHCSLKQQKVIFQHLKKILGDKVHTDPPNLEDNYLPSPLDLKGKIL-LKGKKLPSNCTEPEGE------------VTDEDEGAEMSQRMNNEASEQQVVVQPKKFQLSKDLSDLVTLCKSVQFKDFQMAFQNQKH---------------W--ELCSFNEVFASRCATDHPGDFVNYNKKFLARVYPSPMRIDSSNMNPQDFWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREQVSYFSANTKDSVPGVSPQLLHIKIISGLNLPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDNPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECIQPGFRHIPLQSLTGEVLPHAWVFVHVAITNRRGGGKPHKRGLSVRKGKRGREYASMRILLIKAVDEVFKSAAQPLREATDLRENMQNAIVPFKELCGLSAVANLKQCILALSPRLIGPDGS----------------------------------------PFLLFNLREQYPSV-----EAQSLLPEVLKRAVTAYDTV------STQLS------------LAMEFHENLHDMAVKEGLKGRKLHKSVESFTWNITILKGQADLLKHARAEVLENLK 982          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plcl2 (phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-120426-4])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 387/877 (44.13%), Postives = 565/877 (64.42%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQ---KVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAI 2689
            KKTVSFSS P E  K I S  DC++ M +GS++ K+  N R Y R F LD     +RW PS K+ +KAKI +  I+E+R G        +GI   +SE CAF+I+YG  ++SL L+A SA+ AN+W+ GL  LI+   +   + +   ++  R  WL E+F EAD   +  +     +QL+K L+ G+  ++I+ K KE+   +      +T EEF+ VF ++ TRPEI+FLL+++S+N EFL  +DL++FLEAEQGM  ++++  +E+IQ YEPS EG+ KG L +DGFT+YL+S +C IFDPE   VCQDMNQPL HY+I +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S +PL + +ENHCS++QQ ++   LK  LG  ++   PN  +   P  L  +  ++  K   +P+N     G             V++EDE  E S++   + S  + +    K +L   LSD+  +                  + Q    + +  +    E+   +E+ A R A +H   F+ +NK  L  VYP+  R+DSSN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR Q+     + KD +P + PQ LHI++IS   LPKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FECIQ G+RHI L + TGEV+P+A++FVHVAITN+RGGGK  KRG+SV+   + +    ++ L I  +DEVFK A   L+E  ++R+   +A+   +E C L   +N+KQCI A+
Sbjct:   22 KKTVSFSSMPTE--KKISSASDCINSMVDGSELRKVRSNSRVYHRYFLLDADMQSLRWEPSKKESDKAKIDVKSIKEVRTGKNTDTFRTNGISDQISEDCAFSIIYGENYESLDLVANSADVANIWVTGLRYLIS-YGKHTLNMIQSSQDNMRASWLGELFDEADAIGRKSISLCTAVQLIKKLSPGVKNVKIELKFKELHKSKDKSSSDVTKEEFIEVFHDLCTRPEIYFLLVQFSSNKEFLDTKDLMIFLEAEQGMAKVSEDISVEVIQKYEPSKEGQLKGWLSLDGFTNYLMSADCHIFDPEQKTVCQDMNQPLSHYYINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRNVIDIINKYAFAASEFPLFLCLENHCSLKQQKVIFQHLKKILGDKVHTDPPNLEDNYLPSPLDLKGKIL-LKGKKLPSNCTEPEGE------------VTDEDEGAEMSQRMNNEASEQQVVVQPKKFQLSKDLSDLVTL----------------CKSVQFKDFQMAFQNQKHWELCSFNEVFASRCATDHPGDFVNYNKKFLARVYPSPMRIDSSNMNPQDFWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREQVSYFSANTKDSVPGVSPQLLHIKIISGLNLPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDNPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECIQPGFRHIPLQSLTGEVLPHAWVFVHVAITNRRGGGKPHKRGLSVRKGKRGREYASMRILLIKAVDEVFKSAAQPLREATDLRENMQNAIVPFKELCGLSAVANLKQCILAL 866          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plcl2 (phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-120426-4])

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 392/884 (44.34%), Postives = 568/884 (64.25%), Query Frame = 2
Query:   74 DFIMNEKKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQ---KVSRTRKISNAPKMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAI 2689
            +F    KKTVSFSS P E  K I S  DC++ M +GS++ K+  N R Y R F LD     +RW PS K+ +KAKI +  I+E+R G        +GI   +SE CAF+I+YG  ++SL L+A SA+ AN+W+ GL  LI+   +   + +   ++  R  WL E+F EAD   +  +     +QL+K L+ G+  ++I+ K KE+   +      +T EEF+ VF ++ TRPEI+FLL+++S+N EFL  +DL++FLEAEQGM  ++++  +E+IQ YEPS EG+ KG L +DGFT+YL+S +C IFDPE   VCQDMNQPL HY+I +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S +PL + +ENHCS++QQ ++   LK  LG  ++   PN  +   P  L  +  ++  K   +P+N     G             V++EDE  E S++   + S  + +    K +L   LSD+  +    +F D  M   N                  W  E+   +E+ A R A +H   F+ +NK  L  VYP+  R+DSSN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR Q+     + KD +P + PQ LHI++IS   LPKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FECIQ G+RHI L + TGEV+P+A++FVHVAITN+RGGGK  KRG+SV+   + +    ++ L I  +DEVFK A   L+E  ++R+   +A+   +E C L   +N+KQCI A+
Sbjct:   23 NFCHERKKTVSFSSMPTE--KKISSASDCINSMVDGSELRKVRSNSRVYHRYFLLDADMQSLRWEPSKKESDKAKIDVKSIKEVRTGKNTDTFRTNGISDQISEDCAFSIIYGENYESLDLVANSADVANIWVTGLRYLIS-YGKHTLNMIQSSQDNMRASWLGELFDEADAIGRKSISLCTAVQLIKKLSPGVKNVKIELKFKELHKSKDKSSSDVTKEEFIEVFHDLCTRPEIYFLLVQFSSNKEFLDTKDLMIFLEAEQGMAKVSEDISVEVIQKYEPSKEGQLKGWLSLDGFTNYLMSADCHIFDPEQKTVCQDMNQPLSHYYINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRNVIDIINKYAFAASEFPLFLCLENHCSLKQQKVIFQHLKKILGDKVHTDPPNLEDNYLPSPLDLKGKIL-LKGKKLPSNCTEPEGE------------VTDEDEGAEMSQRMNNEASEQQVVVQPKKFQLSKDLSDLVTLCKSVQFKDFQMAFQNQKH---------------W--ELCSFNEVFASRCATDHPGDFVNYNKKFLARVYPSPMRIDSSNMNPQDFWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREQVSYFSANTKDSVPGVSPQLLHIKIISGLNLPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDNPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECIQPGFRHIPLQSLTGEVLPHAWVFVHVAITNRRGGGKPHKRGLSVRKGKRGREYASMRILLIKAVDEVFKSAAQPLREATDLRENMQNAIVPFKELCGLSAVANLKQCILAL 873          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plcl2 (phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-120426-4])

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 391/878 (44.53%), Postives = 566/878 (64.46%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQ---KVSRTRKISNAPKMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAI 2689
            KKTVSFSS P E  K I S  DC++ M +GS++ K+  N R Y R F LD     +RW PS K+ +KAKI +  I+E+R G        +GI   +SE CAF+I+YG  ++SL L+A SA+ AN+W+ GL  LI+   +   + +   ++  R  WL E+F EAD   +  +     +QL+K L+ G+  ++I+ K KE+   +      +T EEF+ VF ++ TRPEI+FLL+++S+N EFL  +DL++FLEAEQGM  ++++  +E+IQ YEPS EG+ KG L +DGFT+YL+S +C IFDPE   VCQDMNQPL HY+I +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S +PL + +ENHCS++QQ ++   LK  LG  ++   PN  +   P  L  +  ++  K   +P+N     G             V++EDE  E S++   + S  + +    K +L   LSD+  +    +F D  M   N                  W  E+   +E+ A R A +H   F+ +NK  L  VYP+  R+DSSN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR Q+     + KD +P + PQ LHI++IS   LPKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FECIQ G+RHI L + TGEV+P+A++FVHVAITN+RGGGK  KRG+SV+   + +    ++ L I  +DEVFK A   L+E  ++R+   +A+   +E C L   +N+KQCI A+
Sbjct:   63 KKTVSFSSMPTE--KKISSASDCINSMVDGSELRKVRSNSRVYHRYFLLDADMQSLRWEPSKKESDKAKIDVKSIKEVRTGKNTDTFRTNGISDQISEDCAFSIIYGENYESLDLVANSADVANIWVTGLRYLIS-YGKHTLNMIQSSQDNMRASWLGELFDEADAIGRKSISLCTAVQLIKKLSPGVKNVKIELKFKELHKSKDKSSSDVTKEEFIEVFHDLCTRPEIYFLLVQFSSNKEFLDTKDLMIFLEAEQGMAKVSEDISVEVIQKYEPSKEGQLKGWLSLDGFTNYLMSADCHIFDPEQKTVCQDMNQPLSHYYINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRNVIDIINKYAFAASEFPLFLCLENHCSLKQQKVIFQHLKKILGDKVHTDPPNLEDNYLPSPLDLKGKIL-LKGKKLPSNCTEPEGE------------VTDEDEGAEMSQRMNNEASEQQVVVQPKKFQLSKDLSDLVTLCKSVQFKDFQMAFQNQKH---------------W--ELCSFNEVFASRCATDHPGDFVNYNKKFLARVYPSPMRIDSSNMNPQDFWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREQVSYFSANTKDSVPGVSPQLLHIKIISGLNLPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDNPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECIQPGFRHIPLQSLTGEVLPHAWVFVHVAITNRRGGGKPHKRGLSVRKGKRGREYASMRILLIKAVDEVFKSAAQPLREATDLRENMQNAIVPFKELCGLSAVANLKQCILAL 907          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Match: plcl2 (phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-120426-4])

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 387/877 (44.13%), Postives = 565/877 (64.42%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQ---KVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAI 2689
            KKTVSFSS P E  K I S  DC++ M +GS++ K+  N R Y R F LD     +RW PS K+ +KAKI +  I+E+R G        +GI   +SE CAF+I+YG  ++SL L+A SA+ AN+W+ GL  LI+   +   + +   ++  R  WL E+F EAD   +  +     +QL+K L+ G+  ++I+ K KE+   +      +T EEF+ VF ++ TRPEI+FLL+++S+N EFL  +DL++FLEAEQGM  ++++  +E+IQ YEPS EG+ KG L +DGFT+YL+S +C IFDPE   VCQDMNQPL HY+I +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S +PL + +ENHCS++QQ ++   LK  LG  ++   PN  +   P  L  +  ++  K   +P+N     G             V++EDE  E S++   + S  + +    K +L   LSD+  +                  + Q    + +  +    E+   +E+ A R A +H   F+ +NK  L  VYP+  R+DSSN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR Q+     + KD +P + PQ LHI++IS   LPKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FECIQ G+RHI L + TGEV+P+A++FVHVAITN+RGGGK  KRG+SV+   + +    ++ L I  +DEVFK A   L+E  ++R+   +A+   +E C L   +N+KQCI A+
Sbjct:   47 KKTVSFSSMPTE--KKISSASDCINSMVDGSELRKVRSNSRVYHRYFLLDADMQSLRWEPSKKESDKAKIDVKSIKEVRTGKNTDTFRTNGISDQISEDCAFSIIYGENYESLDLVANSADVANIWVTGLRYLIS-YGKHTLNMIQSSQDNMRASWLGELFDEADAIGRKSISLCTAVQLIKKLSPGVKNVKIELKFKELHKSKDKSSSDVTKEEFIEVFHDLCTRPEIYFLLVQFSSNKEFLDTKDLMIFLEAEQGMAKVSEDISVEVIQKYEPSKEGQLKGWLSLDGFTNYLMSADCHIFDPEQKTVCQDMNQPLSHYYINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRNVIDIINKYAFAASEFPLFLCLENHCSLKQQKVIFQHLKKILGDKVHTDPPNLEDNYLPSPLDLKGKIL-LKGKKLPSNCTEPEGE------------VTDEDEGAEMSQRMNNEASEQQVVVQPKKFQLSKDLSDLVTL----------------CKSVQFKDFQMAFQNQKHWELCSFNEVFASRCATDHPGDFVNYNKKFLARVYPSPMRIDSSNMNPQDFWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREQVSYFSANTKDSVPGVSPQLLHIKIISGLNLPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDNPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECIQPGFRHIPLQSLTGEVLPHAWVFVHVAITNRRGGGKPHKRGLSVRKGKRGREYASMRILLIKAVDEVFKSAAQPLREATDLRENMQNAIVPFKELCGLSAVANLKQCILAL 891          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: PLCL2 (phospholipase C like 2 [Source:NCBI gene;Acc:100489093])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 433/1064 (40.70%), Postives = 652/1064 (61.28%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS-LSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDD-KNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSR--TRKISNAP--KMKLMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            KKTVSFSS P E  K I S  DC++ M  GS++ K+  N R Y R F LD     +RW PS K   KAKI I  ++E+R G        +GIY  +SE CAF+I+YG  ++SL L+A SA+ ANVW+ GL  LI+    +   D+++  ++  R  WL ++F E D +N G +     +Q +K+LN G+   +I+ K KE+   +      +T +EF+ VF E+ TRPEI+FLL+++S+N E+L  +DL++FLEAEQGM  +T+E  +++I+ YEPS +G++ G L +DG TSYL+S +C IFDPE+  +CQDM QPL HY+I AS+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  +E I+KYA  +S YPLI+ +ENHCSV+QQ ++   +K  LG  +Y  +PNS E   PSP+ LK ++++ GKKL            N D    S   G V++EDE +E S Q+V +    + + AP  +++L   LSD+  I     FT F                   +       W  EV   +E+ A + ANE+   F+ +NK  L  ++P+  R+DSSN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++ +VRF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L + TG+++P+A LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I  +DEVFK A   +++  ++R+   + + + +E C L   +N++QCI A     +ST  + P                                    + P+ +   +E +P   +        +P+ +K+ +  +D ++   K++ + +D + EKI  C+K AMEF+E L  +     +K RK  +A E+F WN+ +++GQ+DL+   + +A+ +L+       + G+
Sbjct:  106 KKTVSFSSMPTE--KKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSVKEVRTGKNTDIFRSNGIYDQISEDCAFSIIYGENYESLDLVANSADVANVWVTGLRYLIS--YGKHTLDMIESFQDNMRISWLSQMFRELDEENTGDIPLCKAVQFIKNLNPGLKNSKIELKFKELQKSKEKVSTEVTKDEFIEVFHELCTRPEIYFLLVQFSSNKEYLDTKDLMMFLEAEQGMAHVTEEISLDIIKKYEPS-KGQETGSLSLDGLTSYLMSPDCSIFDPEHKKICQDMAQPLSHYYINASHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIEIINKYAVYASEYPLILCLENHCSVKQQKVMVQHMKKILGDKLYTTSPNSEESYLPSPESLKGKLLIKGKKL------------NSDC---SGIEGDVTDEDEGLEMS-QRVGKDGEEQQNTAPVKRVQLCKELSDLVSICKSVQFTDFQ------------------ISFQNQKYW--EVCSFNEVAAGKYANENPGDFVNYNKRYLSRIFPSPMRIDSSNMNPQDYWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGNCGYVLRPSIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDNPIFDESFEFQINLPELTMVRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLQSLTGDILPHASLFVHVAITNRRGGGKPHKRGLSVRKAKKSRDYASLRTLLIKSVDEVFKNAIQPIRDATDLRENMQNTVVSFKELCGLSPVANLRQCIMA-----LSTRLAGP-----------------------------------DNTPVVVMNLNEQYPTMELQGT-----VPEVMKRILAAYDSIIQNSKTLIENADGVYEKIVQCQKTAMEFHENLSSIGAKEGLKERKMLKAVESFTWNITILKGQADLLKYAKTEALENLKQIHYAAVSCGL 1083          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: PLCL1 (phospholipase C like 1 (inactive) [Source:NCBI gene;Acc:100495595])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 410/1027 (39.92%), Postives = 606/1027 (59.01%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS--LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCY-LSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQ 3139
            KKTVSFSS P E  K I S  DC+ +M  G ++ K+ PN R Y R F LD     +RW PS K   KAK+ I  I+EIR G        +G+      + A +I++G  ++SL L+A SA+ AN+W++GL  L++   Q  +S V   +N  R +WL  VF  AD    G + E   ++L+K LN  +   +++ K KE+   +     R+T EEF   F E+ TRPE++FLL++ S N E+L   DL+LFLE+EQGMT +T+E C+++IQ YE S EG  KG L IDGFT YL+S  CD+FDP +  VCQDM QPL HY+I +S+NTYL+EDQ +GP+ +NG++RAL + CR I++D  DG ++EPII + N++TS L  R  +E I+KYAF+SS +PLI+ I NHCSV+QQ ++   +K   G  ++   P   E   PSP++LK +II    K   +P++           Y   E G V++EDE  E SR+    +       ++  +C  LSD+  I                  + Q      ++ S    E+   SE  A R+ANE+ + F+ +NK  L  VYP+  R+DSSN NPQD WNCGCQIVA+NYQT G MMDL+  +F +NG CGYVL+P IMR ++     + K  +P + PQ LHI++IS Q  PKP+G+ +KG+VIDPY+ I++ G P DC+E++T+TV  N  NP+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI  +C+Q GYRH+ L +  G+ + +A LFVHVAITN+ GGGK  K+G+S +   K +    ++  G+  +D++FK A   L+E  ++R+   +A+ +L+E C +P  +++KQCI + L T +    S+PL                         F  M+ ++    P+                      +PD  KK +  ++ ++   +++ + +D++ +KI  C+K  MEF+E L  L     IK RK  +A E+F WNV +++
Sbjct:   55 KKTVSFSSMPSE--KKISSANDCISFMQGGCELKKVRPNSRIYSRFFTLDPDLQALRWEPSKKDPEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDSALSIIHGENYESLDLVANSADVANIWVSGLRYLVSHSKQPLDS-VEGGQNTPRLQWLNSVFEAADVDGNGIMLEDTAVELIKQLNPAIKEAKVRLKFKEIQKSKEKLTTRVTKEEFYEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLESEQGMTQVTEEMCLDIIQKYELSQEGCLKGFLTIDGFTQYLVSHECDVFDPVHKKVCQDMAQPLSHYYINSSHNTYLIEDQFRGPADINGYVRALKLSCRSIELDVSDGPDNEPIICNRNSMTSSLAFRNVIEVINKYAFISSEFPLILCIGNHCSVQQQKVMVQHIKKIFGSKLFTERPLPLESYLPSPEKLKKKII---VKGKKLPSD-----------YDLLE-GEVTDEDEEAEMSRR---MSEDYFGEQRLITLCKELSDLVSI----------------CKSVQYRDFDVTMKSQNYGEICSFSESQASRIANEYPEDFVNYNKKFLSRVYPSPMRIDSSNLNPQDFWNCGCQIVAMNYQTPGPMMDLNIAWFMQNGGCGYVLRPSIMRDEISYFSANTKGMVPGVSPQVLHIKIISGQNFPKPKGACAKGDVIDPYICIEIHGIPADCAEQRTKTVQQNGDNPIFDESFEFQINLPELAMVRFMVLDDDYIGDEFIGQYTIPVDCLQPGYRHVPLRSFVGDTLEHAKLFVHVAITNRGGGGKAQKKGLSARIGKKAREYTMLRNTGLKTVDDIFKLAIHPLREASDVRENMQNALVSLKELCGVPTSASLKQCILS-LATRLVNSDSTPL------------------------VFLNMKDNYPYLEPVGA--------------------IPDVQKKLLTAYELMIQESRTLFESADTIHDKILQCQKTGMEFHEELHSLGTKEGIKGRKLNKAIESFAWNVTVLK 999          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: ENSXETT00000008582.1 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:100488276])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 416/1064 (39.10%), Postives = 625/1064 (58.74%), Query Frame = 2
Query:   89 EKKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS--LS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQT--RDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDR--GRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKI---SNAPKMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            +KKTVSFS+  +   + I ST  C+ +M  G +M K+  N R Y R F LD     +RW PS K   KAK+ I  IRE+R G     + S  LS     ECAF+I+YG  ++SL L+A++A+  N W+ GL  L++    +   DVL   NQT  R  W+  +F  AD   +G +     IQL+K LN GM T  ++ K KE  IQ+  D+  G +T + FV  + E+ TRPEIFFLL+++S+N E+L ++DL++F+E EQGM  + ++  ++ I  YE + EG++KG L IDGFT YLLS +C +FDP +  VCQDM +PL HY+I ++++   MED   G + ++G+I AL +GCR I++  WDG ++EP+IY   ++ S ++ R  +  I KYAF +S YPLII +  HCSV+QQ ++   LK  LG  +Y   P   E   PSP+QLK +I++ GKKL+  P    H +   D+T          +EDE +E +R+  +   +    +   K++L   LSD+  +    +F D                   RS    W  +VS  +E+ A R +NE+ + F+ +NK  L  VYP+  R+D+SN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P +  Q L+I++IS Q LPKP+GS +KG+V++PYV +++ G P DC+E +T+TV  N  NP+FDESFEF + + ++A++RF+VLDDD IGD+FI QYTI FEC+QTG+RH+ L + TGE + N  LFVH+AITN+RGGGK  K+G+ V+   K +     K  GI  IDEVF+ A P+L+E  ++R+   +A+ + +E C L   +N+KQCI  +         S+ L  N                              +S L +T+ + S+ +P            +P+ LKK +  ++  + A +++ + +D +  KI   +K  M F+E L  +     +K RK  +  E+F WN+ +++GQ+DL+   R +AV H+R     GQ++G+
Sbjct:   63 QKKTVSFST--MSNKRKINSTAACISFMMEGCEMKKVRSNSRMYNRFFLLDPDMRFLRWEPSKKDSEKAKLEIKSIREVRVGKKTPVLRSNGLSDQFPEECAFSIIYGENYESLDLVASTADIVNTWVMGLRYLVS--YGKHTPDVLG-ANQTSLRTLWISSLFEIADLDKEGQIPLQRAIQLIKGLNPGMKTSTVELKFKE--IQKANDKFGGHVTCDVFVEAYCELCTRPEIFFLLVQFSSNKEYLDLKDLMIFMELEQGMEEVNEDTSLDFINKYETTKEGREKGYLTIDGFTRYLLSSDCHVFDPHHKTVCQDMTKPLTHYYINSAHSACQMEDHYWGTADISGYIHALKMGCRSIELVVWDGPDNEPLIYLSLSVVSHVSFRSVINVIDKYAFETSDYPLIICLVVHCSVKQQRLMAQCLKEVLGNKLYNFPPCPKELYMPSPEQLKGKILIKGKKLS--PE---HSDSEGDVT----------DEDEGMEIARRLGNDGEEHLGEAGHRKLRLCKELSDLVNLCQSVKFRDFET---------------SRSSQKYW--QVSSFNEVAASRFSNEYPEEFVRYNKRFLSRVYPSSMRIDASNMNPQDFWKCGCQIVAMNFQTPGLMMDLNTGWFRQNGNCGYVLRPAIMREEVSYFSANAKDSLPGVSAQLLYIKIISGQNLPKPKGSGAKGDVVEPYVYVEIHGIPADCAEHRTKTVTQNGDNPIFDESFEFHINLPELAILRFVVLDDDFIGDEFIAQYTIPFECLQTGFRHVPLQSLTGEFLQNTTLFVHIAITNRRGGGKAQKKGLYVRKGKKVREYTSTKTTGIKAIDEVFRTATPSLREATDLRENVQNALVSFKELCGLTPAANMKQCILTV---------SAWLLNN------------------------------DSPLTVTLNLRSQ-YPTL-----EAQGPVPELLKKVLASYEAFIQASRTLIETADVVYSKIIQVQKAGMGFHEDLHRIGAKEGLKGRKLQKVMESFAWNITVLKGQADLLKHARNEAVEHVRQIHHAGQSSGI 1042          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: ENSXETT00000008695.1 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:100488276])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 404/1035 (39.03%), Postives = 606/1035 (58.55%), Query Frame = 2
Query:   89 EKKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS--LS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQT--RDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDR--GRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKI---SNAPKMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQ 3139
            +KKTVSFS+  +   + I ST  C+ +M  G +M K+  N R Y R F LD     +RW PS K   KAK+ I  IRE+R G     + S  LS     ECAF+I+YG  ++SL L+A++A+  N W+ GL  L++    +   DVL   NQT  R  W+  +F  AD   +G +     IQL+K LN GM T  ++ K KE  IQ+  D+  G +T + FV  + E+ TRPEIFFLL+++S+N E+L ++DL++F+E EQGM  + ++  ++ I  YE + EG++KG L IDGFT YLLS +C +FDP +  VCQDM +PL HY+I ++++   MED   G + ++G+I AL +GCR I++  WDG ++EP+IY   ++ S ++ R  +  I KYAF +S YPLII +  HCSV+QQ ++   LK  LG  +Y   P   E   PSP+QLK +I++ GKKL+  P    H +   D+T          +EDE +E +R+  +   +    +   K++L   LSD+  +    +F D                   RS    W  +VS  +E+ A R +NE+ + F+ +NK  L  VYP+  R+D+SN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P +  Q L+I++IS Q LPKP+GS +KG+V++PYV +++ G P DC+E +T+TV  N  NP+FDESFEF + + ++A++RF+VLDDD IGD+FI QYTI FEC+QTG+RH+ L + TGE + N  LFVH+AITN+RGGGK  K+G+ V+   K +     K  GI  IDEVF+ A P+L+E  ++R+   +A+ + +E C L   +N+KQCI  +         S+ L  N                              +S L +T+ + S+ +P            +P+ LKK +  ++  + A +++ + +D +  KI   +K  M F+E L  +     +K RK  +  E+F WN+ +++
Sbjct:   38 QKKTVSFST--MSNKRKINSTAACISFMMEGCEMKKVRSNSRMYNRFFLLDPDMRFLRWEPSKKDSEKAKLEIKSIREVRVGKKTPVLRSNGLSDQFPEECAFSIIYGENYESLDLVASTADIVNTWVMGLRYLVS--YGKHTPDVLG-ANQTSLRTLWISSLFEIADLDKEGQIPLQRAIQLIKGLNPGMKTSTVELKFKE--IQKANDKFGGHVTCDVFVEAYCELCTRPEIFFLLVQFSSNKEYLDLKDLMIFMELEQGMEEVNEDTSLDFINKYETTKEGREKGYLTIDGFTRYLLSSDCHVFDPHHKTVCQDMTKPLTHYYINSAHSACQMEDHYWGTADISGYIHALKMGCRSIELVVWDGPDNEPLIYLSLSVVSHVSFRSVINVIDKYAFETSDYPLIICLVVHCSVKQQRLMAQCLKEVLGNKLYNFPPCPKELYMPSPEQLKGKILIKGKKLS--PE---HSDSEGDVT----------DEDEGMEIARRLGNDGEEHLGEAGHRKLRLCKELSDLVNLCQSVKFRDFET---------------SRSSQKYW--QVSSFNEVAASRFSNEYPEEFVRYNKRFLSRVYPSSMRIDASNMNPQDFWKCGCQIVAMNFQTPGLMMDLNTGWFRQNGNCGYVLRPAIMREEVSYFSANAKDSLPGVSAQLLYIKIISGQNLPKPKGSGAKGDVVEPYVYVEIHGIPADCAEHRTKTVTQNGDNPIFDESFEFHINLPELAILRFVVLDDDFIGDEFIAQYTIPFECLQTGFRHVPLQSLTGEFLQNTTLFVHIAITNRRGGGKAQKKGLYVRKGKKVREYTSTKTTGIKAIDEVFRTATPSLREATDLRENVQNALVSFKELCGLTPAANMKQCILTV---------SAWLLNN------------------------------DSPLTVTLNLRSQ-YPTL-----EAQGPVPELLKKVLASYEAFIQASRTLIETADVVYSKIIQVQKAGMGFHEDLHRIGAKEGLKGRKLQKVMESFAWNITVLK 988          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Match: PLCH2 (phospholipase C eta 2 [Source:NCBI gene;Acc:100487353])

HSP 1 Score: 543.502 bits (1399), Expect = 2.016e-176
Identity = 316/803 (39.35%), Postives = 463/803 (57.66%), Query Frame = 2
Query:  158 CLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYSL-------SECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQE---VFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIY---VHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQ-KVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKR------------------------SINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGST--SKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            C+  M  G+ MIK+  + +   R ++LD   + +RW PS +K  KAKI ID I+E+  G  +S I+           C F+I YG   +SL L+++S EEA  WI GL  L+AG S   + D L  + +TRD++L +    F EAD    G L   +V+QLM  LN  +   ++KQ  KE D     ++G L  +EF   +K +STR +++ L++ YSN+ + L  +DL  FLE EQ M  +TKE+C++++  +EP  E K++G LGIDGFT+Y+ S   DIF+P++  V QDM  PL +YFIA+S+NTYLM DQL   S V+ +   L  GCR +++DCWDG + EPI++HG TLTSK+  +  +E I+KYAF+ + YP+I++IENHCSV QQ  +   L   LG+ +    V N +S++ PSP+ L+ +I++ GKKL    ++               E G VS+ED   E     K+    ++ N  K KL   L +    +    ++  +     S   SQ   LK+                           S W  +VS  SE  A ++  +    F+  N+  L  +YP+  RVDSSNYNPQ  WN GCQ+VALNYQ+ G M+ L+   F+ NGNCGYVLKP+ M  Q   + + +D +P  L + L +R+IS QQLPKP+ S    +G +IDP+V ++L G PVDC +E+TR V+ N +NP+++E+  F V + +++L+RFLV D D IG DFIGQ T+SF  +  GYRH+ L     E +  A +FVHVAI +
Sbjct:   14 CMSSMQAGTQMIKLRGSSKGLVRFYYLDEHKSCIRWRPS-RKNEKAKISIDSIQEVCEG-KQSEIFQRYADGSFDPNCCFSIYYGDHMESLDLVSSSGEEARTWITGLKYLMAGIS---DEDSLSKRQRTRDQYLFQHYHTFDEADKNGDGCLSINEVLQLMHKLNVNLPRQKVKQMFKEADTD--DNQGTLGFDEFCAFYKMMSTRRDLYLLMLTYSNHKDHLDPDDLKRFLEVEQKMINVTKEYCLDIVDKFEPCPENKKQGALGIDGFTNYMRSPAGDIFNPDHYQVNQDMTLPLSNYFIASSHNTYLMGDQLMSQSRVDMYAWVLQAGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIRNDYPVILSIENHCSVVQQKKMAQYLIEILGEKLNLSDVVNEDSTKLPSPESLRGKILVKGKKLPASISD-------------DAEEGDVSDEDSADEIDDDCKLINGDQVENIAKKKLDSLLKESKIRDREDPNNFTVTTLPPSGKLSQKPELKKKTMKLSRALSDLVKYTKSVGIHDVETESNW--QVSSFSETKAHQILQQKPAQFVRFNQHQLSRIYPSSYRVDSSNYNPQPFWNAGCQLVALNYQSEGRMLQLNRAKFNSNGNCGYVLKPKCM-CQGAFNPNSEDPLPGQLKKQLVLRIISGQQLPKPKDSMLGDRGEIIDPFVEVELIGLPVDCFKEQTRVVDDNGFNPMWEETLVFTVHMPEISLIRFLVWDHDPIGRDFIGQRTLSFSSMMPGYRHVYL-----EGMEEASIFVHVAIND 788          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plcl2 (phospholipase C-like 2 [Source:MGI Symbol;Acc:MGI:1352756])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 438/1063 (41.20%), Postives = 651/1063 (61.24%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS-LSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDD-KNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS-RQKVSRTRKISNAP--KMKLMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            KKTVSFSS P E  K I S  DC++ M  GS++ K+  N R Y R F LD     +RW PS K   KAKI I  I+E+R G        +GI   +SE CAF+++YG  ++SL L+A SA+ AN+W+ GL  LI+    +   D+L+  ++  R  W+ ++FSE D    G +     +Q +++LN G+ T +I+ K KE+   +      +T EEF+ VF E+ TRPEI+FLL+++S+N EFL  +DL++FLEAEQG+  I +E  +E+I  YEPS EG++KG L IDGFT+YL+S +C IFDPE+  VCQDM QPL HYFI +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S YPLI+ +ENHCS++QQ ++   +K  LG  +Y  +PN  E   PSPD LK +I++  KKL+    + C  +G E         G V++EDE  E S R       + ++ P  + +L   LS++  I     F  F                   +   +   W  EV   +E+ A + ANE+   F+ +NK  L  V+P+  R+DSSN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TVN N   P+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FEC+QTGYRH+ L + TGEV+ +A LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I  +DEVFK A P +++  ++R+   +A+ + +E C L   +N+ QC+ A+          SP                            ++   +N   P+ +   SE +P   +        +P+ LKK +  +D ++ + K++ + +D++ EKI  C+K AMEF+E L  +     +K RK  +A E+F WN+ +++GQ+DL+   + + + +L+       + G+
Sbjct:  120 KKTVSFSSMPTE--KKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISEQISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLIS--YGKHTLDMLESSQDNMRTSWISQMFSEIDVDGLGHITLCHAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEITKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKILGDKLYTTSPNMEESYLPSPDVLKGKILIKAKKLS----SNC--SGVE---------GDVTDEDEGAEMSQRMGKENVEQPNHVPVKRFQLCKELSELVSICKSVQFKEFQ------------------VSFQVQKYW--EVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNVGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVNQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAV----------SP---------------------------RFLGPDNN---PLVVLNLSEPYPTMELQ-----AIVPEVLKKIVTTYDMMMQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGL 1098          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plcl1 (phospholipase C-like 1 [Source:MGI Symbol;Acc:MGI:3036262])

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 418/1045 (40.00%), Postives = 619/1045 (59.23%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS--LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCY-LSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLR 3193
            KKTVSFSS P E  K I S  DC+ +M  G ++ K+ PN R Y R F LD     +RW PS K   KAK+ I  I+EIR G        +G+      +CAF+I++G  ++SL L+A SA+ AN+W++GL R +  RS++    +  ++N  R  WL+ VF  AD    G + E   ++L+K LN  +   +I+ K KE+   +     R+T EEF   F E+ TRPE++FLL++ S N E+L   DL+LFLEAEQG+T IT++ C+++I+ YE S +G+QKG L IDGFT YLLS  CDIFDPE   V QDM QPL HY+I AS+NTYL+EDQ +GP+ +NG++RAL +GCR I++D  DG ++EPI+ + N +   L+ R  LE I+K+AFV+S YPLI+ + NHCS+ QQ ++   +K   G+ +Y   P SSE   PSP++LK  II+ GKKL              D+  G      V++EDE  E SR+    +   +   K   +C  LSD+  I                    +   L     + W  E+   SE  A R+ANE+ + F+ +NK  L  VYP+  R+DSSN NPQD WNCGCQIVA+N+QT G MMDL  G+F +NG CGYVL+P IMR ++     + K  +P + P  LHI++IS Q  PKP+G+ +KG+VIDPYV +++ G P DC E++T+TV  N+ NP+FDE+FEF+V + ++ +VRF++LDDD IGD+FIGQYTI FEC+Q GYRH+ L +  G+++ +  LFVH+AITN+ GGGK  KR +SV+   K +    ++ +G+  ID++FK A   L+E  +MR+   +A+ +++E C LP  +++KQC+  + +  I++ S+                                        P    +  + FP            +PD  K+ +  +D ++   + + +++D++QEKI  C+K  MEF+E L  L     +K RK  +A E+F WN+ +++GQ DL+   + +AV +++
Sbjct:   92 KKTVSFSSMPSE--KKISSAHDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADVANIWVSGL-RYLVSRSKQPLDFIEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKESKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDMCLDIIRRYELSEDGRQKGFLAIDGFTQYLLSPECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIEDQFRGPADINGYVRALKMGCRSIELDVSDGPDNEPILCNRNNMAMHLSFRSVLEVINKFAFVASEYPLILCLGNHCSLPQQKVMAQQMKKVFGEKLYTEAPLSSESYLPSPEKLKNMIIVKGKKLP----------SESDLLEGE-----VTDEDEEAEMSRR---MSGDYNGEQKHIWLCRELSDLVSI--------------CKSVQHRDFELSMKTQNYW--EMCSFSETEASRIANEYPEDFVNYNKKFLSRVYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGIVPGVSPLVLHIKIISGQNFPKPKGACAKGDVIDPYVCVEIHGIPADCCEQRTKTVQQNSDNPIFDETFEFQVNLPELTMVRFVILDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRSGGGKPQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVSVKELCGLPPIASLKQCLLTLSSRLITSDST----------------------------------------PSVSLVMKDCFPYL-----EPLGAIPDVQKRMLAAYDLMIQESRVLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKAIESFAWNITVLKGQGDLLKNAKNEAVENIK 1054          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plcd3 (phospholipase C, delta 3 [Source:MGI Symbol;Acc:MGI:107451])

HSP 1 Score: 425.631 bits (1093), Expect = 3.500e-133
Identity = 265/770 (34.42%), Postives = 387/770 (50.26%), Query Frame = 2
Query:  170 MTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAK--IPIDDIREIRHGIAKSGIYSLS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVH---NPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIG-DDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            M  GS ++KI       +R + L      V W      R  +K    +  I  +R G    G+          C  TI +     +L L A +AEEA  W+ GL +L      R   D +  + +  D W+      AD      +   ++  L++ +N  M  +   +  KE D   H +  RL   E     + +  RPE+  +  RYS     LS  +LL FLE +QG  G T     +LIQTYE +   KQ   + +DGF  YLLS      +  +  V QDM QPL HYFI++S+NTYL + Q+ G SS   +IRA + GCR +++DCW+G   EP+IYHG+TLTSK+  R  ++ +  +AF SS YP+I+++ENHC + QQ ++   L+  LG  +      + N  E PSP+QLK RI++ GKKL            +ED    S       EE+E  E       R+R    +P++  +       Y   TR                   TL  S     +  V  LSE  A +   E   SF+ HN   L  VYP   R++S+NYNPQ++WN GCQ+VALN+QT G  MDL+ G F  NG CGYVLKP  +R    L+       P     TL I+V++AQQLPK   +    +++DP V +++ G P DC++++T  V  N +NP ++++ +F +   ++ LVRF+V D D+   +DF+GQ T+    ++ GYRHI LL+  G  +  A LFVH+ I N
Sbjct:   61 MLRGSRLLKIRSRTWHKERLYRLQEDGLSV-WFQRRIPRAASKHIFFVQHIEAVREGHQSEGLRRFGGAFAPACCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLAKL------RARLDAMSQRERL-DHWIHSYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYAYRLFKECD---HSNNERLEGAEIEAFLRRLLKRPELEEIFRRYSGEDRVLSASELLEFLE-DQGEDGATLACAQQLIQTYELNETAKQHELMTLDGFMMYLLSPEGAALNVAHTCVFQDMGQPLAHYFISSSHNTYLTDSQIGGTSSTEAYIRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVRDHAFTSSPYPVILSLENHCGLEQQAVMARHLRSILGDMLVTQALDSQNPEELPSPEQLKGRILVKGKKLP--------AARSEDGRILSDREEEEEEEEEAEEALEAAEQRSRAKQISPELSALA-----VYCCATRLR-----------------TLDPSPGPPQSCTVGSLSERKARKFTREAGTSFVRHNTQQLTRVYPLGLRMNSANYNPQEMWNSGCQLVALNFQTPGYEMDLNTGRFLINGQCGYVLKPAYLRQ---LNTTFDPECPGPPRTTLAIQVLTAQQLPK-LNAEKPSSIVDPLVRVEIHGVPEDCAQKETDYVLNNGFNPCWEQTLQFRLRAPELVLVRFVVEDYDTTSPNDFVGQSTLPLSSLKQGYRHIHLLSKDGASLAPATLFVHIRIQN 784          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plcd1 (phospholipase C, delta 1 [Source:MGI Symbol;Acc:MGI:97614])

HSP 1 Score: 417.927 bits (1073), Expect = 1.285e-130
Identity = 272/784 (34.69%), Postives = 410/784 (52.30%), Query Frame = 2
Query:  152 PDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSN-EVRWLPSNKKRNKAK---IPIDDIREIRHGIAKSGIYSLS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVH--NPNSSEWPSPDQ-LKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKV-SRTRKISNAPKMKLMCYLSDMFY----INFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRH-QLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLD-DDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            PD L  +  GS ++K+  +   ++R  F  +Q + +  W  S K     +     I+DI+E+R G    G+   +     +  F+IV+  + ++L LIA S  +   W+ GL ++I             D+ Q    W+     +AD      ++  +V   +K LN  +     ++  +E D   H     L  EE    ++ ++ R EI       + + E LS+E L+ FL+ +Q          + LI+ YEPS   K + Q+  DGF  YLLS + + F   +  V QDMNQPL HY +++S+NTYL+EDQL GPSS   +IRAL  GCR +++DCWDG N EPIIYHG T TSK+     L  I  YAF +S YP+I+++ENHCS+ QQ ++   L+  LG  +     +  ++  PSP+Q  +  ++   K    +P  G  +NG         E   VS+EDE  E   + V S+ +      K+KL+  LSDM      ++F  F              S  +T  ++       E++  SE  A+RL  E   SF+ HN  +L  +YP   R DSSNY+P ++WN GCQIVALN+QT G  MD+  G F  NG CGYVLKP  +R      +       P   P+ L + +IS QQLPK   + +K +++DP V++++ G   D +  +T  +  N +NP +D  FEF VAV  +ALVRF+V D D S  +DFIGQ TI +  ++ GYRH+ LL+  G++ P+A LFV ++I +
Sbjct:   17 PD-LQALLKGSQLLKVKSSS--WRRERFYKLQEDCKTIWQESRKVMRSPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADVQHWVQGLRKIIDRSGSM-------DQRQKLQHWIHSCLRKADKNKDNKMNFKEVKDFLKELNVQVDDSYARKIFRECD---HSQTDSLEDEEIETFYRMLTQRAEIDRAFAEAAGSAETLSVEKLVTFLQHQQREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGNAFSLAHRRVYQDMNQPLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMAHHLRAILGPMLLDQPLDGVTTSLPSPEQLKEKILLKGKKLGGLLPAGG--ENG--------PEATDVSDEDEAAEMEDEAVRSQVQHKPKEDKLKLVPELSDMVIYCKSVHFGGF--------------SSPSTSGQAFY-----EMASFSESRALRLLQESGNSFVRHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDNGGCGYVLKPAFLRDPDTTFNSRALTQGPWWAPKKLRVWIISGQQLPKV--NKNKNSIVDPKVIVEIHGVGQDVASRQTAVITNNGFNPRWDTEFEFVVAVPDLALVRFMVEDYDSSSKNDFIGQSTIPWNSLKQGYRHVHLLSKNGDLHPSATLFVKISIQD 756          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Match: Plcd1 (phospholipase C, delta 1 [Source:MGI Symbol;Acc:MGI:97614])

HSP 1 Score: 417.542 bits (1072), Expect = 3.915e-130
Identity = 273/784 (34.82%), Postives = 412/784 (52.55%), Query Frame = 2
Query:  152 PDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSN-EVRWLPSNKKRNKAK---IPIDDIREIRHGIAKSGIYSLS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVH--NPNSSEWPSPDQ-LKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKV-SRTRKISNAPKMKLMCYLSDMFY----INFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRH-QLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLD-DDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            PD L  +  GS ++K+  +   ++R  F  +Q + +  W  S K     +     I+DI+E+R G    G+   +     +  F+IV+  + ++L LIA S  +   W+ GL ++I    + G  D    + Q    W+     +AD      ++  +V   +K LN  +     ++  +E D   H     L  EE    ++ ++ R EI       + + E LS+E L+ FL+ +Q          + LI+ YEPS   K + Q+  DGF  YLLS + + F   +  V QDMNQPL HY +++S+NTYL+EDQL GPSS   +IRAL  GCR +++DCWDG N EPIIYHG T TSK+     L  I  YAF +S YP+I+++ENHCS+ QQ ++   L+  LG  +     +  ++  PSP+Q  +  ++   K    +P  G  +NG E           VS+EDE  E   + V S+ +      K+KL+  LSDM      ++F  F              S  +T  ++       E++  SE  A+RL  E   SF+ HN  +L  +YP   R DSSNY+P ++WN GCQIVALN+QT G  MD+  G F  NG CGYVLKP  +R      +       P   P+ L + +IS QQLPK   + +K +++DP V++++ G   D +  +T  +  N +NP +D  FEF VAV  +ALVRF+V D D S  +DFIGQ TI +  ++ GYRH+ LL+  G++ P+A LFV ++I +
Sbjct:   43 PD-LQALLKGSQLLKVKSSS--WRRERFYKLQEDCKTIWQESRKVMRSPESQLFSIEDIQEVRMGHRTEGLEKFARDIPEDRCFSIVFKDQRNTLDLIAPSPADVQHWVQGLRKII---DRSGSMD----QRQKLQHWIHSCLRKADKNKDNKMNFKEVKDFLKELNVQVDDSYARKIFRECD---HSQTDSLEDEEIETFYRMLTQRAEIDRAFAEAAGSAETLSVEKLVTFLQHQQREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGNAFSLAHRRVYQDMNQPLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCSLEQQRVMAHHLRAILGPMLLDQPLDGVTTSLPSPEQLKEKILLKGKKLGGLLPAGG--ENGPEATD--------VSDEDEAAEMEDEAVRSQVQHKPKEDKLKLVPELSDMVIYCKSVHFGGF--------------SSPSTSGQAFY-----EMASFSESRALRLLQESGNSFVRHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYLGCFQDNGGCGYVLKPAFLRDPDTTFNSRALTQGPWWAPKKLRVWIISGQQLPKV--NKNKNSIVDPKVIVEIHGVGQDVASRQTAVITNNGFNPRWDTEFEFVVAVPDLALVRFMVEDYDSSSKNDFIGQSTIPWNSLKQGYRHVHLLSKNGDLHPSATLFVKISIQD 782          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q9UPR0|PLCL2_HUMAN (Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2)

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 438/1063 (41.20%), Postives = 650/1063 (61.15%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDD-KNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS-RQKVSRTRKISNAP--KMKLMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            KKTVSFSS P E  K I S  DC++ M  GS++ K+  N R Y R F LD     +RW PS K   KAKI I  I+E+R G        +GI   +SE CAF+++YG  ++SL L+A SA+ AN+W+ GL  LI+    +   D+L+  ++  R  W+ ++FSE D  N G +   + +Q +++LN G+ T +I+ K KE+   +      +T EEF+ VF E+ TRPEI+FLL+++S+N EFL  +DL++FLEAEQG+  I +E  +E+I  YEPS EG++KG L IDGFT+YL+S +C IFDPE+  VCQDM QPL HYFI +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S YPLI+ +ENHCS++QQ ++   +K  LG  +Y  +PN  E   PSPD LK +I++  KKL    ++ C  +G E         G V++EDE  E S R       + +N P  + +L   LS++  I     F  F                   +   +   W  EV   +E+ A + ANE+   F+ +NK  L  V+P+  R+DSSN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TV+ N   P+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FEC+QTGYRH+ L + TGEV+ +A LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I  +DEVFK A P +++  ++R+   +A+ + +E C L   +N+ QC+ A+          SP                                    + P+ +   SE +P   +        +P+ LKK +  +D ++ + K++ + +D++ EKI  C+K AMEF+E L  +     +K RK  +A E+F WN+ +++GQ+DL+   + + + +L+       + G+
Sbjct:  119 KKTVSFSSMPTE--KKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLIS--YGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKLLGDKLYTTSPNVEESYLPSPDVLKGKILIKAKKL----SSNC--SGVE---------GDVTDEDEGAEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQFKEFQ------------------VSFQVQKYW--EVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAV----------SPRFLGP------------------------------DNTPLVVLNLSEQYPTMELQ-----GIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGL 1097          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q8K394|PLCL2_MOUSE (Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2)

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 438/1063 (41.20%), Postives = 651/1063 (61.24%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS-LSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDD-KNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS-RQKVSRTRKISNAP--KMKLMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            KKTVSFSS P E  K I S  DC++ M  GS++ K+  N R Y R F LD     +RW PS K   KAKI I  I+E+R G        +GI   +SE CAF+++YG  ++SL L+A SA+ AN+W+ GL  LI+    +   D+L+  ++  R  W+ ++FSE D    G +     +Q +++LN G+ T +I+ K KE+   +      +T EEF+ VF E+ TRPEI+FLL+++S+N EFL  +DL++FLEAEQG+  I +E  +E+I  YEPS EG++KG L IDGFT+YL+S +C IFDPE+  VCQDM QPL HYFI +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAF +S YPLI+ +ENHCS++QQ ++   +K  LG  +Y  +PN  E   PSPD LK +I++  KKL+    + C  +G E         G V++EDE  E S R       + ++ P  + +L   LS++  I     F  F                   +   +   W  EV   +E+ A + ANE+   F+ +NK  L  V+P+  R+DSSN NPQD W CGCQIVA+N+QT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TVN N   P+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FEC+QTGYRH+ L + TGEV+ +A LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I  +DEVFK A P +++  ++R+   +A+ + +E C L   +N+ QC+ A+          SP                            ++   +N   P+ +   SE +P   +        +P+ LKK +  +D ++ + K++ + +D++ EKI  C+K AMEF+E L  +     +K RK  +A E+F WN+ +++GQ+DL+   + + + +L+       + G+
Sbjct:  120 KKTVSFSSMPTE--KKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADMQSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISEQISEDCAFSVIYGENYESLDLVANSADVANIWVTGLRYLIS--YGKHTLDMLESSQDNMRTSWISQMFSEIDVDGLGHITLCHAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEITKEEFIEVFHELCTRPEIYFLLVQFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGQEKGWLSIDGFTNYLMSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQKVMVQHMKKILGDKLYTTSPNMEESYLPSPDVLKGKILIKAKKLS----SNC--SGVE---------GDVTDEDEGAEMSQRMGKENVEQPNHVPVKRFQLCKELSELVSICKSVQFKEFQ------------------VSFQVQKYW--EVCSFNEVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGLMMDLNVGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVNQNGDAPIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAV----------SP---------------------------RFLGPDNN---PLVVLNLSEPYPTMELQ-----AIVPEVLKKIVTTYDMMMQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGL 1098          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q15111|PLCL1_HUMAN (Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3)

HSP 1 Score: 769.615 bits (1986), Expect = 0.000e+0
Identity = 420/1044 (40.23%), Postives = 625/1044 (59.87%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS--LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGI-PDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLR 3193
            KKTVSFSS P E  K I S  DC+ +M  G ++ K+ PN R Y R F LD     +RW PS K   KAK+ I  I+EIR G        +G+      +CAF+I++G  ++SL L+A SA+ AN+W++GL R +  RS++    +  ++N  R  WL+ VF  AD    G + E   ++L+K LN  +   +I+ K KE+   +     R+T EEF   F E+ TRPE++FLL++ S N E+L   DL+LFLEAEQG+T IT++ C+++I+ YE S EG+QKG L IDGFT YLLS  CDIFDPE   V QDM QPL HY+I AS+NTYL+EDQ +GP+ +NG+IRAL +GCR +++D  DG+++EPI+ + N +T+ ++ R  +E I+K+AFV+S YPLI+ + NHCS+ QQ ++   +K   G  +Y   P  SE   PSP++LK  II+ GKKL   P          D+  G      V++EDE  E SR+            +++L   LSD+  I                  + Q    + S+ S    E+   SE  A R+ANE+ + F+ +NK  L  +YP+  R+DSSN NPQD WNCGCQIVA+N+QT G MMDL  G+F +NG CGYVL+P IMR ++     +  GI P + P  LHI++IS Q  PKP+G+ +KG+VIDPYV I++ G P DCSE++T+TV  N+ NP+FDE+FEF+V + ++A++RF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L +  G+++ +  LFVH+AITN+ GGGK  KR +SV+   K +    ++ +G+  ID++FK A   L+E  +MR+   +A+ +++E C LP  +++KQC+  + +  I++ ++                                        P    +  + FP     +      +PD  KK +  +D ++   + + +++D++QEKI  C+K  MEF+E L  L     +K RK  +A E+F WN+ +++GQ DL+   + +A+ +++
Sbjct:   91 KKTVSFSSMPSE--KKISSANDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADVANIWVSGL-RYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDICLDIIRRYELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIEDQFRGPADINGYIRALKMGCRSVELDVSDGSDNEPILCNRNNMTTHVSFRSVIEVINKFAFVASEYPLILCLGNHCSLPQQKVMAQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVKGKKLPSDP----------DVLEGE-----VTDEDEEAEMSRRMSVDYN--GEQKQIRLCRELSDLVSI----------------CKSVQYRDFELSMKSQNYWEMCSFSETEASRIANEYPEDFVNYNKKFLSRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGILPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQQNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVSIKELCGLPPIASLKQCLLTLSSRLITSDNT----------------------------------------PSVSLVMKDSFP-----YLEPLGAIPDVQKKMLTAYDLMIQESRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIENMK 1053          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q3USB7|PLCL1_MOUSE (Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3)

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 418/1045 (40.00%), Postives = 619/1045 (59.23%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS--LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCY-LSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLR 3193
            KKTVSFSS P E  K I S  DC+ +M  G ++ K+ PN R Y R F LD     +RW PS K   KAK+ I  I+EIR G        +G+      +CAF+I++G  ++SL L+A SA+ AN+W++GL R +  RS++    +  ++N  R  WL+ VF  AD    G + E   ++L+K LN  +   +I+ K KE+   +     R+T EEF   F E+ TRPE++FLL++ S N E+L   DL+LFLEAEQG+T IT++ C+++I+ YE S +G+QKG L IDGFT YLLS  CDIFDPE   V QDM QPL HY+I AS+NTYL+EDQ +GP+ +NG++RAL +GCR I++D  DG ++EPI+ + N +   L+ R  LE I+K+AFV+S YPLI+ + NHCS+ QQ ++   +K   G+ +Y   P SSE   PSP++LK  II+ GKKL              D+  G      V++EDE  E SR+    +   +   K   +C  LSD+  I                    +   L     + W  E+   SE  A R+ANE+ + F+ +NK  L  VYP+  R+DSSN NPQD WNCGCQIVA+N+QT G MMDL  G+F +NG CGYVL+P IMR ++     + K  +P + P  LHI++IS Q  PKP+G+ +KG+VIDPYV +++ G P DC E++T+TV  N+ NP+FDE+FEF+V + ++ +VRF++LDDD IGD+FIGQYTI FEC+Q GYRH+ L +  G+++ +  LFVH+AITN+ GGGK  KR +SV+   K +    ++ +G+  ID++FK A   L+E  +MR+   +A+ +++E C LP  +++KQC+  + +  I++ S+                                        P    +  + FP            +PD  K+ +  +D ++   + + +++D++QEKI  C+K  MEF+E L  L     +K RK  +A E+F WN+ +++GQ DL+   + +AV +++
Sbjct:   92 KKTVSFSSMPSE--KKISSAHDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADVANIWVSGL-RYLVSRSKQPLDFIEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKESKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDMCLDIIRRYELSEDGRQKGFLAIDGFTQYLLSPECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIEDQFRGPADINGYVRALKMGCRSIELDVSDGPDNEPILCNRNNMAMHLSFRSVLEVINKFAFVASEYPLILCLGNHCSLPQQKVMAQQMKKVFGEKLYTEAPLSSESYLPSPEKLKNMIIVKGKKLP----------SESDLLEGE-----VTDEDEEAEMSRR---MSGDYNGEQKHIWLCRELSDLVSI--------------CKSVQHRDFELSMKTQNYW--EMCSFSETEASRIANEYPEDFVNYNKKFLSRVYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGIVPGVSPLVLHIKIISGQNFPKPKGACAKGDVIDPYVCVEIHGIPADCCEQRTKTVQQNSDNPIFDETFEFQVNLPELTMVRFVILDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRSGGGKPQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVSVKELCGLPPIASLKQCLLTLSSRLITSDST----------------------------------------PSVSLVMKDCFPYL-----EPLGAIPDVQKRMLAAYDLMIQESRVLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKAIESFAWNITVLKGQGDLLKNAKNEAVENIK 1054          
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Match: sp|Q62688|PLCL1_RAT (Inactive phospholipase C-like protein 1 OS=Rattus norvegicus OX=10116 GN=Plcl1 PE=1 SV=1)

HSP 1 Score: 758.829 bits (1958), Expect = 0.000e+0
Identity = 423/1046 (40.44%), Postives = 626/1046 (59.85%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS--LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCY-LSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLR 3193
            KKTVSFSS P E  K I S  DC+ +M  G ++ K+ PN R Y R F LD     +RW PS K   KAK+ I  I+EIR G        +G+      +CAF+I++G  ++SL L+A SA+ AN+W++GL R +  RS++    +  ++N  R  WL+ VF  AD    G + E   ++L+K LN  +   +I+ K KE+   +     R+T EEF   F E+ TRPE++FLL++ S N E+L   DL+LFLE EQG+T +T++ C+++I+ YE S +G+QKG L IDGFT YLLS  CDIFDPE   V QDM QPL HY+I AS+NTYL+EDQ +GP+ +NG++RAL +GCR I++D  DG ++EPI+ + N +   L+ R  LE I+K+AFV+S YPLI+ + NHCS+ QQ ++   +K   G  +Y   P SSE   PSP++LK+ II+ GKKL              D+  G      V++EDE  E SR+    +   +   K   +C  LSD+  I    ++ D                 L     + W  E+   SE  A R+ANE+ + F+ +NK  L  VYP+  R+DSSN NPQD WNCGCQIVA+N+QT G MMDL  G+F +NG CGYVL+P IMR ++     + K  +P + P  LHI++IS Q  PKP+G+ +KG+VIDPYV +++ G P DCSE++T+TV  N+ NP+FDE+FEF+V + ++ +VRF++LDDD IGD+FIGQYTI FEC+Q GYRH+ L +  G+++ +  LFVH+AITN+ GGGK  KR +SV+   K +    ++ +G+  ID++FK A   L+E  +MR+   +A+ +++E C LP  +++KQC+   L++ + T  S+P                 S S+     F Y+E       P+                      +PD  K+ +  +D ++   + + +++D++QEKI  C+K  MEF+E L  L     +K RK  +A E+F WN+ +++GQ DL+   + +AV +++
Sbjct:   92 KKTVSFSSMPSE--KKISSAHDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADVANIWVSGL-RYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKESKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEVEQGVTHVTEDMCLDIIRRYELSEDGRQKGFLAIDGFTQYLLSPECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIEDQFRGPADINGYVRALKMGCRSIELDVSDGPDNEPILCNRNNMAMLLSFRSVLEVINKFAFVASEYPLILCLGNHCSLPQQRVMVQQMKKVFGNKLYTEAPLSSESYLPSPEKLKHMIIVKGKKLP----------SESDLLEGE-----VTDEDEEAEMSRRV---SGDYNGEQKHIWLCRELSDLVSICKSVQYRDF---------------ELSMKTQNYW--EICSFSETLASRIANEYPEDFVNYNKKFLSRVYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGIVPGVSPLLLHIKIISGQNFPKPKGACAKGDVIDPYVCVEIHGIPADCSEQRTKTVQQNSDNPIFDETFEFQVNLPELTMVRFVILDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVSVKELCGLPPIASLKQCL-LTLSSRLITSDSTP-----------------SVSLVMKDCFPYLE-------PLGT--------------------IPDVQKRMLAAYDLMIQESRVLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKAIESFAWNITVLKGQGDLLKNAKNEAVENIK 1054          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: A0A1S3JF87 (Phosphoinositide phospholipase C OS=Lingula unguis OX=7574 GN=LOC106172721 PE=4 SV=1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 478/1062 (45.01%), Postives = 689/1062 (64.88%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAK--------SGIYSLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQR-HGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVH--NPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS--RQKVSRTRKISNAPKMKLMCYLSDMF-YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISV-KSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGML 3229
            KKTVSFSS P E  K I ++ DCL+YM NGS++IK+  N RQY R F +D    E+RW PS+KK +KA+I ++ ++E+R G           +G+Y   ECAF+++YG  +DSL LIAAS +EA +W+AGLT LI+G++ +   + L+D  + RD+WLQEVFS AD  N G LDE +VI LMK L+S ++T +I+QK+KE+   R  G   +L S+EF  +FK++ TRPE++FLL+RYS++ E++SI+DL+LFLEAEQG++ +TKE C+ +++ YEPS EG+QKGQL +DGFT+YLLS +CD+FDPE+  VCQDM  PL HYFIA S+NTYL+EDQLKGPSS   + RAL  GCR +++D WDG +DEP+IYHG+TLTSK++ +  ++ I++YAF +S YP+I+AIENHC ++ Q  +   +K   G  +Y    + N+ + PSP++LK +I++  KKL               +   ++E G+V+EEDE  E +  R+K ++        K  L   LSD+  +    RF D     +                  +W  E+   SE  A+RLAN   + F+ HNK  L  VYPN  RVDS NYNPQD+WNCGCQ+VALNYQT GLMMDL  G F++NG CGYV+KP IMR ++     + +D IP + PQ LHIRVIS  Q PKP+GS +KG+V DPYV+I++ G P DC+EE+T+TV  N YNP+FDESFEF+V + ++ALVRF+VLDDD IGD+FIGQYTI FEC+QTGYRHIRLL+NT EVIPN  LFVH+AIT+K GGGK +KRG SV K+RS+ + +  +K  G+  ID+ FK    +L +  ++R   + A+   +E+C+    +N+KQCIR +L++ I + +     C                                        I  +D   ++ NH+N    +PD +KK++  FD +V  C+++ + +  + +++   +K  +E +E L  LC+   ++ RK  +A E+F WN+R+++GQ+DL+ + +QD  ++L+  +E   ATG++
Sbjct:   67 KKTVSFSSMPFE--KKIANSQDCLNYMQNGSELIKVRSNSRQYHRYFSIDPDLTELRWQPSSKKPHKARIGLEAMKEVRSGKTTDVLRNKEIAGMYQ-EECAFSVIYGDNYDSLDLIAASPDEAGIWVAGLTCLISGKNNKS-PESLEDGQEMRDRWLQEVFSSADQDNIGVLDEFEVINLMKKLDSNISTAKIQQKIKEICTARIEGKNVQLNSDEFSRLFKDMVTRPEVYFLLVRYSSHAEYMSIDDLMLFLEAEQGISTVTKEDCLRIVEKYEPSPEGRQKGQLAVDGFTAYLLSEDCDLFDPEHRKVCQDMAHPLSHYFIATSHNTYLLEDQLKGPSSTEAYERALKKGCRCLELDTWDGPDDEPVIYHGHTLTSKVSFKSVIDTINQYAFQASEYPVILAIENHCCIKLQQAMVHYMKAVFGDKLYAKPTDENAIQLPSPEELKGKILIKCKKLP--------------LDSDNSE-GWVTEEDEGAESTDNRKKNNKRPPEGAIRKYLLSKELSDLVSWCQSVRFTDFETAADE---------------QDVW--ELCSFSESFALRLANSFPEEFVNHNKRFLSRVYPNGARVDSGNYNPQDMWNCGCQLVALNYQTGGLMMDLYDGKFAQNGGCGYVIKPAIMREEIAYFSANTRDVIPGVPPQVLHIRVISGHQFPKPKGSGAKGDVTDPYVLIEIFGIPADCAEERTKTVPHNGYNPLFDESFEFQVNLPELALVRFVVLDDDFIGDEFIGQYTIPFECMQTGYRHIRLLSNTSEVIPNCTLFVHIAITDKCGGGKSSKRGTSVKKNRSRMRDHCSLKTTGVKNIDDTFKSGVQSLADAADLRDGVLIALEAFKETCSQASTANLKQCIR-VLSSRIQSSADQASIC----------------------------------------ILKKDGWPYIENHSN----IPDIIKKAVVAFDVLVAECRNLVENAVEVCQQLRDSQKAGLEMHEELNMLCQQAGLRARKLNKAMESFAWNIRVLKGQADLLMQAKQDCSDYLKQIEEAAVATGLM 1047          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: R7TQV1 (Phosphoinositide phospholipase C OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_92139 PE=4 SV=1)

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 476/1057 (45.03%), Postives = 669/1057 (63.29%), Query Frame = 2
Query:   86 NEKKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAK--------SGIYSLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHN--PNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCY-LSDMF-YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQA 3217
            + KKTVSFSS P ERS  +I+  DCL+YM NGS++IK+  N RQY R F LD + NE+RW PS+KK  KAKI +D I+E+R+G           SG Y   ECAF+I+YG  ++++ LIA S +EAN+W+ GLT L++G +++  +  + D   +   WL E+F  AD  N G +DE +V+ LMK LN+G+ T++I+QKLKE+ I++ G+RGRL S EF+N+FKEI+TRPEI+FLL+RY+++ + LS +DLLLFLEAEQGM  +TKE C+E+I  +EP+ +G+Q G LGIDGFT YLLS  CDIFD E   V QDM QPL HYFIA+S+NTYLMEDQLKGPSS++ +IR L  GCR I++DCWDGANDEP+IYHG+TLTSK++ +  ++ I+ +AF  S YP+I++IENHCS +QQ  +   +K  LG  ++  N  P+    PSP+ LK ++++  KKL   P +    +            GYV++EDE  E  +      ++  +  K   MC  LSD+  Y    RF D                  + S+      E+   SE  A++ AN   + F+ HNK  L  VYPN  RVDSSN+NPQDLWNCGCQ+VALNYQT GLMMDL+ G F +NG CG+VLKP IMR ++     + ++ IP + PQ LHI++IS QQLPKPRGS +KG+ +DPYV I++ G P DC+EE+T+TV  N YNP+FDESFEF++ + ++ALVRF VLDDD IGD+FI QYTI FEC+QTGYRHI+L +NTGE + N  LFVHVAITNKRGGGK ++RG SV+   +++    +K + +  +DE  K A   L++  ++R     A+   +E C L   SN+KQCIR +         +S +H                              S    + + + I +E +P            LPD +KK++  F+ +V  C+++ Q +D + EK+   ++  +E++E L  L     +K RK  RA ENF WN+R+++GQ+DLI + + +   +++      Q+
Sbjct:   60 DRKKTVSFSSMPNERS--VINAADCLNYMQNGSELIKVRSNSRQYHRLFILDAELNEIRWQPSSKKPQKAKILLDQIKEVRNGKNTDVLRNQDVSGHYP-EECAFSIIYGDNYETMDLIANSPDEANIWVTGLTCLVSGINRK--TGYIHDSVDSLTVWLLEMFEMADTDNLGQIDEFEVVNLMKKLNNGLTTVKIQQKLKELSIKKDGERGRLNSSEFINLFKEIATRPEIYFLLVRYASSSDHLSTDDLLLFLEAEQGMARVTKEKCLEIINKFEPTKDGRQLGHLGIDGFTMYLLSKECDIFDSECSKVFQDMTQPLSHYFIASSHNTYLMEDQLKGPSSIDAYIRVLKKGCRCIELDCWDGANDEPVIYHGHTLTSKISFKSVIQAINAHAFTKSEYPVILSIENHCSKKQQQAMAFHMKTILGSKLFADNRDPDLQLLPSPECLKGKVLVKCKKL---PCSSEQPD------------GYVTDEDEGAETEKSNKKSNKREGSVKKTHEMCKELSDLVNYCKSVRFQD-----------------FQESLQKGKYYELCSFSESTALKFANACPEEFVNHNKMFLSRVYPNGMRVDSSNFNPQDLWNCGCQLVALNYQTPGLMMDLNDGHFMQNGGCGFVLKPAIMREEIAYFSANTREVIPGVSPQILHIKIISGQQLPKPRGSGAKGDTLDPYVSIEIFGIPADCAEERTKTVQHNGYNPIFDESFEFQINLPELALVRFAVLDDDFIGDEFISQYTIPFECMQTGYRHIQLKSNTGEDVSNCTLFVHVAITNKRGGGKASRRGTSVRRSKREREYTSMKSVSVKCVDETLKMAIQPLRDGTDLRDNVHLALAQFKEDCGLALISNVKQCIRML---------ASRIH------------------------------SSCEDVVLRLVIKAE-YPCL-----EARGFLPDIIKKALVAFENLVAECRNLIQRADEVYEKLIHAQRAGLEWHEDLQNLGIQQGLKGRKLNRAMENFAWNIRVLKGQADLIKQAKIECQEYMKQVSHCNQS 1034          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: K1PZR1 (Phosphoinositide phospholipase C OS=Crassostrea gigas OX=29159 GN=CGI_10013004 PE=4 SV=1)

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 494/1083 (45.61%), Postives = 695/1083 (64.17%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAK--------SGIYSLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGES-DVLDDKNQTRDKW----LQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGD---RGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFI---YVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMF-YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDRNAKSSVTDDADK 3277
            KKTVSFSS P ER   I +  DCL  M +GS++IK+  N RQY R F L+    E+RW P++KK +KA+I I  I+E+R G           +GIY   ECAF+I++G +F+S+ LIA + +EAN+WI GLT LI   ++ G S + +++  Q RD +     +E+F     Q++G LDE  V+ L+  LN+ +A  R++QK+KE+++ R      RGR+ S+EFV++FKEISTRPEI+FLL+RY++N ++L+ +DLLLFLEAEQGM  +TK+ C+++I  YEPS +G++KGQLGIDGFT YLLS +CD+FDP+   + QDMNQPL HYFIA+S+NTYL++DQL+GPSSV+ +IRAL+ GCR +++DCWDG NDEPIIYHG+T TSK+  +  +E I  YAF +S YP+I++IENHCS++QQ  +   +    G+ +   YV   N S  PSP+ LK +II+ GKKL   P N              +E  YV++EDE  E S +K +   K     K KL   LSD+  Y   TRF D             Q +  K+        E+   SE  AI+LA    + F+ HNK  L  +YPN  RVDSSNYNPQDLWNCGCQ+VALNYQT GLMMDL  GFF RN NCG++LKP IMR ++     + KD IP + PQ LHI+VIS Q  PKP+GS S+G+V DPYV I++ G P DC+EE+T+TV  N Y+P+FDESFEF++ + ++ALVRF VLDDD IGD+FIGQYTI F+C+QTGYRHIRL +NTGE IPN  LF+HVAITNKRGGGK  KRG+SVK ++K+ Y   +K +G+  IDE FK A   L++  ++R      + + +E+C L   +NIKQC R ++ T +S                                 N  E+++     +T+ +  E +P      N     LPD LKK++  FDE+V   K++ + +D++ EK+  CK+  ME++E L  +C+   +K +K ++A ENF WN+R+++GQ+DL+++ +++   +LR   E  Q+ G+   + N ++ + +  DK
Sbjct:   73 KKTVSFSSMPTERK--IATAQDCLQCMQSGSELIKVRSNSRQYHRIFTLNPDMTEIRWQPTSKKPHKARISIASIKEVRSGKTTEALKNKEIAGIYQ-DECAFSIIFGEDFESMDLIANTPDEANIWITGLTCLINTSAKIGTSPEAIEEMQQMRDSYPLSATEEMFKTEASQSEGTLDEKGVVNLVTKLNNNIAPARVQQKVKEIELNRVEAVERRGRINSDEFVSLFKEISTRPEIYFLLVRYASNTDYLTTDDLLLFLEAEQGMQRVTKDKCIDIINRYEPSKDGRKKGQLGIDGFTDYLLSDDCDVFDPDQNNIVQDMNQPLSHYFIASSHNTYLLKDQLQGPSSVDAYIRALAKGCRCVELDCWDGPNDEPIIYHGHTFTSKIQFKAVIEAIDTYAFKTSEYPVILSIENHCSIKQQQAMAHYMTTIFGEKLCLDYV-GENESCLPSPETLKKKIIVKGKKL---PPN--------------SEDDYVTDEDEGAE-SDKKKNNKTKDHPVKKHKLAKELSDLVNYCVSTRFQDF------------QVSQQKQKFF-----EMCSFSESTAIKLAMSCPEEFVNHNKKFLSRIYPNGMRVDSSNYNPQDLWNCGCQMVALNYQTHGLMMDLYNGFFRRNANCGFILKPTIMREEIAYFSANTKDVIPGVSPQILHIKVISGQHFPKPKGSGSRGDVTDPYVTIEIFGIPADCAEERTKTVPHNGYSPIFDESFEFQINLPELALVRFAVLDDDYIGDEFIGQYTIPFDCMQTGYRHIRLCSNTGEEIPNCTLFIHVAITNKRGGGKANKRGMSVKKKTKRDYT-SMKSVGVKNIDETFKVAIQPLRDGTDLRDNVQVTLADFKETCGLSPIANIKQCFR-LMGTRLS---------------------------------NSTEQAN-----LTLVMRGE-YPSLEAQGN-----LPDILKKALISFDELVAEIKNLLENADNVYEKLLHCKRAGMEWHEDLENVCQQAGLKGKKLSKAMENFSWNIRVLKGQADLLNQAKKEGQEYLRQITEAAQSMGLGKYNEN-QTEIPESIDK 1069          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: A0A1I8H5P4 (Phosphoinositide phospholipase C OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023826g1 PE=4 SV=1)

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 443/967 (45.81%), Postives = 611/967 (63.19%), Query Frame = 2
Query:   89 EKKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYSLSE--------CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRH-GDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWP-----------SPDQLKYRIILVGKKLTDIPTNGCHKNGNEDIT---YGSTECGYVSEEDENIEFSRQKVSRT-RKISN-------------------------APKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINS----------IWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXIS---------------------VKSRSKKKYNH--------------------QIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAI 2689
            +KK+VSF S+  ++   +I  PDC++YM +G++++KI  +GR +KR FFLD ++ E+RW PS+KKR KAK+PID ++E+R G   S I   SE        CAFT++YG +F S+ L+A S ++ANVW+ GLT LI GR  +  SD ++ +   RD+WL+EVFS A     GFLDE DVIQLMK LNSG+ T RIK+KLKEVDI      RGRL+S EFVN+FKEISTRPE++FLL+RYS++G++LS EDLL+FLEAEQG + ++KE C E+I  +EPS+EG+ KGQLGIDGFT++L S  CDIFDPE+L VCQDM QPL HYFI +S+NTYL+EDQLKG SSV G+ +AL    RYI+++ W+G NDEPIIYHG+TLTSK+ LR  L+ + ++AF  +  PLI++IENHCS+ QQ  +  L++ TLG ++   +P S+              +P +L+ RI++  KKL   P  G        +      +   GYVSEED+N++  R +  +  +K  N                           ++KL   LSD+  +   RF D      +   S S  A  +R  +           +W+     +SE  A RLA       + +++  LV V PN  RVDSSNYNPQD+W+CGCQ+V LN+QT GLM DL+ G FS+NG+CG+VLKP  MR           G  D+ P +LHIRVIS  QLPKPRGS +KG+V DP VV+++ G P DCSEE+T+TV+GN YNPVFDE FEF V++ ++AL+R +VLDDD+IGDDFIGQ+TI F+CIQTGYRH+RLL++ GE +P A+LF+HVA+TN+ GGG+  KR  +                     +K+R+    +                     +++  G   ID+ FK A PTL+E   +R+ F  A+  L+++C L H +N+KQC+R +
Sbjct:   61 QKKSVSFLSSSFDKGIRVIDAPDCVNYMRDGTELLKIRSSGRHFKRFFFLDTETMEIRWHPSSKKRQKAKLPIDQLKEVRRG-RTSAILKDSEVAAAYPADCAFTVIYGEDFLSMDLVAVSLDDANVWVTGLTCLINGRPGQLSSDTIEKRQLMRDRWLEEVFSAASLDEDGFLDEQDVIQLMKKLNSGVNTSRIKKKLKEVDIANAISSRGRLSSSEFVNLFKEISTRPEVYFLLVRYSSDGDYLSTEDLLMFLEAEQGNSKVSKEKCSEIINQFEPSTEGRAKGQLGIDGFTAFLQSEFCDIFDPEHLAVCQDMEQPLTHYFINSSHNTYLLEDQLKGKSSVEGYEKALKSQVRYIELEVWNGPNDEPIIYHGHTLTSKIGLRDVLDTVRQFAFYKTDMPLILSIENHCSLAQQCRMVQLIRSTLGDWLL--DPGSASESDVQLLSDPRLLTPSRLRRRILVKCKKLPPPPEGGASAGCERQVATVQQSAVAFGYVSEEDDNVDIQRDRSPKAFKKAGNQSHQSLQQQQQQQQPPPPPQQQQQCGRRIKLSQELSDLAALGSERFADLDDCCFHFYKSDSAQAASRRQPDHQQQHQLLHQQVWS-----ISESAAFRLAQSDMDGLVEYSRRCLVQVQPNAIRVDSSNYNPQDMWSCGCQLVCLNHQTPGLMTDLNRGQFSKNGSCGFVLKPGAMRQTFAFLAQRGGGGSDLAPHSLHIRVISGSQLPKPRGSVAKGDVTDPCVVVEVFGLPADCSEERTKTVHGNGYNPVFDECFEFRVSLPELALLRLVVLDDDAIGDDFIGQFTIPFDCIQTGYRHVRLLDSDGEPLPEAHLFLHVAVTNRHGGGRLGKRSFASSNKKSSNSTNFNVGSSLEPNLKARTSSGGSDGGGGDSGERVESIGSGGGYPRLRPTGFRDIDDAFKAALPTLREAAGLREGFDRALAGLQDACGLSHIANVKQCVRVM 1019          

HSP 2 Score: 83.9593 bits (206), Expect = 2.240e-12
Identity = 36/105 (34.29%), Postives = 64/105 (60.95%), Query Frame = 2
Query: 2912 LPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            LP+ LKKS+  F+++V   K + Q+   +  ++  C+   M+FY+ L  +C     K RK  + A++F WNVR+++GQ+DL+++    A   +  A+E G+ATG+
Sbjct: 1070 LPEPLKKSLVAFEQLVTESKKLMQLGPGMHTRLQDCEAACMQFYDDLAPMCSSAGYKPRKVAKIADSFAWNVRVLRGQADLLARAVSGARCTMVQAEEAGEATGL 1174          
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Match: A0A267FU34 (Phosphoinositide phospholipase C OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025153g1 PE=4 SV=1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 413/842 (49.05%), Postives = 559/842 (66.39%), Query Frame = 2
Query:   86 NEKKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYSLSE--------CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRH-GDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWP-----------SPDQLKYRIILVGKKLTDIPTNGCHKNGNEDIT---YGSTECGYVSEEDENIEFSRQKVSRT-RKISN---------------------APKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRS----------INSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
             +KK+VSF S+  ++   +I  PDC++YM +G++++KI  +GR +KR FFLD ++ E+RW PS+KKR KAK+PID ++E+R G   S I   SE        CAFT++YG +F S+ L+A S ++ANVW+ GLT LI GR  +  SD ++ +   RD+WL+EVFS A     GFLDE DVIQLMK LNSG+ T RIK+KLKEVDI      RGRL+S EFVN+FKEISTRPE++FLL+RYS++G++LS EDLL+FLEAEQG + ++KE C E+I  +EPS+EG+ KGQLGIDGFT++L S  CDIFDPE+L VCQDM QPL HYFI +S+NTYL+EDQLKG SSV G+ +AL    RYI+++ W+G ND+PIIYHG+TLTSK+ LR  L+ + ++AF  +  PLI++IENHCS+ QQ  +  L++ TLG ++   +P S+              +P +L+ RI++  KKL   P  G        +      +   GYVSEED+N++  R +  +  +K  N                       ++KL   LSD+  +   RF D      +   S S  A  +R              +W+     +SE  A RLA       + +++  LV V PN  RVDSSNYNPQD+W+CGCQ+V LN+QT GLM DL+ G FS+NG+CG+VLKP  MR           G  D+ P +LHIRVIS  QLPKPRGS +KG+V DP VV+++ G P DCSEE+T+TV+GN YNPVFDE FEF V++ ++AL+R +VLDDD+IGDDFIGQ+TI F+CIQTGYRH+RLL++ GE +P A+LF+HVA+TN
Sbjct:   60 TQKKSVSFLSSSFDKGIRVIDAPDCVNYMRDGTELLKIRSSGRHFKRFFFLDTETMEIRWHPSSKKRQKAKLPIDQLKEVRRG-RTSAILKDSEVAAAYPADCAFTVIYGEDFLSMDLVAVSLDDANVWVTGLTCLINGRPGQLSSDTIEKRQLMRDRWLEEVFSAASLDEDGFLDEQDVIQLMKKLNSGVNTSRIKKKLKEVDIANAISSRGRLSSSEFVNLFKEISTRPEVYFLLVRYSSDGDYLSTEDLLMFLEAEQGNSKVSKEKCSEIINQFEPSTEGRAKGQLGIDGFTAFLQSEFCDIFDPEHLAVCQDMEQPLAHYFINSSHNTYLLEDQLKGKSSVEGYEKALKSQVRYIELEVWNGPNDQPIIYHGHTLTSKIGLRDVLDTVRQFAFYKTDMPLILSIENHCSLAQQCRMVQLIRSTLGDWLL--DPGSASESDVQLLSDPRLLTPSRLRRRILVKCKKLPPPPEGGASAGCERQVATVQQSAVAFGYVSEEDDNVDIQRDRSPKAFKKAGNQSQQSLQQQQQQQPPPQQQQCGRRIKLSQELSDLAALGSERFADLDDCCFHFYKSDSAQAASRRQPHHQQQHQLLHQQVWS-----ISESAAFRLAQSDMDGLVEYSRRCLVQVQPNAIRVDSSNYNPQDMWSCGCQLVCLNHQTPGLMTDLNRGQFSKNGSCGFVLKPGAMRQTFAFLAQRGGGGSDLAPHSLHIRVISGSQLPKPRGSVAKGDVTDPCVVVEVFGLPADCSEERTKTVHGNGYNPVFDECFEFRVSLPELALLRLVVLDDDAIGDDFIGQFTIPFDCIQTGYRHVRLLDSDGEPLPEAHLFLHVAVTN 893          

HSP 2 Score: 83.5741 bits (205), Expect = 2.297e-12
Identity = 36/105 (34.29%), Postives = 64/105 (60.95%), Query Frame = 2
Query: 2912 LPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            LP+ LKKS+  F+++V   K + Q+   +  ++  C+   M+FY+ L  +C     K RK  + A++F WNVR+++GQ+DL+++    A   +  A+E G+ATG+
Sbjct: 1069 LPEPLKKSLVAFEQLVTESKKLMQLGPGMHTRLQDCEAACMQFYDDLAPMCSSAGYKPRKVAKIADSFAWNVRVLRGQADLLARAVSGARCTMVQAEEAGEATGL 1173          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: si:ch211-210g13.5 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:103045997])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 408/1064 (38.35%), Postives = 625/1064 (58.74%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS-------LSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIA-GRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKIS----NAPKMKLMCYLSDMF----YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            KKTVSFSS P +R  N  ST  C+ +M  G +M K+  N R Y R F LD     +RW PS K   KAK+ I  I+E+R G     + S         ECAF+I+YG  ++SL L+A++A+  + W+ GL  L++ GR   G  +    +   R  W+  VF  AD + +G +D     Q++K LN GM   RI+ K KE+   R      +  + FV V+ E+ TR EIFFLL+++S+N E+L  +DL+LF+E EQG+ G+T+E C ++++ YEPS EG+++G L IDGFT YLLS  C IFDP++  VCQDM QPL HY+I +S+N  L+ED   G S ++ ++RAL +GCR +++  WDG + EP++Y G+++ S+L   K L+ I++YAF SS +PLI+ +  HCSV QQ ++   +K  LG  +++  P+  E   PSP++LK +I+L GK+L   P       G             V++E+E +E SR+ V    K      +  +++L   LSD+      + F  F+                  L +     W  E+   +E+ A R ANE+ + F+ +NK  L  VYP   R+D+SN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + +D +P +  Q LHI+VIS Q LPKPRGS +KG+V++PY+ +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A++RF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L + TGE +PN  LFVHVAITN+RGGGK  KRG+SV+   K +     K  GI V+DE+F+ +   L+E  ++R+   +AM + +E C L   +N+KQCI  + +  +++       C                                  L +T+ + SE +P            +P+ L+K +  +D ++   +++ + +DS+  K+   ++  ++F+E L  +     +K RK  +A E++ WN+ +++GQ+DL+   + +A++ LR  +    + G+
Sbjct:   90 KKTVSFSSMPSDRKMN--STAACMAFMLEGCEMKKVRSNSRMYNRYFLLDPDLRWLRWEPSKKDSEKAKLEIKSIKEVRLGKKTPVLRSNGLSDQFPEECAFSIIYGDNYESLDLVASTADVVSTWVMGLRYLVSYGRHMVGVVEA--SQPSVRTSWIGSVFELADIERQGQIDLFRATQIIKGLNPGMRESRIELKFKELQKARDCYGEGIDLDTFVEVYCELCTRSEIFFLLVQFSSNKEYLDSKDLMLFVEVEQGVEGVTEELCRDIVRKYEPSVEGRERGYLSIDGFTHYLLSSECHIFDPQHKRVCQDMTQPLSHYYINSSHNASLLEDHYWGSSDISSYVRALRMGCRSLEVVVWDGPDCEPVVYVGSSVASQLAFSKVLDVINQYAFESSEFPLILCLVTHCSVPQQRVMAQHMKKILGDKLHLEPPSPDELYLPSPEKLKGKILLKGKRL---PPETQDSEGE------------VTDEEEGLEMSRRMVGADDKDQLNGISCKRLRLCKELSDLVSLCKSVQFRDFE------------------LSKREQKHW--EICSFNEVDANRFANEYPEDFVCYNKRFLSRVYPTPMRIDASNMNPQDFWKCGCQIVAMNYQTPGLMMDLNLGWFRQNGNCGYVLRPSIMRDEVSYFSANARDSLPGVSAQLLHIKVISGQNLPKPRGSAAKGDVVEPYIYVEIHGIPADCAEQRTKTVSQNGDNPIFDESFEFQINLPELAVLRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLQSLTGEFLPNTTLFVHVAITNRRGGGKAHKRGLSVRKGRKAREYTSTKTTGIKVVDELFRASTQPLREATDLRENVQNAMVSFKELCGLTPAANMKQCILTVSSWLLNSE-----RC----------------------------------LRVTVDL-SEAYPTM-----EAQGPVPELLRKVLTAYDTMIQTSRTLIESADSVYCKLTQAQRAGLDFHEDLHRIGAKEGLKGRKLQKAMESYAWNITVLKGQADLLKYAKGEAMDTLRQIQCAAHSCGL 1069          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: plcl2 (phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-120426-4])

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 393/891 (44.11%), Postives = 571/891 (64.09%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIA-GRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQ---KVSRTRKISNAPKMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSS 2719
            KKTVSFSS P E  K I S  DC++ M +GS++ K+  N R Y R F LD     +RW PS K+ +KAKI +  ++E+R G        +GIY  +SE CAF+I+YG  ++SL L+A +A+ AN+W+ GL  LI+ G++      +   +N  R  WL E+F E D      +     +QL+K LN G+  ++I+ KLKE+   +      +T +EFV V+ ++ TRPEI+FLL+++S+N EFL  +DL++FLEAEQGM  ++++  +E+I+ YEPS +G+ KG L +DGFT+YL+S +C IFDPE+  VCQDMNQPL HY+I +S+NTYL+EDQ +GPS + G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAFV+S +PLI+ +ENHCS++QQ ++   LK  LG  I+   P   +   P+P+              D+      K      T  S+E G V++EDE  E S++   +    + +S   K +L   LSD+  +    +F D      N                  W  E+   +E+ A R A +    F+ +NK  L  VYP+  R+DSSN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR Q+     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC+E++T+TVN N  NP+FDESFEF++ + ++A+VRF+ LDDD IGD+FIGQYTI FEC+Q G+RHI L + TGE++P+A+LFVHVAITN+RGGGK  KRG+SV+   + +    ++ L I  +DEVFK A   L+E  ++R+   +A+   +E C L   +N+KQCI A+ +  I   +S
Sbjct:   24 KKTVSFSSMPTE--KKISSASDCINAMVDGSELRKVRSNSRVYHRYFLLDADMQSLRWEPSKKESDKAKIDVKSVKEVRTGKNTDTFRTNGIYDQISEDCAFSIIYGETYESLDLVANTADVANIWVTGLRYLISYGKATLNM--IESTQNNLRSSWLGELFDEVDNAGNKSISLCTAVQLVKKLNPGLKNVKIELKLKELHKAKEKMGSDVTKDEFVEVYHDLCTRPEIYFLLVQFSSNKEFLDTKDLMIFLEAEQGMAQVSEDTSLEVIKQYEPSEDGRLKGCLSLDGFTNYLMSNDCHIFDPEHKTVCQDMNQPLSHYYINSSHNTYLIEDQFRGPSDITGYIRALKMGCRSVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFVASEFPLILCLENHCSLKQQRVMFQHLKKILGDRIHSDPPRPEDTYLPTPN--------------DLKGKILLKGKKLASTCNSSE-GEVTDEDEGAEMSQRMSMEAGEPQTVSQPKKFQLSKDLSDLVTLCKSIQFKDFPTAFQNQKH---------------W--ELCSFNEVFASRCATDFPGEFVNYNKKFLARVYPSPMRIDSSNMNPQDFWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREQVSYFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVNQNGENPLFDESFEFQINLPELAMVRFVALDDDYIGDEFIGQYTIPFECLQPGFRHIPLQSLTGELLPHAWLFVHVAITNRRGGGKPHKRGLSVRKSKRSREYASMRILLIKAVDEVFKTATLPLREATDLRENMQNALVTFKELCGLSAVANLKQCILALSSRLIGADNS 878          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: si:ch211-210g13.5 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:103045997])

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 401/1055 (38.01%), Postives = 618/1055 (58.58%), Query Frame = 2
Query:  119 PLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS--LS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIA-GRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKIS----NAPKMKLMCYLSDMF----YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            P +R  N  ST  C+ +M  G +M K+  N R Y R F LD     +RW PS K   KAK+ I  I+E+R G     + S  LS     ECAF+I+YG  ++SL L+A++A+  + W+ GL  L++ GR   G  +    +   R  W+  VF  AD + +G +D     Q++K LN GM   RI+ K KE+   R      +  + FV V+ E+ TR EIFFLL+++S+N E+L  +DL+LF+E EQG+ G+T+E C ++++ YEPS EG+++G L IDGFT YLLS  C IFDP++  VCQDM QPL HY+I +S+N  L+ED   G S ++ ++RAL +GCR +++  WDG + EP++Y G+++ S+L   K L+ I++YAF SS +PLI+ +  HCSV QQ ++   +K  LG  +++  P+  E   PSP++LK +I+L GK+L   P       G             V++E+E +E SR+ V    K      +  +++L   LSD+      + F  F+                  L +     W  E+   +E+ A R ANE+ + F+ +NK  L  VYP   R+D+SN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + +D +P +  Q LHI+VIS Q LPKPRGS +KG+V++PY+ +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A++RF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L + TGE +PN  LFVHVAITN+RGGGK  KRG+SV+   K +     K  GI V+DE+F+ +   L+E  ++R+   +AM + +E C L   +N+KQCI  + +  +++                                          L +T+ + SE +P            +P+ L+K +  +D ++   +++ + +DS+  K+   ++  ++F+E L  +     +K RK  +A E++ WN+ +++GQ+DL+   + +A++ LR  +    + G+
Sbjct:    2 PSDRKMN--STAACMAFMLEGCEMKKVRSNSRMYNRYFLLDPDLRWLRWEPSKKDSEKAKLEIKSIKEVRLGKKTPVLRSNGLSDQFPEECAFSIIYGDNYESLDLVASTADVVSTWVMGLRYLVSYGRHMVGVVEA--SQPSVRTSWIGSVFELADIERQGQIDLFRATQIIKGLNPGMRESRIELKFKELQKARDCYGEGIDLDTFVEVYCELCTRSEIFFLLVQFSSNKEYLDSKDLMLFVEVEQGVEGVTEELCRDIVRKYEPSVEGRERGYLSIDGFTHYLLSSECHIFDPQHKRVCQDMTQPLSHYYINSSHNASLLEDHYWGSSDISSYVRALRMGCRSLEVVVWDGPDCEPVVYVGSSVASQLAFSKVLDVINQYAFESSEFPLILCLVTHCSVPQQRVMAQHMKKILGDKLHLEPPSPDELYLPSPEKLKGKILLKGKRL---PPETQDSEGE------------VTDEEEGLEMSRRMVGADDKDQLNGISCKRLRLCKELSDLVSLCKSVQFRDFE------------------LSKREQKHW--EICSFNEVDANRFANEYPEDFVCYNKRFLSRVYPTPMRIDASNMNPQDFWKCGCQIVAMNYQTPGLMMDLNLGWFRQNGNCGYVLRPSIMRDEVSYFSANARDSLPGVSAQLLHIKVISGQNLPKPRGSAAKGDVVEPYIYVEIHGIPADCAEQRTKTVSQNGDNPIFDESFEFQINLPELAVLRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLQSLTGEFLPNTTLFVHVAITNRRGGGKAHKRGLSVRKGRKAREYTSTKTTGIKVVDELFRASTQPLREATDLRENVQNAMVSFKELCGLTPAANMKQCILTVSSWLLNSE---------------------------------------RCLRVTVDL-SEAYPTM-----EAQGPVPELLRKVLTAYDTMIQTSRTLIESADSVYCKLTQAQRAGLDFHEDLHRIGAKEGLKGRKLQKAMESYAWNITVLKGQADLLKYAKGEAMDTLRQIQCAAHSCGL 972          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: plcd4b (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 [Source:NCBI gene;Acc:103025130])

HSP 1 Score: 476.478 bits (1225), Expect = 4.902e-153
Identity = 300/794 (37.78%), Postives = 440/794 (55.42%), Query Frame = 2
Query:  122 LERSKNIISTPDC-LDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYSLS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNS--SEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMK--LMCYLSDMFYI----NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAP-EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIP----DILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLD-DDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAIT 2443
            +E  +N+   PD  L+ M  GS + K      +  R + L      + +  +    + +   + D+  +R G       S++     E  FT+V+     +L L+A +AEEA  WI G+  LI      GES       Q  D+W+ ++F +AD    G +   +V +L+K LN  M         K  D  +    G L SEEFV  +K ++ R ++  L   YS++G+ LS  DL  FL  EQ     + ++ +ELI+ YEPS   K    + IDGF  YL S +  IF+PE+L + QDM QP  HYFI++S+NTYL+EDQLKG SS+  +I+AL  GCR ++IDCWDG+N EP++YHG+T TSK+  +  +  ++KYAF +S YP+I++IEN C+  QQ I+  LLK  LG  +     +   +  PSP+ LK ++++ GKK+           G ED    +   G VS+ED++ E  R  ++     S++ K K  L   LSD+       NFT F+DS                    IN    P ++S  SE  A ++  E +  F+ HN   +  VYP+  R DSSN+ PQD+WN GCQ+VALN+QT GL MDL+ G FS+N +CGYVLKPEI+RH    + H     P    D  P  L I+VIS QQLPK   +  +G+++DP+V +++ G P D ++++T  +  N  NP ++E+ EF V   ++ALVRF+V D D +  +DFIGQ+T+ F CIQ+GYRHI LL+  G  I  + LFVH+ IT
Sbjct:    1 MESPQNVCVQPDSSLEIMKAGSVLRKAKSRIWRGHRHYRLMEDCKTIAYKSTWAMNSYSTFSVADVEAVREGHESEVFLSVADEFPPERCFTLVFRGRRGNLDLVADTAEEAQAWIQGMQTLIENLENMGES-------QKLDQWVSDLFLKADINKDGRISFKEVRRLLKLLNMDMNEDHASSLFKMADKTQ---TGLLESEEFVQFYKMLTQRMDVLELFQDYSSDGQTLSHCDLEEFLREEQLEGDRSHDYALELIKRYEPSDTAKANTTMSIDGFLMYLTSADGAIFNPEDLRLFQDMTQPFSHYFISSSHNTYLLEDQLKGRSSIEAYIKALRRGCRCLEIDCWDGSNGEPVVYHGHTFTSKILFKDVIATVAKYAFKTSEYPVILSIENRCNAEQQKIMAQLLKDILGDMLLKTTVDGKVNVLPSPEDLKGKVLVKGKKI----------GGLEDA--DNPGGGEVSDEDDSAEQRRDSLTNESLPSDSKKSKRNLTKELSDLVIYCKNENFTNFEDS-------------------RING--KPYDISSFSESKARKIIKESAADFIQHNTRQITRVYPSGLRTDSSNFCPQDMWNVGCQMVALNFQTAGLEMDLNDGLFSQNNHCGYVLKPEILRHS---EQHFNPDRPQDRKDYCPLILTIQVISGQQLPKV--NNKEGSIVDPFVRVEIYGVPSDQAKQETSYIENNGLNPCWNETLEFVVHTPEVALVRFVVEDYDMATKNDFIGQFTLPFSCIQSGYRHIHLLSKDGTSICPSSLFVHINIT 746          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Match: plcd1a (phospholipase C delta 1 [Source:NCBI gene;Acc:103045272])

HSP 1 Score: 451.055 bits (1159), Expect = 4.193e-143
Identity = 274/773 (35.45%), Postives = 417/773 (53.95%), Query Frame = 2
Query:  161 LDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKK-RNKAKIPIDDIREIRHGIAKSGIY-----SLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVH---NPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFY----INFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQ-LLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLD-DDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHV 2434
            L ++ NG ++ K+  +  Q KR F L  +  E  W  S K  R      ++DI  +R G     +      SL E  F+I++  +  +L L+A+S EEA  W+ GL +++   S         +  Q  + W+     +AD      +   ++ + ++ +N  +         ++ D  +    G L  +E    ++ ++ R EI  +  +Y+     +S  ++L FL+ EQ  + ++ E  ++LI+ YEP    +Q   +  DGF  YL      I +P +  V QDM+QP+ HYFI++S+NTYLMEDQLKGPSS   +IRAL  GCR +++D WDG N EP+IYHG+TLTSK+  R  ++ I  YAF SS YP+I+++ENHC + QQ ++   +   LG  + V    N   +  PSP+QLK RI++ GK+L  +  +    N N      + E   VSE+DE  E    K +  +  S   K++L   LSD+      ++F+ F               + A  K+S       E++   E  A +LA+  + +F+ HN   L  +YP  +R DSSNYNP  +WN GCQIVALN+QT    M+L+ G F  NG CGY+LKP+ MR      D ++    P +  + LH+ VISAQQLPK        +++DPYV +++ G P D +  +T  +N N +NP ++ +FEF V V ++A+VRFLV D D +  +DFIGQYT+    +Q GYRHI LL   G+VI +A LFVHV
Sbjct:   36 LQFLLNGGELTKVKSDSWQKKRFFKLQ-EDFETMWHDSEKIFRKNNTFSLNDIDSVRQGRGSESLQKYTDDSLEERCFSIIFKGKRKNLDLMASSPEEAKQWVVGLEKVLTHMSNL-------NSQQKSEHWIISCMRKADKNGDNMMTLKELKRFLQQINIEVDDTYAAMLFQKCDTSK---SGTLEGDEIKKFYELLTNREEINVIYGKYAETNGQMSANNVLSFLKTEQKES-VSLEDAVKLIEKYEPDEAARQSKNMTKDGFLRYLTHTEGSIINPAHRQVYQDMSQPINHYFISSSHNTYLMEDQLKGPSSTEAYIRALLKGCRCVELDIWDGPNGEPVIYHGHTLTSKVLFRDVIKAIKDYAFKSSEYPVILSLENHCCLEQQKLMAHHMISILGSALLVQPLGNEMPTALPSPEQLKGRILVKGKRLNKL--DAAFNNNN------TVEEDVVSEDDEAAE---AKETDPKAKSTKSKIRLAKELSDLVIYCKSVHFSGF---------------EHAKEKQSFY-----EMASFKESKAKQLADNSASAFVRHNMEKLSRIYPAGSRTDSSNYNPVPMWNAGCQIVALNFQTSCKKMNLNQGRFLPNGQCGYILKPQFMRTPGSQFDPNNLTAGPWLQRKILHVMVISAQQLPK-LNKDKPTSIVDPYVRVEIYGVPADTASAQTPHINNNGFNPTWNMNFEFTVNVPELAIVRFLVQDYDAASANDFIGQYTLPLTSMQFGYRHIPLLTQNGDVISSAGLFVHV 764          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: plcl2 (phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-120426-4])

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 426/1037 (41.08%), Postives = 622/1037 (59.98%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIR----------HGIAKSGIYSLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDK-NQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVH--NPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAP------KMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQ 3139
            KKTVSF S P +R   + S  DC++ M  G ++ KI PN R Y+R F L+     +RW PS K   +A++ I  IRE+R          HG A+   +  ++CAF+I+YG  ++SL L+A++ + AN W+ GL  L++  S     D+L+   N  R  WL  +F+ AD   KG L      QL++ LN  +  I I+ KLKE+   R      ++  EFV+++ E+ TR EI+FLL+++S++ E+L   DL +FLEAEQGMT IT++ C+++I+ YEPS+EG+++G LGIDGFT YL+S  CD+FDP +  VCQDM+QP+ HY+I +S+NTYL+EDQ +GP  V+G++RAL +GCR +++D WDG + EPI+Y+G+T+T  +     LE I+KYAFV+S YPLII +ENH  + QQ +L   +K  LG  +Y+   + N S  PSP+ LK +IIL GKKL         + G E         G V++EDE  E + Q+   ++ I   P      K KL   LSD+  +    RF D                   +     W  E+   +E  A R +NE S+ F+ HNK  L  ++P+  R+DSSN NPQD WNCGCQ+V +NYQT GLMMDL+ G+F +NG CGYVL+P +MR ++     + +DG+P I PQ LHI+VIS Q LPKPRGS SKG+V+DPYV +++ G P DC+E++T+T+  N  +PVFDESF F+V + ++A+VRF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L   TGE I +A LF+HVAITN+RGGGK  KRG+SV+   K +    ++ LG+   DEVF+ A   L E  ++R+   +A+ + +E C LP  + +KQC+  +    +S+ +S+ +                                        +    E +P          + LP+SLKK +Q F+ +VN  K++ + S+SL  KI  C+K  +E +E LP     + +K RK ++A E+F WN+ +++
Sbjct:   16 KKTVSFGSMPTDR--RVSSASDCINLMLEGCELRKIRPNSRVYQRYFLLESDLQWLRWEPSKKDSERARLEIVAIREVRVGKNTETFRNHGFAE---HISADCAFSIIYGEGYESLDLVASAPDIANAWVTGLRYLLSFGSH--SLDMLESSHNSLRHCWLLPLFTRADGGGKGCLPAEVACQLLQGLNPALKGIAIRLKLKELQKSRVSPIDGISFPEFVDMYHELCTRAEIYFLLVQFSSSKEYLDSRDLTMFLEAEQGMTDITEQMCLDIIRRYEPSTEGQERGFLGIDGFTGYLISAECDLFDPAHRRVCQDMSQPISHYYINSSHNTYLIEDQFRGPCDVSGYVRALRMGCRCVEMDVWDGPDGEPIVYNGHTMTLPITFHSALEAINKYAFVASEYPLIICLENHNCIMQQKVLVQHIKKVLGDKLYIKPVDINESYLPSPESLKLKIILKGKKLP------FEEPGPE---------GEVTDEDEASEIA-QRTEMSQDIFLQPDEIDVKKQKLCPELSDLITLCKSVRFRDFDS---------------SQQCQKYW--EMCSFTEALASRFSNEFSEDFVNHNKRFLSRIFPSPMRIDSSNLNPQDFWNCGCQVVGMNYQTPGLMMDLNVGWFRQNGGCGYVLRPSVMRDEVSYFSANVRDGLPGISPQLLHIKVISGQHLPKPRGSGSKGDVVDPYVYVEVHGIPADCAEQRTKTIGQNGGSPVFDESFVFQVNLPELAIVRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLHALTGECIEHANLFLHVAITNRRGGGKAQKRGLSVRKGKKTREYAAMRLLGVRAPDEVFRMAAQPLHEATDLRENMQNAVMSFKEVCGLPPAACLKQCMLGMCARLLSSDASACM----------------------------------------VLQQREGYPAL-----ESPSPLPESLKKLVQAFNMMVNETKNLIESSESLYNKIIHCQKAGLELHEDLPNAGAKDGLKGRKLSKALESFAWNITVLK 967          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: plcl2 (phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-120426-4])

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 420/1071 (39.22%), Postives = 626/1071 (58.45%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS-LSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIA--GRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEV--DIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSS--EWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTEC-GYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISV-KSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKK--KAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDRNA 3247
            KKTVSFSS P E  K I S  DC+  M  GS++ K+  N R Y+R F L+     +RW PS K  +KA++ +  I+E+R G        +GI   +SE CAF+I+YG  ++SL L+A SA+ A+ W+ GL  L++  GR Q   + +   +N  R  WLQ  F     ++ G+L E   ++L+  L+ G+    +K KLKEV  +  R  D   LT   F++VF  ++TRPE++FLL+++S+N E+L ++DL LFL+ EQGM  +++E  +++I+ YEPS EG+  G LGIDGFT YLLS  C +FDP++  VCQDM QPL HY++ AS+NTYL+EDQ +GPS V GFIRAL +GCR +++D WDG   EP++++G+T+TS +  R  L+ I K+AF  S YPL++ +E HC   QQ  +   +K  L + +Y     +S    PSP+ L+ RI++ G+KL   PT                EC G VSEEDE  +  +Q      +   A ++ L   LSD+  +    RF D           A QS          W  E+S  SEL A RL +E S+ F+ +NK  L  VYP+  R+DSSN NP D W CGCQ+V LN QT GLM+DL+ G+F +NG CGYVL+P IMR  +     +  +  P + PQ LH+R+IS Q LPKP+GS +KG V+DPYV  ++ G P DC+E++T+TV  +  +P+F+ESFEF++ + ++AL+R +VLDDD IGD+FIGQYTI  EC+Q GYRH+ LL+ TGE++ +A +F+HVA+TN+RGGGK  KRG+SV + R   KY   ++ +GI V+DEVF+ A   L++  ++R+    A+   +E C LP  +N+ QC+  + +  ++T  +                                        P    +  +  P   +        LPD LKK +  +D ++   +++ + +D++  KI  C+K  + +E +E L  L     +K RK  +A E+F WNV L++GQ+DL+ + + + + ++R       + G   LD+NA
Sbjct:   18 KKTVSFSSMPTE--KKISSAGDCVSLMQEGSELKKVRSNSRIYQRLFLLESDLQHLRWEPSKKDLDKARLEVRSIKEVRAGKNTDIFRSNGISEQVSEDCAFSIIYGESYESLDLVANSADVASAWVTGLRYLLSCSGR-QDISASIHFGQNSLRSCWLQAEFKCTVTEDAGYLSEAGAVELIHKLHPGLRNSYVKLKLKEVLKNNDRPDDIIGLTVANFIDVFNVLATRPEVYFLLVQFSSNKEYLDVKDLSLFLDTEQGMAQVSEEVSLDIIRRYEPSQEGRAAGCLGIDGFTRYLLSPECHVFDPDHRHVCQDMTQPLSHYYVHASHNTYLVEDQFRGPSDVGGFIRALRLGCRSVELDVWDGPEKEPLVFNGHTMTSPITFRAALDAIGKHAFAVSEYPLVLCLETHCCPAQQRTMVRHIKEVLKEKLYTEPAVASCAHLPSPESLRGRILIKGRKLP--PT--------------CQECEGDVSEEDEAAQIGQQHC----EPEQARRLTLTRELSDLASLCQSVRFRD--------FDVALQS-------QKYW--EISSFSELQAGRLISERSEDFLSYNKRFLSRVYPSPMRLDSSNVNPLDFWKCGCQLVGLNLQTPGLMLDLNVGWFQQNGGCGYVLRPAIMREAVSYFRANTHESFPGLCPQMLHLRIISGQNLPKPKGSGAKGEVLDPYVAAEIHGIPADCAEQRTKTVYHDGDHPIFEESFEFQLHLPELALLRLVVLDDDYIGDEFIGQYTIPLECLQPGYRHVPLLSLTGELLTHASIFIHVAVTNRRGGGKPPKRGLSVMRGRRTHKYV-TMRTVGIKVVDEVFRVATQPLRDAADLRENSQVAVLAFKEVCGLPPVANLAQCMLVLCSRLLNTDGT----------------------------------------PQVGLVLRDQMPCLDVQ-----GALPDVLKKGVVLYDTMIQELRTLVESADAIHGKITQCQKSGEGLELHEDLSSLGTREGLKGRKLAKAIESFTWNVTLLKGQADLLRQAKGECIENIRQVHNAAISCG---LDKNA 999          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: plcd3b (phospholipase C, delta 3b [Source:ZFIN;Acc:ZDB-GENE-081222-2])

HSP 1 Score: 422.165 bits (1084), Expect = 5.333e-133
Identity = 269/786 (34.22%), Postives = 408/786 (51.91%), Query Frame = 2
Query:  155 DCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLP---SNKKRNKAKIPIDDIREIRHGIAKSGIYSLS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQ-FIYVHNPNS--SEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENI-EFSRQKVSRTR--KISNAPKMKLMCYLSD-MFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIP-------DILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIG-DDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAIT 2443
            D L  +  GS ++K    GR+ +R   L    + VR      S  ++ +    I D+ E+R G     + +L      +  FT+V+     +L L+A +AE+A  W+  L  L        E     D  Q  D WL   F +AD      +   +V  L+ +LN  M  +  K+   E D    GD   L  +EFV +F++++ R ++  L  R S +G  L    L  FL+ EQ     ++     +I  +EP  EG+ KG + +DGF  YL S +  ++D  +  V  DM QPL HYFI++S+NTYL +DQL+GPSS   ++++L  GCR +++DCWDGA+ EP+IYHG TLTS++  R  +  I+  AF +S YP+I+++ENHC+V QQ ++   L+  LG+  +    P    ++ PSP++LK + ++  KK +  P N         I   +   G  S+ + ++ E S+    + +  K   + K ++   LSD + Y +   F+                  L+R+ +     E+   SE   + L      +F+ +N  +L   YP+ TRV S NYNP D+WN GCQIVALN+QT G  MDL  G F +NG CGYVLKP  +R        H D  P          P  L I VIS QQLPK R S  +G++IDP V +++ G   D +  +T     N  NPV+ E F F++ V ++AL+RF+V D D    +DFIGQ+++ F C++ GYRH+ LL+  G  +  A LFVH+ IT
Sbjct:   14 DDLALLVRGSPVLKASSTGRRGRRVMSLRDDCSAVRCSSRKLSKLRKRRTIFSISDLVEVREGCQTETLRALPLHVDPQRCFTLVFRGRQANLDLVADNAEDARRWVYCLRSL-------SEHSRTMDARQKLDTWLYRSFRKADKNKDNRMTFDEVKDLLNTLNVSMNEVEAKKLFDESDSSHTGD---LVEDEFVQLFRKLTRRDDVATLFKRLSPDGIGLPAARLAQFLQDEQ-HEDDSEHRAACIIAEHEPLDEGRSKGLMTLDGFVRYLTSPDGSLWDQRHDSVSHDMTQPLSHYFISSSHNTYLTDDQLRGPSSTEAYVKSLMRGCRCVELDCWDGADGEPVIYHGYTLTSQILFRDVITSIAHEAFKASAYPVILSLENHCNVEQQIVMARHLRSILGERLVTAPLPGRPPTQLPSPEELKGKFLIKAKKRSK-PVN---------IKSSAKGLGQASDTESDVFEDSKPSTGKHKPLKAEKSKKKEVSKELSDCVIYCSGVHFE-----------------GLERAESHQKGNEMCSFSETKTMGLIETQGNAFVRYNMQHLSRTYPSGTRVGSGNYNPHDMWNAGCQIVALNFQTPGKEMDLYDGLFRQNGGCGYVLKPSFLRDP------HTDFDPGNPARGTGRHPVKLAITVISGQQLPKERNS-RRGSIIDPLVSVEVHGVRGDTAVRETHHQENNGLNPVWKEEFLFQLTVPELALIRFVVKDYDVTSRNDFIGQFSLPFSCLRQGYRHVHLLSLDGRSLFPATLFVHIRIT 754          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: PLCD4 (phospholipase C delta 4 [Source:HGNC Symbol;Acc:HGNC:9062])

HSP 1 Score: 386.341 bits (991), Expect = 3.239e-121
Identity = 242/658 (36.78%), Postives = 352/658 (53.50%), Query Frame = 2
Query:  536 WLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTG-----ITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFI--RALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIY---VHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKV-----SRTRKISNAPKMKL---MCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQT--LHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDD-SIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            W+ + F +AD    G +   +V  L+K +N  M     +   +  D+ R G    L   EFV  +K ++ R E+  L    S +G  LS  +L  FL   Q   G       +E    + + +E S+  +    + +DGF  YL S +  ++D  +  +  DM +PL HYFI++S+NTYLMEDQL+GPSS   +I  RA   GCR +++DCWDG N EP+IYHG+TLTSK+     +  I KYAF  S YP+I++IENHCSV QQ +L   ++  LG  +    +    SS+ PSP+QL+ ++++ GK+L      G        +  G  E G VS+EDE  E   + V      R +K      M+L   + Y   + +  F+R                      R   S W  ++S  +E  A +L  E    F+ HN   L  VYP   R DSSNYNPQ+ WN GCQIVALN+QT G  MDL  G F +NG CGYVLKP  +          ++  P I   T  L I+VIS QQLPK   S +KG++IDP V +++ G P+D +  +T+ ++ N +NP ++E   F + V ++AL+RF+V D D +  +DF+ QY+I+F  ++ GYRHI LL+  G  +  + LF+HV I N
Sbjct:    1 WIYDCFKKADKNKDGRMTFKEVKNLLKMMNIDMNEHHAQHLFEMADMSRSGT---LEGIEFVVFYKLLTQRDELQALFSSLSGDGSVLSRGELAAFLRDFQREEGCEELRFAEELASSITERHELSNIARSLSVMTLDGFVRYLTSPDGSLWDQRHDSIGHDMTRPLSHYFISSSHNTYLMEDQLRGPSSTEAYISSRAFRKGCRCVELDCWDGQNGEPVIYHGHTLTSKILFSDVIRTIEKYAFQVSDYPVILSIENHCSVAQQAVLARHMQSILGDKLLTAPLAGLPSSQLPSPEQLRGKVLVKGKRLP-----GPWPREAVPVANGHDESGEVSDEDEAAEMEDESVRNCVRQRGKKCKQNLSMELSNCVVYCRSVQFPGFSR---------------------PRDQASAW--DISSFTETKARKLLREDGNEFVRHNTLQLSRVYPAGRRTDSSNYNPQEFWNVGCQIVALNFQTAGDEMDLHDGHFRQNGGCGYVLKPAFLCDPTTA-FQPENPQPGIGLHTVRLTIKVISGQQLPKVPHS-NKGSIIDPLVRVEVHGVPLDNARYETKYIDNNGFNPQWNEILSFNINVPEVALLRFVVEDHDTATPNDFVAQYSIAFSSLRQGYRHIPLLSRDGTRVEPSSLFIHVKIAN 625          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Match: plch2a (phospholipase C, eta 2a [Source:ZFIN;Acc:ZDB-GENE-030131-6367])

HSP 1 Score: 247.669 bits (631), Expect = 1.867e-69
Identity = 132/337 (39.17%), Postives = 201/337 (59.64%), Query Frame = 2
Query:  161 LDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYSLSE------CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIK-IDCW 1150
            L  M +G+ MIK+    +   R ++LD Q + +RW PS +K+ KAKI ID +RE+  G          E      C   I +G   + L ++  SA+EA  W+ GL  L+AG +   + D L  + +TRD+WL++ F EAD    G L   +V+ LM  LN  +   ++KQ  +E D     D+G LT EEF  +++++STR +++ +L+RYSN  + L++++L  FL+ EQ MT +++E C++++  +EP  E KQ+G LGIDGFT+Y+ S   DIF+ E+  V QDM QPL HYFIA+S+NTYL  DQL   S  + +   L  GCR ++ + CW
Sbjct:    5 LTAMQSGTQMIKLKGGPKGLPRLYYLDEQRSCIRWRPS-RKQEKAKIAIDSVREVCEGRHSEIFQRYPEGSFDPACCLCIYHGSHTEWLAVVTGSADEARSWLTGLRYLMAGIN---DEDCLAKRQRTRDQWLKQTFMEADKNGDGSLSIDEVLLLMHKLNVNLPRRKVKQMFQEADTD--TDKGTLTFEEFCALYQKMSTRRDLYLILLRYSNRKDHLTVDELQRFLQIEQQMTDVSREHCVDVVNMFEPCEENKQQGILGIDGFTNYMRSPEGDIFNMEHYKVNQDMMQPLSHYFIASSHNTYLTGDQLMSHSRADMYAWVLQAGCRCVEGLSCW 335          

HSP 2 Score: 62.3882 bits (150), Expect = 4.771e-10
Identity = 38/112 (33.93%), Postives = 57/112 (50.89%), Query Frame = 2
Query: 1892 CQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGST--SKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNA 2218
            C  +A  Y+  GL ++LS    S +  C     P      L       +D +P      L ++VIS QQLPKP  S    +G +IDP+V +++ G PVDC +E+TR ++ N 
Sbjct:  672 CHDLATLYKAEGLTINLSHAKASAHRPCTTNSSPGCRAVCLGTFRPFSEDPLPGYPKTQLIVKVISGQQLPKPPDSMLGDRGEIIDPFVEVEIIGLPVDCCKEQTRVIDDNG 783          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Yeast
Match: PLC1 (Phospholipase C; hydrolyzes phosphatidylinositol 4,5-biphosphate (PIP2) to generate the signaling molecules inositol 1,4,5-triphosphate (IP3) and 1,2-diacylglycerol (DAG); involved in regulating many cellular processes; Plc1p and inositol polyphosphates are required for acetyl-CoA homeostasis which regulates global histone acetylation [Source:SGD;Acc:S000006189])

HSP 1 Score: 230.335 bits (586), Expect = 3.748e-63
Identity = 198/766 (25.85%), Postives = 353/766 (46.08%), Query Frame = 2
Query:  299 IPIDDIREIRHGIAKSG---------IYSLSECAFTIVYGI--EFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQ-TRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGE-FLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDM-NQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTD----IPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSR------QKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFS-------RNGNCGYVLKPEIMRHQLLLDMHHKDGIPDIL--------PQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLC-------------GTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAI 2440
            + +D +++IR G   S          + S S+    I+Y +  +  +L ++A +  + N +++ +  L+  R +  ES +L D +Q  R  W   V  + + + K  L   DV +L    +  ++T ++ +  +  DI  +G       E+F+ + K    R E+  +  +++      LS E+   FL  EQ      +      I+  EP+     +  +G DGFT +L         P  + V +++ ++PL HYFIA+S+NTYL+  Q+    SV G+I+ L  GCR ++ID WDG N  P++ HG  LTS + L+  +  I KYAF++S YPLII++E +C+   Q + + +++  L + +Y     + + PSP +LK++I+L  KK ++    +  N    +        + E     ++D     S       Q++ R     +A  +  +  +S +  I F  F               +S T+     S+   +V ++ +   ++L      S   HN+  L+ VYP++ R  SSN+NP   W  G Q+VA N+QT  +   L+   F         +   GYVLKP+    +LL  +     IP I         P T+ IR++S Q LP+   ++   N  + +V ++               GT +  +E  T++  GN +NP++D      +  + +  ++F+V+ +++     I    +    ++ GYRHI L N  GE      LF+H  I
Sbjct:  146 LELDSVKDIRIGDTASTYQEEVDPKRLRSDSKLWIAIIYKVSNKLKALHVVALNELDFNTFLSCICGLVKLRRELMESILLPDNSQFARIHWQITVSEKEEDEKKDTLSFADVKKLCDKFHIYVSTGQLLEFFQLADINHNGLLNYFEFEKFIKILK---NRKEVNMIWSKFTKPPHSHLSFENFFQFLITEQHEQVDRQTAWSYFIKYREPT-----QLTMGQDGFTKFLKE------QPYLVEVKEELYSKPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQGCRCVEIDIWDGENG-PVVCHG-FLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQKLASLIMREVLAEQLYFVGTRTDKLPSPRELKHKILLKSKKTSEATRGLSVNEPFPSSFSSSYESANEQELRMKDDSTNSSSATNSSSMQRIKRIGLKKHADIINDVSNISGIHGIKFRNFS------------LPESKTIAHCF-SLNERKVEYMIKDKHLKL------SLDKHNRRYLMRVYPHVLRYKSSNFNPIPFWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPK----KLLPVVTKAKMIPLIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDKGTRISATEASTKSSQGNGFNPIWDAEVSITLKDTDLTFIKFMVISEETQ----IASVCLKLNYLRMGYRHIPLFNMEGEQYIFCTLFIHTQI 868          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO46546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPQ0])

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 420/1056 (39.77%), Postives = 627/1056 (59.38%), Query Frame = 2
Query:   95 KTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYSL------SECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVL 3235
            K+VSFSS P    K II+  DCL +M NG +++KI  N RQY+R F +D   + +RW PS+KK  KAKI +D +REIR G        +       +CAF+I+YG  FD+L L+A S +EAN+W+ GL  L+   S++    ++   + T   WL+E F  AD   KG L+E++V+ +++ L   +  + +KQ+ K   +     +  L+ EEF++ +KE++TRPEI+FLL RY++N ++L+ +DLLLFLE+EQG+T   K +C+E+I   EP+ EG++K  LGIDGFT YL+  +CDIFDP+   +CQDM QPL HYFIA+S+NTYL+++QL G SS+ G+I AL  GCR +++DCWDG  DEPIIYHG+TLTSK+  ++T+E I ++AF  S YP+I++IENHC V+QQ I+   LK  L   +Y   P   E   PSP+ LK RI++  KKL     N               E G VSEEDE +E +    ++  + +     KL   LSD+  +                    Q           W  E+  L+E  A RL N + + F+ +NK  L  +YP+  RV SSNYNPQD+WNCGCQ+VALNYQT G+MM +++G F  NG CGYVLKP +MR ++   + + KD IP I PQ + I+VIS QQ PKP+GST+KG+VIDPYV I++ G P D ++E+TRTV  N +NPVFDE+FEF + + ++AL RF+V DDD IGD FIGQYTI   C+Q G RH+RLL   G+ + +A LFVHV I +    G++ ++    KS+  ++Y   +K +G+  +DE FK A   L++  ++R+    ++ N +E C +   SN+KQCIR +         SS L                              +       + + +  E +P F          +P+ +KK++   ++VV   K++ + +DS+ E++  C++  ME++E L   C  + +K ++  +A E+F WN+R+++GQ++L+   +Q+  ++LR      Q +G  +L
Sbjct:    1 KSVSFSSRP--EDKKIINAADCLTFMQNGCELMKIRSNSRQYQRFFAIDEDFSTLRWKPSSKKPEKAKISMDTVREIRSGKNTEIFREMDRDDIQEDCAFSIIYGDNFDTLNLVAYSPDEANIWVTGLRCLVD--SEKDPLQLITIDSLTLHTWLKEQFVLADMGGKGRLNEIEVLTVLRQLKVQIPEVIVKQRFKATAVSSAPQKNSLSREEFLSFYKELTTRPEIYFLLARYASNNDYLTTDDLLLFLESEQGITRAGKHYCLEIISRCEPTEEGRKKKCLGIDGFTQYLMESDCDIFDPDQQNICQDMTQPLSHYFIASSHNTYLLDNQLSGRSSIEGYIAALQQGCRCVELDCWDGPYDEPIIYHGHTLTSKIMFKETVEAIEEHAFDVSPYPVILSIENHCCVKQQQIMAKYLKEILKDKLYTEAPGEDETFLPSPEALKGRILIKNKKLPASIDN-------------DEEAGEVSEEDEYVEENGHDANKNPRKTT----KLARELSDLVSL--------------CKSVTFQDFQYSADNQKFW--ELCSLNEALARRLGNAYPEEFVNYNKRCLSRIYPSGKRVGSSNYNPQDMWNCGCQLVALNYQTPGIMMHVNSGKFLENGECGYVLKPSVMRDEIAYFNPNTKDAIPGISPQIVQIKVISGQQFPKPKGSTAKGDVIDPYVTIEVFGIPSDIAQERTRTVPHNGFNPVFDETFEFHINLPEIALFRFVVQDDDFIGDGFIGQYTIPLNCMQQGDRHLRLLAFDGDPLDSATLFVHVTIASINEAGQRQRKHSLRKSKKGREYT-SMKTVGVKAVDETFKNAIQPLRDGADLRENLQTSLANFKEICGVAPRSNLKQCIRLL---------SSRL------------------------------EPGPEGTTLELVLKDELYPYF-----EALGCVPEMMKKALLSMEQVVQDSKNLIENADSIYERVVHCQQAGMEWHEDLYNTCTKDGLKGKRLNKALESFAWNIRVLKGQAELLLAAKQECQDYLR------QVSGFYIL 968          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO38229 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH9])

HSP 1 Score: 486.493 bits (1251), Expect = 2.084e-158
Identity = 275/702 (39.17%), Postives = 412/702 (58.69%), Query Frame = 2
Query:  353 YSLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSS--EWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTR--KISNAPKMKLMCYLSD-MFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRH-QLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAI 2440
            YSL  C  ++ +G +  SL L+A S E AN+W+ GL  LI               NQ++  WL + F + D    G L   +V +L+ +LN  +    IK++ +    ++ G    L  EEF   FK I+TR EI  ++ ++++    +++EDL  FL  +QG+  ++K++C  +I TYEP+ EG++  QLGIDG T+YLLS   DIFD  +  V QDM QPL HYFIA+S+NTYLMEDQLKGPSSV+ +I A + GCR +++DCWDG N +PI+YHG+TLTSK+  +  ++ ++++AF  S YP+I+++ENHC++  Q  +   L+  LG  ++    +++    PSP+ LK ++++ GKKL   P       G +D        G VS+EDE  +  ++ ++  R  + S   K+KL   LS  + YI+   F +                  + S  +    ++S   E     LA   +  F+ +N   L   YP  +RVDSSNYNPQ  WN GCQIVALNYQT G  M L+ G F  N   GYVLKP  MR+  +  + ++    P +  + L I+VIS QQLPKP+GS+SKG VIDPYV +++ G   D ++ KT+ +  N +NPV++E  +  + V ++A++RF V D+D   DDFIGQ+++    ++TGYRHI LL+  GE +P+A LFVHV +
Sbjct:   10 YSLDTC-ISVKFGAD-RSLDLVAKSVETANLWLVGLQTLI--------------NNQSKCTWLIDAFEKFDKNKDGELGLSEVTKLLNALNVNITPKTIKKRFRVS--EQAGAEAALNKEEFAEFFKAIATRDEIVEIMNKFTSGKAHMNVEDLQKFL-YKQGVKEVSKQYCDIIISTYEPTEEGQRDKQLGIDGLTNYLLSKEGDIFDTAHDKVYQDMRQPLSHYFIASSHNTYLMEDQLKGPSSVDAYINAFNKGCRCVELDCWDGDNGDPIVYHGHTLTSKIKFKDIIQAVAEHAFKVSDYPVILSLENHCNIENQRKIAEHLENILGDKLFKDPVDTALTSLPSPESLKGKVLIKGKKLK--PEQEMAAVGEDD--------GTVSDEDEAADIEQEDLAAAREGEESKEKKVKLAKELSRCVNYISSVGFKN-----------------FEHSKENAKFYQMSSFVESKVATLAQNKAAGFVEYNTRQLSRTYPAGSRVDSSNYNPQVAWNVGCQIVALNYQTDGEYMHLNQGRFRENKRAGYVLKPAYMRNPDIKFNPNNPKSCPGVKKKLLIIQVISGQQLPKPQGSSSKGEVIDPYVEVKIYGVNSDSADFKTKVIKDNGFNPVWNEEIKKLLYVPELAMLRFCVYDEDVGKDDFIGQFSLPITSLRTGYRHIHLLDIKGEPLPHASLFVHVML 665          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO31556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXK4])

HSP 1 Score: 350.517 bits (898), Expect = 1.656e-108
Identity = 215/587 (36.63%), Postives = 320/587 (54.51%), Query Frame = 2
Query:  725 VFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSS--EWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMF--YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHA------IRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRH-QLLLDMHHKDG-IPDILPQTLHIRVISAQQLPKPRGSTS-KGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            ++K IS R E+  L    S+NG +++++DL  F+  +Q    +T + C ELI+ +E S  GK + QLGIDGF S++ S +  +F+P +  + QDMNQPL HYFIA+S+NTYL+  QLKG SSV  +   L  GCR +++DCWDG ++EPI+YHG+TLTSK+  +  ++ I + AF  S YP+I+++ENHCSV+ Q  +   LK  LG  +Y    + +    PSP     +I++ GK    I  +                     E D+ I+   +KV   R +          +++D     IN+                   +   K  I S+   E+   S+ H+      +   ++ +  F+  NK  +  +YP   RVDSSNY+P   W  GCQIVALN+QT    M L  G F +NGN GYVLKP+ +R  +L  D   +DG  P I P+ L + VISA QL +   S S   +  DPYV +++ G P D +   T  +     NPV++E F+  V V ++A+V+F+V D+D   DDF+GQ  I FE +  GYR I+LL+ +G  +P   LFVHV I++
Sbjct:    1 MYKFISKRKEVDLLFRNVSSNGAWVTVDDLEDFMTKDQRF-DVTHKTCKELIKKFEVSQRGKAQLQLGIDGFLSFINSQHASLFNPAHEKIYQDMNQPLSHYFIASSHNTYLLGHQLKGSSSVQAYRDVLERGCRCVELDCWDGDDEEPIVYHGHTLTSKVLFKDIVQAIKESAFKVSPYPVIVSLENHCSVQFQIKMAEHLKGILGSLLYTTPVDFTLDALPSPKFFLNKILVRGKTGKSIVDD--------------------KEMDKEIDSFDRKVQIERSVQETDFRGTKEHVADELSQLINYI-----------------SNEKFKSFIESM---EMGHFSQTHSFVESEMLYFLDKSASEFVEFNKHQISRIYPGNLRVDSSNYDPIKPWTVGCQIVALNHQTNSEEMQLHYGKFRQNGNTGYVLKPKFLRDPELTFDPDPQDGKFPGIQPKRLQLTVISAFQLLEIEESWSLVRDEPDPYVQVEVHGVPADKATFTTHGLTDTTLNPVWNEEFQTIVHVPELAMVQFVVYDEDYGFDDFLGQVVIPFESLMEGYRQIQLLDMSGLPLPGTTLFVHVKISD 546          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO46562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPT6])

HSP 1 Score: 340.502 bits (872), Expect = 2.670e-101
Identity = 188/502 (37.45%), Postives = 295/502 (58.76%), Query Frame = 2
Query:  137 NIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYSLSEC-----AFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQ---FIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGS-TECGYVSEEDENIEFSRQKVS----RTRKISNAPKMKLMC 1603
            ++ +  + +  M  GS++IK+    ++Y RT+FLD +   + W PS KK ++AKIP++ ++EIR G         SE       FT+++G  F +L L+AA+ EEA  W+ GL  L+A     GE++    + + RD WL+ +++ AD    G L   +V  LM  LN  ++  ++++  K  D       G L  EEF N +K ISTR E++ LL++Y N+ E +++++LL FL  EQ +T   +E+C  +IQTYEP+   K+   LGIDGFTSYLLS + +IF+PE+  V QDM +PL HYFIA+S+NTYL  DQL   SS++ ++R L  GCR +++DCWDG + EP++YHG T+TSK+  R  +  I+ +AF+++ YP+I+++ENHCSV QQ  + + ++ T       ++    +  + PSP +L  +I++  KKL   P        +ED+  G  TE     E DE  +F   +V+     TRK    P +  +C
Sbjct:    9 SVFTVDESIALMRRGSELIKLRSASKKYPRTYFLDSELANISWTPS-KKGDRAKIPVNTVKEIREGTVSDAFSQCSEVFPEERCFTLIHGESFATLDLVAANREEAMHWMIGLRYLMA--QHYGENEPTR-RQKARDLWLRGIYTAADKSGDGLLSIDEVYFLMHKLNVKISNRQVRENFKAADTDTVNSSGLLDFEEFANFYKSISTRRELYMLLLKYGNSKENMTVQELLNFLRIEQRVTECDEEYCSNIIQTYEPADSNKKNMLLGIDGFTSYLLSADGEIFNPEHSDVYQDMTRPLSHYFIASSHNTYLTGDQLASASSMDMYVRVLQSGCRCLELDCWDGKDGEPVVYHGYTMTSKVKFRYVILNINDFAFLNNRYPVILSLENHCSVEQQKFMANFMRDTFKDILCILFFMLFDGKDLPSPQELMGKILIKTKKL---PV-----ALSEDLEEGEVTEEDSADEMDECFKFRSDEVNPLKRNTRKCILHPFVAFVC 498          

HSP 2 Score: 217.624 bits (553), Expect = 1.433e-58
Identity = 111/242 (45.87%), Postives = 150/242 (61.98%), Query Frame = 2
Query: 1733 EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIM--RHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGST--SKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITN 2446
            EV  + E  A R  +  +  F  + +  L  +YP   R+DSSN NPQ  WNCGCQ+VALNYQT G M+ ++ G F  NGNCGYVLKP+I+    Q    M  KD IP +  + L IRVIS QQLPKP+ S    +G +IDPYV +++ G P D S+ +T+TV  N +NPV++E+  F +    +ALVRF+V D+D IG DFIGQ T+ F+ I  G+RH+ L     E +  A +F HV I +
Sbjct:  633 EVISIPEPRAYRFTDTKATQFTRYTRYKLCRIYPAGYRIDSSNPNPQTFWNCGCQLVALNYQTEGRMLQINRGKFRANGNCGYVLKPDILCKESQSFDPMTRKD-IPGVSKKVLKIRVISGQQLPKPKDSILGDRGEIIDPYVEVEIIGIPADTSKYRTKTVIDNGFNPVWEETMVFLLNFPDIALVRFVVWDEDPIGRDFIGQMTLPFQSIMPGFRHVHL-----EGLDQATVFCHVTIMD 868          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Match: EDO43813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXP6])

HSP 1 Score: 281.952 bits (720), Expect = 2.167e-81
Identity = 218/726 (30.03%), Postives = 343/726 (47.25%), Query Frame = 2
Query:  359 LSECAFTIVYG---IEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNK--GFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEF-VNVFKE----ISTRPEIFFLLIRYSNNGE-FLSIEDLLLFLEAEQG---MTGITKEFC-----MELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGAND--EPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHN----PNSSEWPSP--DQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISN--APKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRH-QLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRT--VNGNAYNPVFDES-FEF-EVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHV 2434
            L+E A TIV+G   ++   +  +++S+  A  W   L ++            L + N+    +L++ +++   Q    G +   +VI+ + S +S     RI+  L+ V +  HG    ++ E+F  ++F E    +  R +I  +        + ++  E L+ F+   Q    +  I   +C      E+I+ YEP+ +  +KG   + G T YL+S +     P+ L + QDM QP+ HYFI +S+NTYL   QL G SSV  + + L  GCR I++DCWDG  +  EP+I HG TL ++++ +  +E I++ AF +S YP+I++ ENHC+ +QQ  + S      G  +        P     P P    L  +I++  KK  D   N        + +   T        + N E       R   +    AP M L   ++    ++F  FD               SA   RS       E+S   E  A     E    F+ +NK  L  +YP  TRV S NY PQ  WN GCQ+VALN+QT+ L M L+ G F  NG CGY+LKP  MR      D   +  +  I+   +H++VIS Q L + +  T        YV +++ G P D   +K RT  V  N  NPV+D+  FEF +V +  +A++R  V ++       IGQ  +  + +  GYRHI+L N+    +    LFVH+
Sbjct:   20 LTEKAITIVHGANMVDLMYVTFVSSSSTMARQWTDSLVKITHN---------LLEINECPTTFLKKQYTKICVQTTQDGKVSVKNVIKYISS-SSKEDRKRIQDALQSVGLP-HGKNDAISLEKFSFDIFWEFYNRLCNRQDIDKIFTEIGTKKKPYMVTEQLVDFINNNQRDPRLNEILYPYCNEEKAREIIRKYEPNQDFVKKGHFSVQGLTRYLMSEDNAPIHPDRLSLHQDMTQPISHYFINSSHNTYLTGHQLTGKSSVEMYRQTLLAGCRCIELDCWDGKTEDQEPVITHGMTLCTEISFKDVIEAIAECAFKTSDYPVILSFENHCTPKQQLKMASYCVNIFGDMLLSKPLDDYPLEEGRPLPPLKVLMRKIVIKNKKPIDSEPNATSDQAFSNNSAPPTPATEDKPPEINGEVDPDASQRDSTVEEEAAPDMALSELVNYFQPVHFKSFD--------------VSAKRNRSY------EMSSFVETVATTQLKEKPVEFVNYNKRQLSRIYPKGTRVGSENYMPQIFWNAGCQLVALNFQTLDLAMMLNLGIFEYNGRCGYILKPSFMRRSDRTFDPFAESTVDGIIAGAVHVKVISGQLLTEKKVGT--------YVEVEMYGLPADTVRKKYRTKVVPNNGINPVYDDDPFEFKKVVLPSLAVLRIAVYEESG---KLIGQRILPVDGLNPGYRHIKLRNDCNLPLTLPVLFVHI 703          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: plcl2 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:101167900])

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 439/1047 (41.93%), Postives = 641/1047 (61.22%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIY-SLSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFS-RQKVSRTRKISNAP-KMKLMCYLSDMFYI-NFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLR 3193
            KKTVSFSS P E  K I    DC+  M +G+++ K+  N R Y R F LD     +RW P+ K+  KAK+ I  I+E+R G        +G Y  +SE CAF+I++G  ++SL L+A +A+ AN+W+ GL  LI+       + +   +N  R  WL ++F E D  N   +     +QL+K LN G+  ++I+ K KE+   +      +  EEF+ VF ++ TRPEI+FL +++S+N EFL  +DL++FLEAEQGM  ++++  +E+IQ YEPS EG+ KG L +DGF++YL+S  C IFDP++  VCQDMNQPL HY+I AS+NTYL+EDQ +GPS V G+IRAL +GCR +++D WDG ++EP+IY G+T+TS++  R  ++ I+KYAFV+S YPLI+++ENHCS++QQ ++   LK  LG  IY   P   +   PSP +LK +I+L GKKL     + C+          +TE G V++EDE  E S R  +  T +   AP K +L   LSD+  +     F D                    S  S    E+   +E+ A R A +    F+ +NK  L  +YP++ R+DSSN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR Q+     + KD +P + PQ LHI++IS Q  PKP+GS +KG+V+DPYV +++ G P DC E++T+TVN N  NP+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI FEC+Q G+RH+ L + TGEV+P+ +LFVHVAITN+RGGGK  KRG+SV+   K +    ++ L I V+DEVFK A   L+E  ++R+   +A+ + +E C L   +N+KQCI A L+  ++   ++PL                         FN  ++  N              P+ L         L + LKK +  ++ V+   K++ + SD + E+I   +K AMEF+E L +L     +K RK  +A E+F WN+ +++GQ+DL+   R +   +L+
Sbjct:   80 KKTVSFSSMPTE--KKISRASDCISAMVDGTELKKVRSNSRIYHRYFLLDADMQSLRWEPTKKESEKAKLDIKSIKEVRTGKNTDTFRTNGTYDQISEDCAFSIIFGENYESLDLVANTADVANIWVTGLRYLIS-YGNHTLNMIESSQNNMRSSWLSDLFDEEDIDNSKQITLCAAVQLIKKLNPGIKNVKIELKFKELQKAQDKAGSSVRKEEFIEVFHDLCTRPEIYFLFVQFSSNKEFLDTKDLMIFLEAEQGMAQVSEDTSLEVIQKYEPSKEGRLKGWLSLDGFSNYLMSPECHIFDPDHKSVCQDMNQPLSHYYINASHNTYLIEDQFRGPSDVTGYIRALKMGCRCVELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDVINKYAFVASEYPLILSLENHCSLKQQKVMFQHLKKILGDKIYTDPPKPEDCFLPSPSELKGKILLKGKKL----GSACN----------ATE-GEVTDEDEGAEMSQRVSIESTEQQIIAPKKFQLSKDLSDLVTLCKSVEFQD-----------------FPSSFQSQKHWELCSFNEVFASRCACDFPGDFVNYNKKFLARIYPSLMRIDSSNMNPQDFWKCGCQIVAMNYQTPGLMMDLNIGWFRQNGNCGYVLRPAIMREQVSYFSANTKDSVPGVSPQLLHIKIISGQNFPKPKGSGAKGDVVDPYVYVEIHGIPADCGEQRTKTVNQNGDNPLFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQPGFRHVPLQSLTGEVLPHTFLFVHVAITNRRGGGKPHKRGLSVRKGKKSREYASMRVLQIKVVDEVFKTALLPLREATDLRENMQNAIVSFKELCGLSAVANLKQCILA-LSPRLTGPDNTPLLV-----------------------FNLKDQYPNLE------------PQSL---------LSEVLKKVVTTYEMVIQTSKALLEGSDGVYERIQQAQKAAMEFHENLHDLAVKEGLKGRKLHKAEESFTWNITILKGQADLLKHARIEVQENLK 1046          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: ENSORLT00000006087.2 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:101171092])

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 443/1108 (39.98%), Postives = 655/1108 (59.12%), Query Frame = 2
Query:   86 NEKKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHG-----IAKSGIYS-LSE-CAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGES--DVL-DDKNQTRDKWLQEVFSEADFQNK-----GFLDELDVIQLMKSLNSGMATIRIKQKLKEV----------------DIQRHGDRG----RLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSS--EWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAP---------KMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPE----------VSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLD 3238
            + KKTVSFSST  E  K I S  DC+  M  GS++ K+ PN R Y+R + +D     + W PS K+ +KA+I +  IRE+R G        SG+Y  +SE CAF+I+YG  ++SL L+A SAE AN+W+ GL  L+    Q G+   D+L   ++  R +WL+ +FS A+ + +     G   +L  I+L++S+N G+++ +++ + KE+                +I+ H +      R+  +EFV VF +  TRPEI+FLL+++S+N EFL  +DL+ F+EAEQGM  + +E  ++LIQ++EPS EG+Q+G L +DGFTSYL S  C +FDPE+  VCQDM+QPL HY+I +S+NTYL+EDQ +GPS ++G+IRAL +GCR ++ID WDG ++EP++  G+TL+  L LR  LE I ++AFV+S YPLI+ IENHCS+ QQ++L   L  TLG+++Y   P       PSP+ L++RI++ GKKL              D      E G VSEEDE  E    K+      S AP         +  +     +  ++   RF              S   TL +SI+ I  P           VSF   L A+RLA +    F+ HNK  L  VYP+  R+DSSN NPQDLW CGCQIVA+N+QT GLMMDL+  +F +NGNCGYVL+P IMR ++       +D +P + PQ LH++VIS Q LPKP+GS +KG+V+DPYV +++ G P DC+E +TRTV  N  NP+FDESFEF++ + ++A+VRF+VLDDD IGD+FIGQYTI  EC+Q GYRH+ L + TGE + +A LFVHVA+TN+RGGGK  KRG+SV+   + +    ++ LG+  +D+VFK A+P L+E  ++R    ++++  RE C +   +N+ QC+ A     +S+  + P                                      P+ +    +++P            LPD L++ +  ++ +VNA K+V ++SD + +KI   +  AMEF+E L  L     +K  K  RA E+F WNV +++GQ+DL+   + +   +++   ++   TG L  D
Sbjct:  101 DRKKTVSFSSTLTE--KKISSAADCIHAMVEGSELKKVRPNSRVYQRYYLMDAGLQALFWEPSKKESDKARIALASIREVRTGRNTETFRTSGVYEQISEDCAFSIIYGEMYESLDLVANSAEVANIWVTGLRYLM----QYGKHAFDMLASSRDSLRLRWLERLFSSANLEGEDDAKEGIPLQL-AIKLIQSVNPGVSSAKVELRFKEIQRVREKSCGSVTDDGCEIKDHSESKKLGERVCKQEFVEVFHDFCTRPEIYFLLVQFSSNKEFLDAKDLMKFIEAEQGMAQVCEETSLKLIQSHEPSEEGRQQGHLSLDGFTSYLTSAECRLFDPEHDNVCQDMSQPLSHYYINSSHNTYLIEDQFRGPSDISGYIRALKMGCRCVEIDVWDGPDEEPVVCTGHTLSPPLVLRCVLEAIGRFAFVASEYPLILCIENHCSLHQQHVLLQHLTRTLGRWLYTDPPAEGILYLPSPETLRHRILIKGKKL------------KPDF---DGEDGDVSEEDEGAEMC-HKMKVVNSGSAAPGGTESDVMQRSVIAVTQPNPPHLPLQRFQ--------LLREFSDLVTLCQSISFIDFPTSSKSQKPWELVSFHESL-AVRLAGDSPGDFVNHNKRFLSRVYPSPARIDSSNMNPQDLWKCGCQIVAMNFQTAGLMMDLNTAWFRQNGNCGYVLRPAIMRQEVSYFCADTRDTVPGVSPQLLHVKVISGQNLPKPKGSGAKGDVVDPYVYMEIHGIPADCAERRTRTVIQNGDNPIFDESFEFQINLPELAMVRFVVLDDDFIGDEFIGQYTIPLECLQPGYRHVPLQSLTGEELLHAQLFVHVALTNRRGGGKPHKRGLSVRKARRGRDYTALRVLGLRAVDDVFKMASPLLREATDLRGNMQNSVSVFRELCGVSAVANLMQCVLA-----LSSRVTGP-----------------------------------EGTPLLLFDLQDNYPTL-----EAQGPLPDVLRRVVSTYEAMVNASKAVMELSDGIHDKILHIQSTAMEFHEKLQILAAKEGLKGSKVCRAVESFSWNVTILKGQADLLKHAKAEVQENMKQVHDSA-LTGNLTKD 1130          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: si:ch211-210g13.5 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:101171670])

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 413/1073 (38.49%), Postives = 632/1073 (58.90%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS--LS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQT-RDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNA---PKMKLMCYLSDMF----YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDRNAKSS 3256
            KKTVSFSS P +R  N  ST  C+ +M  G +M K+  N R Y R F LD   + +RW PS K   KAK+ I  I+E+R G     + S  LS     ECAF+I+YG  ++SL L+A++ +  + W+ GL  L++    R   D++D   Q+ R  W+  VF  AD + KG +D     Q++K LN GM   RI+ K KE+   +      +  + FV  + E+ TRPEIFFLL+++S+N E+L  +DL+LF++ EQG+ G+T+E C +++Q +EPS+EG+++G L IDGFT+YLLS  C IFDP++  VCQDM QPL HY+I +S+N  L++D   G S ++ +IRAL +GCR ++I  WDG + EP++Y G+++ +++   K L+ +++YAF SS YPLI+ +  HC + QQ ++   LK  LG  +Y   P+  E   PSP++LK +I+L  KKL   P +     G+            V++E+E +E SR+  +  R   N     K++L   LSD+      + F  F+                 T KR     W  E+   +E+ A R ANE  + F+ +NK  L  VYP   R+D+SN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + +D +P +  Q LHI++IS Q LPKPRGS +KG+V++PY+ +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A++RF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L + TGE +PN  LFVHVAITN+RGGGK  KRG+SV+   K +     K  GI  +DE+F+ +   L+E  ++R+   +AM + +E C L   +N+KQCI  +    +++                                         SL +T+ + SE +P            +P+ L+K +  +D ++   K++ + +D +  K+   ++  ++F+E L  +     +K RK  +A E++ WN+ +++GQ+DL+   + +A++ LR      Q+ G   L++N  +S
Sbjct:   11 KKTVSFSSMPSDRKIN--STAACMAFMMKGCEMKKVRSNSRMYNRYFLLDPDMHWLRWEPSKKDSEKAKLEIKSIKEVRLGKKTPVLRSNGLSDQFPDECAFSIIYGDNYESLDLVASTPDVVSTWVMGLRYLVS--YGRHTVDMVDPCQQSLRTSWISSVFELADVEKKGHIDLFRATQIIKGLNPGMKESRIELKFKELQKAKDQHGETINMDSFVEAYCELCTRPEIFFLLVQFSSNKEYLDSKDLMLFVDVEQGVEGVTEEMCKDIVQKFEPSTEGRERGYLSIDGFTNYLLSSECHIFDPQHKRVCQDMTQPLSHYYINSSHNASLLDDHFWGSSDISSYIRALRMGCRSVEIVVWDGHDSEPVVYIGSSVATQIAFSKVLDILNQYAFESSEYPLILCLVTHCCILQQRVMAQHLKKILGDKLYTETPHKEENYLPSPEKLKGKILLKSKKL---PPSCTDAEGD------------VTDEEEGLEMSRRVGADDRDQLNGLGCKKIRLCRELSDLVSLCKSVQFRDFE-----------------TSKRD-QKFW--EICSFNEVDANRFANEFPEEFVCYNKRLLSRVYPTPMRIDASNMNPQDFWKCGCQIVAMNYQTPGLMMDLNLGWFRQNGNCGYVLRPAIMREEVSYFSANARDSLPGVSAQLLHIKIISGQNLPKPRGSAAKGDVVEPYIYVEIHGIPADCAEQRTKTVSQNGDNPIFDESFEFQINLPELAVLRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLQSLTGEFLPNTTLFVHVAITNRRGGGKAHKRGLSVRKGRKAREYTTTKTTGIKAVDELFRASTQPLREATDLRENVQNAMVSFKELCGLTPAANMKQCILTVSTWLMNS---------------------------------------ERSLQVTVDL-SETYPTM-----EAQGPVPELLRKVLNAYDMMIQTSKTLIESADVVYSKLTQAQRAGLDFHEDLHRIGAKEGLKGRKLQKAMESYAWNITVLKGQADLLKHAKSEALDTLRQIHYAAQSCG---LNKNGAAS 996          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: si:ch211-210g13.5 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:101171670])

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 413/1073 (38.49%), Postives = 632/1073 (58.90%), Query Frame = 2
Query:   92 KKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS--LS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQT-RDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNA---PKMKLMCYLSDMF----YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDRNAKSS 3256
            KKTVSFSS P +R  N  ST  C+ +M  G +M K+  N R Y R F LD   + +RW PS K   KAK+ I  I+E+R G     + S  LS     ECAF+I+YG  ++SL L+A++ +  + W+ GL  L++    R   D++D   Q+ R  W+  VF  AD + KG +D     Q++K LN GM   RI+ K KE+   +      +  + FV  + E+ TRPEIFFLL+++S+N E+L  +DL+LF++ EQG+ G+T+E C +++Q +EPS+EG+++G L IDGFT+YLLS  C IFDP++  VCQDM QPL HY+I +S+N  L++D   G S ++ +IRAL +GCR ++I  WDG + EP++Y G+++ +++   K L+ +++YAF SS YPLI+ +  HC + QQ ++   LK  LG  +Y   P+  E   PSP++LK +I+L  KKL   P +     G+            V++E+E +E SR+  +  R   N     K++L   LSD+      + F  F+                 T KR     W  E+   +E+ A R ANE  + F+ +NK  L  VYP   R+D+SN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + +D +P +  Q LHI++IS Q LPKPRGS +KG+V++PY+ +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A++RF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L + TGE +PN  LFVHVAITN+RGGGK  KRG+SV+   K +     K  GI  +DE+F+ +   L+E  ++R+   +AM + +E C L   +N+KQCI  +    +++                                         SL +T+ + SE +P            +P+ L+K +  +D ++   K++ + +D +  K+   ++  ++F+E L  +     +K RK  +A E++ WN+ +++GQ+DL+   + +A++ LR      Q+ G   L++N  +S
Sbjct:  110 KKTVSFSSMPSDRKIN--STAACMAFMMKGCEMKKVRSNSRMYNRYFLLDPDMHWLRWEPSKKDSEKAKLEIKSIKEVRLGKKTPVLRSNGLSDQFPDECAFSIIYGDNYESLDLVASTPDVVSTWVMGLRYLVS--YGRHTVDMVDPCQQSLRTSWISSVFELADVEKKGHIDLFRATQIIKGLNPGMKESRIELKFKELQKAKDQHGETINMDSFVEAYCELCTRPEIFFLLVQFSSNKEYLDSKDLMLFVDVEQGVEGVTEEMCKDIVQKFEPSTEGRERGYLSIDGFTNYLLSSECHIFDPQHKRVCQDMTQPLSHYYINSSHNASLLDDHFWGSSDISSYIRALRMGCRSVEIVVWDGHDSEPVVYIGSSVATQIAFSKVLDILNQYAFESSEYPLILCLVTHCCILQQRVMAQHLKKILGDKLYTETPHKEENYLPSPEKLKGKILLKSKKL---PPSCTDAEGD------------VTDEEEGLEMSRRVGADDRDQLNGLGCKKIRLCRELSDLVSLCKSVQFRDFE-----------------TSKRD-QKFW--EICSFNEVDANRFANEFPEEFVCYNKRLLSRVYPTPMRIDASNMNPQDFWKCGCQIVAMNYQTPGLMMDLNLGWFRQNGNCGYVLRPAIMREEVSYFSANARDSLPGVSAQLLHIKIISGQNLPKPRGSAAKGDVVEPYIYVEIHGIPADCAEQRTKTVSQNGDNPIFDESFEFQINLPELAVLRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLQSLTGEFLPNTTLFVHVAITNRRGGGKAHKRGLSVRKGRKAREYTTTKTTGIKAVDELFRASTQPLREATDLRENVQNAMVSFKELCGLTPAANMKQCILTVSTWLMNS---------------------------------------ERSLQVTVDL-SETYPTM-----EAQGPVPELLRKVLNAYDMMIQTSKTLIESADVVYSKLTQAQRAGLDFHEDLHRIGAKEGLKGRKLQKAMESYAWNITVLKGQADLLKHAKSEALDTLRQIHYAAQSCG---LNKNGAAS 1095          
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Match: si:ch211-210g13.5 (inactive phospholipase C-like protein 2 [Source:NCBI gene;Acc:101171670])

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 400/1049 (38.13%), Postives = 617/1049 (58.82%), Query Frame = 2
Query:  134 KNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTFFLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYS--LS-----ECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQT-RDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSE--WPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNA---PKMKLMCYLSDMF----YINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQL-LLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGM 3226
            + I ST  C+ +M  G +M K+  N R Y R F LD   + +RW PS K   KAK+ I  I+E+R G     + S  LS     ECAF+I+YG  ++SL L+A++ +  + W+ GL  L++    R   D++D   Q+ R  W+  VF  AD + KG +D     Q++K LN GM   RI+ K KE+   +      +  + FV  + E+ TRPEIFFLL+++S+N E+L  +DL+LF++ EQG+ G+T+E C +++Q +EPS+EG+++G L IDGFT+YLLS  C IFDP++  VCQDM QPL HY+I +S+N  L++D   G S ++ +IRAL +GCR ++I  WDG + EP++Y G+++ +++   K L+ +++YAF SS YPLI+ +  HC + QQ ++   LK  LG  +Y   P+  E   PSP++LK +I+L  KKL   P +     G+            V++E+E +E SR+  +  R   N     K++L   LSD+      + F  F+                 T KR     W  E+   +E+ A R ANE  + F+ +NK  L  VYP   R+D+SN NPQD W CGCQIVA+NYQT GLMMDL+ G+F +NGNCGYVL+P IMR ++     + +D +P +  Q LHI++IS Q LPKPRGS +KG+V++PY+ +++ G P DC+E++T+TV+ N  NP+FDESFEF++ + ++A++RF+VLDDD IGD+FIGQYTI FEC+Q GYRH+ L + TGE +PN  LFVHVAITN+RGGGK  KRG+SV+   K +     K  GI  +DE+F+ +   L+E  ++R+   +AM + +E C L   +N+KQCI  +    +++                                         SL +T+ + SE +P            +P+ L+K +  +D ++   K++ + +D +  K+   ++  ++F+E L  +     +K RK  +A E++ WN+ +++GQ+DL+   + +A++ LR      Q+ G+
Sbjct:    5 RKINSTAACMAFMMKGCEMKKVRSNSRMYNRYFLLDPDMHWLRWEPSKKDSEKAKLEIKSIKEVRLGKKTPVLRSNGLSDQFPDECAFSIIYGDNYESLDLVASTPDVVSTWVMGLRYLVS--YGRHTVDMVDPCQQSLRTSWISSVFELADVEKKGHIDLFRATQIIKGLNPGMKESRIELKFKELQKAKDQHGETINMDSFVEAYCELCTRPEIFFLLVQFSSNKEYLDSKDLMLFVDVEQGVEGVTEEMCKDIVQKFEPSTEGRERGYLSIDGFTNYLLSSECHIFDPQHKRVCQDMTQPLSHYYINSSHNASLLDDHFWGSSDISSYIRALRMGCRSVEIVVWDGHDSEPVVYIGSSVATQIAFSKVLDILNQYAFESSEYPLILCLVTHCCILQQRVMAQHLKKILGDKLYTETPHKEENYLPSPEKLKGKILLKSKKL---PPSCTDAEGD------------VTDEEEGLEMSRRVGADDRDQLNGLGCKKIRLCRELSDLVSLCKSVQFRDFE-----------------TSKRD-QKFW--EICSFNEVDANRFANEFPEEFVCYNKRLLSRVYPTPMRIDASNMNPQDFWKCGCQIVAMNYQTPGLMMDLNLGWFRQNGNCGYVLRPAIMREEVSYFSANARDSLPGVSAQLLHIKIISGQNLPKPRGSAAKGDVVEPYIYVEIHGIPADCAEQRTKTVSQNGDNPIFDESFEFQINLPELAVLRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLQSLTGEFLPNTTLFVHVAITNRRGGGKAHKRGLSVRKGRKAREYTTTKTTGIKAVDELFRASTQPLREATDLRENVQNAMVSFKELCGLTPAANMKQCILTVSTWLMNSE---------------------------------------RSLQVTVDL-SETYPTM-----EAQGPVPELLRKVLNAYDMMIQTSKTLIESADVVYSKLTQAQRAGLDFHEDLHRIGAKEGLKGRKLQKAMESYAWNITVLKGQADLLKHAKSEALDTLRQIHYAAQSCGL 971          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000046236.1 (SMESG000046236.1)

HSP 1 Score: 1481.08 bits (3833), Expect = 0.000e+0
Identity = 759/765 (99.22%), Postives = 761/765 (99.48%), Query Frame = 2
Query: 1007 MNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDRNAKSSVTDDADKLHSISVDL 3301
            M QPLPHYFIAASYNTYLMEDQLKGPSS NGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKL DIPTNGCHKNGNEDIT+GSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNKRGGGKKTKRGISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNSTSSSHCSNSPSASQSVQSLSKFNYMEKSHNSSLPITMAITSEDFP FLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDR+AKSSVTDDADKLHSISVDL
Sbjct:    1 MTQPLPHYFIAASYNTYLMEDQLKGPSSGNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLADIPTNGCHKNGNEDITHGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNKRGGGKKTKRGISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNSTSSSHCSNSPSASQSVQSLSKFNYMEKSHNSSLPITMAITSEDFPTFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDRSAKSSVTDDADKLHSISVDL 765          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000046236.1 (SMESG000046236.1)

HSP 1 Score: 1424.84 bits (3687), Expect = 0.000e+0
Identity = 737/765 (96.34%), Postives = 741/765 (96.86%), Query Frame = 2
Query: 1007 MNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNXXXXXXXXXXXISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNXXXXXXXXXXXXXXXXXXXXXKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKKSIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDRNAKSSVTDDADKLHSISVDL 3301
            M QPLPHYFIAASYNTYLMEDQLKGPSS NGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKL DIPTNGCHKNGNEDIT+GSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNKRGGGKKTKRGISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNSTSSSHCSNSPSASQSVQSLSKFNYMEKSHNSSLPITMAITSEDFP FLINHNNESTQLPDSLKK IQ    ++               KIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDR+AKSSVTDDADKLHSISVDL
Sbjct:    1 MTQPLPHYFIAASYNTYLMEDQLKGPSSGNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLADIPTNGCHKNGNEDITHGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNKRGGGKKTKRGISVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNLRESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNSTSSSHCSNSPSASQSVQSLSKFNYMEKSHNSSLPITMAITSEDFPTFLINHNNESTQLPDSLKKKIQITTFMI---------------KIDLCKKKAMEFYETLPELCELNDIKTRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLVLDRSAKSSVTDDADKLHSISVDL 750          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000046181.1 (SMESG000046181.1)

HSP 1 Score: 1415.21 bits (3662), Expect = 0.000e+0
Identity = 688/690 (99.71%), Postives = 689/690 (99.86%), Query Frame = 2
Query:  296 KIPIDDIREIRHGIAKSGIYSLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTG 2365
            KIPIDDIREIRHGIAKSGIYSLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKL DIPTNGCHKNGNEDIT+GSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTG
Sbjct:   18 KIPIDDIREIRHGIAKSGIYSLSECAFTIVYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRDKWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLADIPTNGCHKNGNEDITHGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTG 707          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000046181.1 (SMESG000046181.1)

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 609/611 (99.67%), Postives = 610/611 (99.84%), Query Frame = 2
Query:  533 KWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTG 2365
            KWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKL DIPTNGCHKNGNEDIT+GSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTG
Sbjct:    7 KWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQRHGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEAEQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLADIPTNGCHKNGNEDITHGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTG 617          
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Match: SMESG000046181.1 (SMESG000046181.1)

HSP 1 Score: 1046.19 bits (2704), Expect = 0.000e+0
Identity = 508/512 (99.22%), Postives = 509/512 (99.41%), Query Frame = 2
Query:  842 MTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDXXXXXXXXXXXASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGYRHI 2377
            MTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKL DIPTNGCHKNGNEDIT+GSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTG  HI
Sbjct:    1 MTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDPENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRYIKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAIENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKKLADIPTNGCHKNGNEDITHGSTECGYVSEEDENIEFSRQKVSRTRKISNAPKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAPEVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLWNCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHHKDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDCSEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQYTISFECIQTGSSHI 512          
The following BLAST results are available for this feature:
BLAST of Phosphoinositide phospholipase C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCL20.000e+041.20phospholipase C like 2 [Source:HGNC Symbol;Acc:HGN... [more]
PLCL20.000e+041.20phospholipase C like 2 [Source:HGNC Symbol;Acc:HGN... [more]
PLCL20.000e+040.80phospholipase C like 2 [Source:HGNC Symbol;Acc:HGN... [more]
PLCL20.000e+040.80phospholipase C like 2 [Source:HGNC Symbol;Acc:HGN... [more]
PLCL10.000e+039.91phospholipase C like 1 (inactive) [Source:HGNC Sym... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pll-10.000e+039.70Phosphoinositide phospholipase C [Source:UniProtK... [more]
pll-10.000e+039.70Phosphoinositide phospholipase C [Source:UniProtK... [more]
plc-44.650e-5431.91Phosphoinositide phospholipase C [Source:UniProtK... [more]
plc-11.822e-3739.901-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
plc-11.879e-3739.901-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plc21C3.059e-3929.47gene:FBgn0004611 transcript:FBtr0078050[more]
Plc21C3.123e-3929.47gene:FBgn0004611 transcript:FBtr0078048[more]
Plc21C3.123e-3929.47gene:FBgn0004611 transcript:FBtr0078047[more]
Plc21C4.086e-3929.47gene:FBgn0004611 transcript:FBtr0330674[more]
Plc21C4.104e-3929.47gene:FBgn0004611 transcript:FBtr0078049[more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plcl20.000e+040.54phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
plcl20.000e+044.13phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
plcl20.000e+044.34phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
plcl20.000e+044.53phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
plcl20.000e+044.13phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLCL20.000e+040.70phospholipase C like 2 [Source:NCBI gene;Acc:10048... [more]
PLCL10.000e+039.92phospholipase C like 1 (inactive) [Source:NCBI gen... [more]
ENSXETT00000008582.10.000e+039.10inactive phospholipase C-like protein 2 [Source:NC... [more]
ENSXETT00000008695.10.000e+039.03inactive phospholipase C-like protein 2 [Source:NC... [more]
PLCH22.016e-17639.35phospholipase C eta 2 [Source:NCBI gene;Acc:100487... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plcl20.000e+041.20phospholipase C-like 2 [Source:MGI Symbol;Acc:MGI:... [more]
Plcl10.000e+040.00phospholipase C-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
Plcd33.500e-13334.42phospholipase C, delta 3 [Source:MGI Symbol;Acc:MG... [more]
Plcd11.285e-13034.69phospholipase C, delta 1 [Source:MGI Symbol;Acc:MG... [more]
Plcd13.915e-13034.82phospholipase C, delta 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UPR0|PLCL2_HUMAN0.000e+041.20Inactive phospholipase C-like protein 2 OS=Homo sa... [more]
sp|Q8K394|PLCL2_MOUSE0.000e+041.20Inactive phospholipase C-like protein 2 OS=Mus mus... [more]
sp|Q15111|PLCL1_HUMAN0.000e+040.23Inactive phospholipase C-like protein 1 OS=Homo sa... [more]
sp|Q3USB7|PLCL1_MOUSE0.000e+040.00Inactive phospholipase C-like protein 1 OS=Mus mus... [more]
sp|Q62688|PLCL1_RAT0.000e+040.44Inactive phospholipase C-like protein 1 OS=Rattus ... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JF870.000e+045.01Phosphoinositide phospholipase C OS=Lingula unguis... [more]
R7TQV10.000e+045.03Phosphoinositide phospholipase C OS=Capitella tele... [more]
K1PZR10.000e+045.61Phosphoinositide phospholipase C OS=Crassostrea gi... [more]
A0A1I8H5P42.240e-1245.81Phosphoinositide phospholipase C OS=Macrostomum li... [more]
A0A267FU342.297e-1249.05Phosphoinositide phospholipase C OS=Macrostomum li... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210g13.50.000e+038.35inactive phospholipase C-like protein 2 [Source:NC... [more]
plcl20.000e+044.11phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
si:ch211-210g13.50.000e+038.01inactive phospholipase C-like protein 2 [Source:NC... [more]
plcd4b4.902e-15337.781-phosphatidylinositol 4,5-bisphosphate phosphodie... [more]
plcd1a4.193e-14335.45phospholipase C delta 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plcl20.000e+041.08phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
plcl20.000e+039.22phospholipase C like 2 [Source:ZFIN;Acc:ZDB-GENE-1... [more]
plcd3b5.333e-13334.22phospholipase C, delta 3b [Source:ZFIN;Acc:ZDB-GEN... [more]
PLCD43.239e-12136.78phospholipase C delta 4 [Source:HGNC Symbol;Acc:HG... [more]
plch2a1.867e-6939.17phospholipase C, eta 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PLC13.748e-6325.85Phospholipase C; hydrolyzes phosphatidylinositol 4... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO465460.000e+039.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382292.084e-15839.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315561.656e-10836.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465622.670e-10137.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438132.167e-8130.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plcl20.000e+041.93inactive phospholipase C-like protein 2 [Source:NC... [more]
ENSORLT00000006087.20.000e+039.98inactive phospholipase C-like protein 2 [Source:NC... [more]
si:ch211-210g13.50.000e+038.49inactive phospholipase C-like protein 2 [Source:NC... [more]
si:ch211-210g13.50.000e+038.49inactive phospholipase C-like protein 2 [Source:NC... [more]
si:ch211-210g13.50.000e+038.13inactive phospholipase C-like protein 2 [Source:NC... [more]
back to top
BLAST of Phosphoinositide phospholipase C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046236.10.000e+099.22SMESG000046236.1[more]
SMESG000046236.10.000e+096.34SMESG000046236.1[more]
SMESG000046181.10.000e+099.71SMESG000046181.1[more]
SMESG000046181.10.000e+099.67SMESG000046181.1[more]
SMESG000046181.10.000e+099.22SMESG000046181.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017837 ID=SMED30017837|Name=Phosphoinositide phospholipase C|organism=Schmidtea mediterranea sexual|type=transcript|length=3465bp
TTTAAATTCCAGATTAAAATATATTTGCTATTAAATACAGTTATATTACT
TTGTGCTATTAGAAGTATATTATGATTTCATAATGAATGAAAAGAAAACT
GTTTCTTTTAGTAGCACACCTTTAGAGAGGAGTAAAAATATAATAAGCAC
ACCCGATTGCTTGGATTATATGACAAATGGATCGGATATGATCAAAATCC
ATCCAAATGGTCGTCAATACAAAAGAACATTCTTTCTCGATATACAGTCA
AATGAAGTAAGATGGTTGCCATCGAATAAAAAGCGCAACAAAGCGAAAAT
TCCGATTGATGACATTAGAGAAATTCGTCATGGAATTGCCAAAAGTGGAA
TTTACAGTTTATCAGAATGTGCATTTACCATAGTTTATGGAATTGAATTC
GACTCGCTCTGCTTGATTGCTGCCAGTGCGGAGGAAGCCAATGTGTGGAT
CGCGGGATTGACGAGACTTATAGCAGGGAGAAGTCAGCGAGGAGAATCGG
ATGTTCTTGATGACAAAAATCAGACTCGTGACAAATGGTTACAAGAAGTA
TTTTCTGAGGCTGATTTTCAAAATAAAGGCTTTCTCGATGAACTTGATGT
CATTCAATTAATGAAGTCTCTTAATTCTGGAATGGCAACTATTAGAATTA
AACAAAAGTTAAAGGAAGTTGACATTCAGAGACACGGTGACCGTGGCAGG
CTTACGTCAGAAGAATTTGTGAATGTGTTTAAAGAAATCTCGACTCGTCC
TGAAATATTCTTTTTACTTATAAGATACTCAAACAACGGTGAATTTCTAA
GTATTGAAGACTTATTACTATTTCTTGAAGCTGAGCAAGGAATGACTGGA
ATAACAAAAGAATTTTGTATGGAACTTATTCAAACTTATGAACCGTCCAG
TGAAGGCAAACAGAAAGGTCAATTAGGAATAGATGGTTTTACCTCTTATT
TATTATCTGGAAATTGCGACATTTTTGATCCTGAAAACCTTGTCGTATGT
CAAGACATGAATCAACCTCTTCCACATTATTTTATTGCAGCATCTTATAA
CACATACCTAATGGAAGATCAATTGAAAGGGCCATCAAGCGTTAATGGAT
TCATTCGAGCACTTAGCGTCGGATGTCGTTACATTAAAATTGATTGCTGG
GACGGTGCAAATGATGAACCAATTATTTATCATGGCAACACTTTAACATC
TAAACTCAATCTCAGAAAAACTTTGGAACAAATTAGTAAATATGCTTTCG
TGTCTTCGATCTATCCACTTATCATCGCCATTGAAAATCATTGTAGTGTT
CGTCAGCAATATATTCTTACTTCTCTTTTAAAAATGACATTGGGTCAATT
CATTTATGTTCATAATCCTAATTCTTCTGAATGGCCATCACCAGATCAGC
TGAAATATCGGATAATACTTGTAGGTAAAAAGCTGACTGATATTCCCACA
AATGGATGTCATAAAAATGGTAATGAGGATATTACATATGGTAGTACTGA
GTGTGGCTATGTATCTGAGGAAGACGAGAATATTGAATTTTCTAGACAGA
AAGTTTCACGAACAAGAAAAATTTCGAATGCTCCAAAAATGAAGTTGATG
TGCTACCTGTCAGATATGTTTTATATCAACTTTACCAGATTTGATGATTC
TCTGATGATGTTGAATAACAATTCTCTATCTGCAAGTCAATCTGCTACTT
TGAAAAGGTCCATCAATAGCATATGGGCACCTGAGGTTTCGTTTCTTTCA
GAATTGCATGCAATTCGTTTGGCTAATGAACACAGTCAGAGTTTTATGTA
TCATAATAAAAGTAATCTGGTTTGCGTCTATCCAAATATCACTCGGGTTG
ACAGTAGTAATTATAATCCACAAGATCTTTGGAATTGTGGCTGTCAAATT
GTTGCACTAAACTATCAGACAATGGGTTTGATGATGGATTTAAGTGCTGG
TTTCTTTTCTCGAAATGGTAACTGCGGATATGTTCTTAAACCCGAAATAA
TGCGCCACCAATTGCTATTGGATATGCATCATAAAGATGGAATTCCAGAC
ATTTTGCCCCAGACTCTTCATATTCGGGTAATAAGTGCTCAACAGTTACC
AAAACCAAGAGGTTCTACTTCTAAAGGCAATGTAATTGATCCTTATGTCG
TGATACAATTATGTGGAACTCCAGTTGATTGTTCGGAGGAGAAAACTAGG
ACGGTCAATGGAAATGCATATAATCCAGTTTTTGATGAATCGTTTGAATT
TGAAGTAGCAGTTTCTCAAATGGCTCTAGTTCGCTTTCTAGTTCTAGACG
ACGACTCAATCGGGGATGATTTTATTGGCCAATATACTATTTCTTTTGAA
TGTATTCAAACAGGTTATCGACACATAAGGTTGCTCAATAACACCGGTGA
AGTTATTCCTAATGCATATTTATTTGTACATGTAGCAATAACTAATAAAA
GAGGAGGAGGCAAAAAAACAAAAAGAGGAATATCAGTTAAAAGTCGCAGT
AAAAAGAAATACAACCATCAGATTAAAAAATTAGGAATCAGTGTAATAGA
TGAAGTTTTCAAACAAGCAAATCCAACTTTAAAAGAATGCTTTGAAATGC
GTCAGGAATTTATGGATGCTATGAATAATCTTCGTGAATCATGTAATCTT
CCTCATTTTTCAAATATTAAGCAATGCATTCGAGCTATATTAAATACAAG
CATATCCACACATAGTAGCAGTCCACTTCATTGTAATTCCACCTCATCCT
CTCACTGCTCAAACAGTCCTAGTGCGTCTCAGTCTGTGCAATCTTTATCA
AAATTTAATTATATGGAGAAATCGCATAATTCTTCTTTACCAATCACCAT
GGCCATTACAAGCGAGGATTTCCCCAAATTTCTAATAAATCACAACAATG
AAAGCACACAACTTCCAGATTCCCTAAAAAAGAGTATTCAGTGTTTTGAT
GAAGTGGTCAATGCTTGTAAGTCAGTCACCCAAATTAGTGATTCTTTGCA
AGAAAAGATTGATTTGTGTAAAAAGAAAGCTATGGAATTTTATGAAACGT
TGCCAGAATTGTGTGAATTAAATGACATCAAAACCAGAAAAGCAACTCGA
GCAGCCGAGAATTTTGTGTGGAATGTCCGATTGATTCAAGGTCAGTCGGA
TTTAATTTCTAAGCTTAGACAGGACGCAGTAAATCATCTAAGAAGTGCTA
AAGAAACTGGTCAAGCAACTGGAATGTTAGTTCTTGATAGAAACGCAAAA
TCCTCAGTTACTGATGATGCTGATAAATTGCATAGTATTTCAGTTGATTT
GTAGATTTATGTAATACGATGCACCATCAAATTAATTAATTAATCTTCCA
ACACGAACTTCTATTTTTGTCTATTTTAACCTATCAGATAATATTTGTTT
GTATTCAACTCAATTTGTCAATTTGAATTCATCGAGCATCAAAATACAGC
ACTCTTATATTGAAA
back to top

protein sequence of SMED30017837-orf-1

>SMED30017837-orf-1 ID=SMED30017837-orf-1|Name=SMED30017837-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1074bp
MNEKKTVSFSSTPLERSKNIISTPDCLDYMTNGSDMIKIHPNGRQYKRTF
FLDIQSNEVRWLPSNKKRNKAKIPIDDIREIRHGIAKSGIYSLSECAFTI
VYGIEFDSLCLIAASAEEANVWIAGLTRLIAGRSQRGESDVLDDKNQTRD
KWLQEVFSEADFQNKGFLDELDVIQLMKSLNSGMATIRIKQKLKEVDIQR
HGDRGRLTSEEFVNVFKEISTRPEIFFLLIRYSNNGEFLSIEDLLLFLEA
EQGMTGITKEFCMELIQTYEPSSEGKQKGQLGIDGFTSYLLSGNCDIFDP
ENLVVCQDMNQPLPHYFIAASYNTYLMEDQLKGPSSVNGFIRALSVGCRY
IKIDCWDGANDEPIIYHGNTLTSKLNLRKTLEQISKYAFVSSIYPLIIAI
ENHCSVRQQYILTSLLKMTLGQFIYVHNPNSSEWPSPDQLKYRIILVGKK
LTDIPTNGCHKNGNEDITYGSTECGYVSEEDENIEFSRQKVSRTRKISNA
PKMKLMCYLSDMFYINFTRFDDSLMMLNNNSLSASQSATLKRSINSIWAP
EVSFLSELHAIRLANEHSQSFMYHNKSNLVCVYPNITRVDSSNYNPQDLW
NCGCQIVALNYQTMGLMMDLSAGFFSRNGNCGYVLKPEIMRHQLLLDMHH
KDGIPDILPQTLHIRVISAQQLPKPRGSTSKGNVIDPYVVIQLCGTPVDC
SEEKTRTVNGNAYNPVFDESFEFEVAVSQMALVRFLVLDDDSIGDDFIGQ
YTISFECIQTGYRHIRLLNNTGEVIPNAYLFVHVAITNKRGGGKKTKRGI
SVKSRSKKKYNHQIKKLGISVIDEVFKQANPTLKECFEMRQEFMDAMNNL
RESCNLPHFSNIKQCIRAILNTSISTHSSSPLHCNSTSSSHCSNSPSASQ
SVQSLSKFNYMEKSHNSSLPITMAITSEDFPKFLINHNNESTQLPDSLKK
SIQCFDEVVNACKSVTQISDSLQEKIDLCKKKAMEFYETLPELCELNDIK
TRKATRAAENFVWNVRLIQGQSDLISKLRQDAVNHLRSAKETGQATGMLV
LDRNAKSSVTDDADKLHSISVDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0032228regulation of synaptic transmission, GABAergic
GO:0035556intracellular signal transduction
GO:0006629lipid metabolic process
GO:0007165signal transduction
GO:0016042lipid catabolic process
Vocabulary: molecular function
TermDefinition
GO:0050811GABA receptor binding
GO:0070679inositol 1,4,5 trisphosphate binding
GO:0004435phosphatidylinositol phospholipase C activity
GO:0005515protein binding
GO:0008081phosphoric diester hydrolase activity
GO:0005509calcium ion binding
GO:0004871signal transducer activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001192PI-PLC_fam
IPR001711PLipase_C_Pinositol-sp_Y
IPR000008C2_dom
IPR000909PLipase_C_PInositol-sp_X_dom
IPR011993PH-like_dom_sf
IPR011992EF-hand-dom_pair
IPR017946PLC-like_Pdiesterase_TIM-brl
IPR015359PLC_EF-hand-like
IPR002048EF_hand_dom
IPR001849PH_domain
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular