Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas

Overview
NameBreast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas
Smed IDSMED30017834
Length (bp)2211
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas (SMED30017834) t-SNE clustered cells

Violin plots show distribution of expression levels for Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas (SMED30017834) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas (SMED30017834) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas (SMED30017834) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017834

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017834SMESG000028562.1 Contig49595newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017834SMESG000028562.1 Contig49595uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30017834SMESG000028562.1 dd_Smed_v4_6476_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Human
Match: NEDD9 (neural precursor cell expressed, developmentally down-regulated 9 [Source:HGNC Symbol;Acc:HGNC:7733])

HSP 1 Score: 83.9593 bits (206), Expect = 4.975e-18
Identity = 51/145 (35.17%), Postives = 74/145 (51.03%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++   +LI        Q +AS +++ P       T+         N +    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    7 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVK---LLIGPM-----QETASSHEQ-PASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHG-------TQEQEVYQVP 135          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Human
Match: NEDD9 (neural precursor cell expressed, developmentally down-regulated 9 [Source:HGNC Symbol;Acc:HGNC:7733])

HSP 1 Score: 82.8037 bits (203), Expect = 1.301e-15
Identity = 48/145 (33.10%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ T    +Q ++ L            T+         N +    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    7 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGL---------MQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHG-------TQEQEVYQVP 135          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Human
Match: NEDD9 (neural precursor cell expressed, developmentally down-regulated 9 [Source:HGNC Symbol;Acc:HGNC:7733])

HSP 1 Score: 82.8037 bits (203), Expect = 1.335e-15
Identity = 48/145 (33.10%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ T    +Q ++ L            T+         N +    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    7 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGL---------MQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHG-------TQEQEVYQVP 135          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Human
Match: BCAR1 (BCAR1 scaffold protein, Cas family member [Source:HGNC Symbol;Acc:HGNC:971])

HSP 1 Score: 77.411 bits (189), Expect = 6.088e-14
Identity = 31/61 (50.82%), Postives = 45/61 (73.77%), Query Frame = 1
Query:  175 LQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
            L+   A+AL+DN+AE P ELSF+KGDI+TVL++  +G   WW+CSL  + G+ P NRL+ +
Sbjct:   21 LRNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKIL 81          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Human
Match: BCAR1 (BCAR1 scaffold protein, Cas family member [Source:HGNC Symbol;Acc:HGNC:971])

HSP 1 Score: 77.411 bits (189), Expect = 6.088e-14
Identity = 31/61 (50.82%), Postives = 45/61 (73.77%), Query Frame = 1
Query:  175 LQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
            L+   A+AL+DN+AE P ELSF+KGDI+TVL++  +G   WW+CSL  + G+ P NRL+ +
Sbjct:   21 LRNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKIL 81          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Fly
Match: p130CAS (gene:FBgn0035101 transcript:FBtr0301889)

HSP 1 Score: 77.7962 bits (190), Expect = 1.866e-14
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  160 HNIIILQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
              I+I  + +A+A++DN A+   EL FKKGDILTVL++  EG   WW+CSLR++ GL P NRL  +
Sbjct:   34 RRILIKSKLYAKAIYDNYADTSDELPFKKGDILTVLEQDTEGFQGWWLCSLRNRQGLCPGNRLRVL 99          

HSP 2 Score: 61.2326 bits (147), Expect = 2.649e-9
Identity = 49/175 (28.00%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  877 PASVCAPLKMT-----PEE---AVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLN-WSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            P  +C P  +T     P E   A+    + Q +TTA+ N+++ F    W++   L+  I  +K   L     +  L  F    L N+    D NL  K+   ++ L++A     D+ E LD    WS D++A+S         D L  ++  A+ +   VRS +  I GNA++LF
Sbjct:  379 PRVLCTPSTVTTTKELPLELSSALETLAKLQLQTTAAINRLLSFVVPNWRTRAQLEPAIMDLKLAALRLRTTLHDLAEFGEGALGNATRSEDRNLALKLRPLVRALRDANKLIHDSSESLDAQGAWSIDQLARSDEKHGCRPPDALDQLMVCAQTLTEDVRSTTSFIQGNASLLF 553          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Fly
Match: p130CAS (gene:FBgn0035101 transcript:FBtr0299864)

HSP 1 Score: 77.411 bits (189), Expect = 2.621e-14
Identity = 33/66 (50.00%), Postives = 45/66 (68.18%), Query Frame = 1
Query:  160 HNIIILQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
            H     Q+ +A+A++DN A+   EL FKKGDILTVL++  EG   WW+CSLR++ GL P NRL  +
Sbjct:   72 HRAKSAQKLYAKAIYDNYADTSDELPFKKGDILTVLEQDTEGFQGWWLCSLRNRQGLCPGNRLRVL 137          

HSP 2 Score: 61.2326 bits (147), Expect = 2.679e-9
Identity = 49/175 (28.00%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  877 PASVCAPLKMT-----PEE---AVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLN-WSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            P  +C P  +T     P E   A+    + Q +TTA+ N+++ F    W++   L+  I  +K   L     +  L  F    L N+    D NL  K+   ++ L++A     D+ E LD    WS D++A+S         D L  ++  A+ +   VRS +  I GNA++LF
Sbjct:  417 PRVLCTPSTVTTTKELPLELSSALETLAKLQLQTTAAINRLLSFVVPNWRTRAQLEPAIMDLKLAALRLRTTLHDLAEFGEGALGNATRSEDRNLALKLRPLVRALRDANKLIHDSSESLDAQGAWSIDQLARSDEKHGCRPPDALDQLMVCAQTLTEDVRSTTSFIQGNASLLF 591          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Fly
Match: p130CAS (gene:FBgn0035101 transcript:FBtr0299865)

HSP 1 Score: 61.6178 bits (148), Expect = 1.630e-9
Identity = 49/175 (28.00%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  877 PASVCAPLKMT-----PEE---AVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLN-WSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            P  +C P  +T     P E   A+    + Q +TTA+ N+++ F    W++   L+  I  +K   L     +  L  F    L N+    D NL  K+   ++ L++A     D+ E LD    WS D++A+S         D L  ++  A+ +   VRS +  I GNA++LF
Sbjct:  153 PRVLCTPSTVTTTKELPLELSSALETLAKLQLQTTAAINRLLSFVVPNWRTRAQLEPAIMDLKLAALRLRTTLHDLAEFGEGALGNATRSEDRNLALKLRPLVRALRDANKLIHDSSESLDAQGAWSIDQLARSDEKHGCRPPDALDQLMVCAQTLTEDVRSTTSFIQGNASLLF 327          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Fly
Match: p130CAS (gene:FBgn0035101 transcript:FBtr0299866)

HSP 1 Score: 61.6178 bits (148), Expect = 1.646e-9
Identity = 49/175 (28.00%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  877 PASVCAPLKMT-----PEE---AVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLN-WSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            P  +C P  +T     P E   A+    + Q +TTA+ N+++ F    W++   L+  I  +K   L     +  L  F    L N+    D NL  K+   ++ L++A     D+ E LD    WS D++A+S         D L  ++  A+ +   VRS +  I GNA++LF
Sbjct:  154 PRVLCTPSTVTTTKELPLELSSALETLAKLQLQTTAAINRLLSFVVPNWRTRAQLEPAIMDLKLAALRLRTTLHDLAEFGEGALGNATRSEDRNLALKLRPLVRALRDANKLIHDSSESLDAQGAWSIDQLARSDEKHGCRPPDALDQLMVCAQTLTEDVRSTTSFIQGNASLLF 328          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Fly
Match: p130CAS (gene:FBgn0035101 transcript:FBtr0072475)

HSP 1 Score: 61.6178 bits (148), Expect = 1.646e-9
Identity = 49/175 (28.00%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  877 PASVCAPLKMT-----PEE---AVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLN-WSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            P  +C P  +T     P E   A+    + Q +TTA+ N+++ F    W++   L+  I  +K   L     +  L  F    L N+    D NL  K+   ++ L++A     D+ E LD    WS D++A+S         D L  ++  A+ +   VRS +  I GNA++LF
Sbjct:  154 PRVLCTPSTVTTTKELPLELSSALETLAKLQLQTTAAINRLLSFVVPNWRTRAQLEPAIMDLKLAALRLRTTLHDLAEFGEGALGNATRSEDRNLALKLRPLVRALRDANKLIHDSSESLDAQGAWSIDQLARSDEKHGCRPPDALDQLMVCAQTLTEDVRSTTSFIQGNASLLF 328          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Zebrafish
Match: nedd9 (neural precursor cell expressed, developmentally down-regulated 9 [Source:ZFIN;Acc:ZDB-GENE-061013-318])

HSP 1 Score: 89.3521 bits (220), Expect = 7.239e-18
Identity = 63/192 (32.81%), Postives = 92/192 (47.92%), Query Frame = 1
Query:  169 IILQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYN 744
            ++LQ   A+AL+DN+ E P EL+F+KGDILTV+++   G   WW+CSL  + G+AP NRL+   +LI   P    Q  A+     P P          P       RP     +YQ P       P +  + Q+ PS D   +YQ+P    L + GT   V       T   +G +  AF  AS+  ++ Y+
Sbjct:    1 LVLQNLMAKALYDNVPESPEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIAPGNRLK---LLI--GPMFDGQTPAT-----PSP----------PHSHTLQQRPLTPQGVYQVP-------PSHQSIYQTPPSND---LYQVPHRGALAADGTPCKV------VTPVRVG-QTYAFSPASDSSHDLYD 155          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Zebrafish
Match: nedd9 (neural precursor cell expressed, developmentally down-regulated 9 [Source:ZFIN;Acc:ZDB-GENE-061013-318])

HSP 1 Score: 84.7297 bits (208), Expect = 2.008e-16
Identity = 61/186 (32.80%), Postives = 88/186 (47.31%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYN 744
             A+AL+DN+ E P EL+F+KGDILTV+++   G   WW+CSL  + G+AP NRL+   +LI   P    Q  A+     P P          P       RP     +YQ P       P +  + Q+ PS D   +YQ+P    L + GT   V       T   +G +  AF  AS+  ++ Y+
Sbjct:    7 MAKALYDNVPESPEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIAPGNRLK---LLI--GPMFDGQTPAT-----PSP----------PHSHTLQQRPLTPQGVYQVP-------PSHQSIYQTPPSND---LYQVPHRGALAADGTPCKV------VTPVRVG-QTYAFSPASDSSHDLYD 155          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Zebrafish
Match: efs (embryonal Fyn-associated substrate [Source:ZFIN;Acc:ZDB-GENE-030131-1658])

HSP 1 Score: 83.9593 bits (206), Expect = 3.386e-16
Identity = 54/131 (41.22%), Postives = 71/131 (54.20%), Query Frame = 1
Query:  175 LQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNS----RPKDEDSIYQFP---NEDIYVNP 546
            L    A+ALFDN AE P EL+F+KGDIL VL +  +G P WW+CSL  + G+APANRL     L++ST   Q   S++  D    PS  S    + P  SQQ        +D D +Y  P    E +Y +P
Sbjct:    3 LSTVLAKALFDNAAESPEELAFRKGDILMVLNQEQDGGPGWWLCSLHGRQGIAPANRLR----LLQST---QAPASSAGTDARRAPSVDS---VHLPS-SQQGKVNGLSAEDSDGVYLSPPSLAEGVYQSP 122          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Zebrafish
Match: bcar1 (BCAR1 scaffold protein, Cas family member [Source:ZFIN;Acc:ZDB-GENE-030131-2774])

HSP 1 Score: 77.411 bits (189), Expect = 3.703e-14
Identity = 41/126 (32.54%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIE--------------STPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP 522
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +  + +              S  Q    +  S Y+++P  ++++  +  F      NS   + D +Y  P
Sbjct:   49 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLEGWWLCSLHGRQGIVPGNRLKILVGMYDKQQQQQLQQLANQPSPTQSLINLPQSAYNKIPPAAQYTAMHPAFTPSGSANS--TNPDGVYMLP 172          

HSP 2 Score: 63.5438 bits (153), Expect = 7.035e-10
Identity = 37/154 (24.03%), Postives = 71/154 (46.10%), Query Frame = 1
Query:  913 EEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            ++A+ +  ++Q    +S + ++ F    W+S   ++  + +I+         ++ L  F+   + N+    D  L  K+ K +Q ++EA        + LD L WSP  +  S       GGD L  ++  AR V    + L+  + GNA++LF
Sbjct:  533 DQAMERLSRHQQAVESSVSLLMSFISGNWRSSTQMESNLPAIRQAVDRIRVAVRDLLEFARGAVANATQATDRTLQTKLGKQVQKMEEAFQGLVRYSQALDTLGWSPAALMTS---QPGTGGDDLDRLIMCARGVPDDTKQLASFLHGNASLLF 683          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Zebrafish
Match: bcar1 (BCAR1 scaffold protein, Cas family member [Source:ZFIN;Acc:ZDB-GENE-030131-2774])

HSP 1 Score: 77.411 bits (189), Expect = 3.910e-14
Identity = 41/126 (32.54%), Postives = 66/126 (52.38%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIE--------------STPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP 522
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +  + +              S  Q    +  S Y+++P  ++++  +  F      NS   + D +Y  P
Sbjct:   22 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLEGWWLCSLHGRQGIVPGNRLKILVGMYDKQQQQQLQQLANQPSPTQSLINLPQSAYNKIPPAAQYTAMHPAFTPSGSANS--TNPDGVYMLP 145          

HSP 2 Score: 63.5438 bits (153), Expect = 7.329e-10
Identity = 37/154 (24.03%), Postives = 71/154 (46.10%), Query Frame = 1
Query:  913 EEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            ++A+ +  ++Q    +S + ++ F    W+S   ++  + +I+         ++ L  F+   + N+    D  L  K+ K +Q ++EA        + LD L WSP  +  S       GGD L  ++  AR V    + L+  + GNA++LF
Sbjct:  506 DQAMERLSRHQQAVESSVSLLMSFISGNWRSSTQMESNLPAIRQAVDRIRVAVRDLLEFARGAVANATQATDRTLQTKLGKQVQKMEEAFQGLVRYSQALDTLGWSPAALMTS---QPGTGGDDLDRLIMCARGVPDDTKQLASFLHGNASLLF 656          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Xenopus
Match: CASS4 (Cas scaffold protein family member 4 [Source:NCBI gene;Acc:100490791])

HSP 1 Score: 83.5741 bits (205), Expect = 6.275e-16
Identity = 62/186 (33.33%), Postives = 82/186 (44.09%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYN 744
             ARA FDN A+ P EL+F+KGDILTVL +   GS  WW C L  + GL PANRL+   I+   TP +Q     S Y  L       N Y   P   +  S P  E        + +Y+ PL        P +    +YQ PV  P +    Y+  A    +   F +     A   AS   +E Y+
Sbjct:    7 LARAQFDNKADSPDELTFRKGDILTVLDQNIPGSEGWWRCYLHGRQGLVPANRLQLFTIIKNDTPSVQ-----SYYGTLGRQQSQQNIY-QVPSAPKITSLPTYEQM------DSVYIVPLT-------PKSVSGDLYQTPVSSPAQ---IYYEKANGSSSQHLFTLPRACRASKPASITQSELYD 170          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Xenopus
Match: CASS4 (Cas scaffold protein family member 4 [Source:NCBI gene;Acc:100490791])

HSP 1 Score: 83.5741 bits (205), Expect = 6.304e-16
Identity = 62/186 (33.33%), Postives = 82/186 (44.09%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYN 744
             ARA FDN A+ P EL+F+KGDILTVL +   GS  WW C L  + GL PANRL+   I+   TP +Q     S Y  L       N Y   P   +  S P  E        + +Y+ PL        P +    +YQ PV  P +    Y+  A    +   F +     A   AS   +E Y+
Sbjct:    2 LARAQFDNKADSPDELTFRKGDILTVLDQNIPGSEGWWRCYLHGRQGLVPANRLQLFTIIKNDTPSVQ-----SYYGTLGRQQSQQNIY-QVPSAPKITSLPTYEQM------DSVYIVPLT-------PKSVSGDLYQTPVSSPAQ---IYYEKANGSSSQHLFTLPRACRASKPASITQSELYD 165          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Xenopus
Match: bcar1 (BCAR1, Cas family scaffold protein [Source:NCBI gene;Acc:447979])

HSP 1 Score: 77.0258 bits (188), Expect = 6.907e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLERNTQGLEGWWLCSLHGRQGIVPGNRLKIL 63          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Xenopus
Match: bcar1 (BCAR1, Cas family scaffold protein [Source:NCBI gene;Acc:447979])

HSP 1 Score: 77.0258 bits (188), Expect = 6.914e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLERNTQGLEGWWLCSLHGRQGIVPGNRLKIL 63          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Xenopus
Match: srebf1 (sterol regulatory element binding transcription factor 1 [Source:Xenbase;Acc:XB-GENE-987572])

HSP 1 Score: 75.0998 bits (183), Expect = 3.031e-13
Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             ARAL+DN+ E   ELSF+KGDILTV+++   G   WW+CSL  + G+AP NRL+ +
Sbjct:    7 MARALYDNVPECAEELSFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIAPGNRLKLL 63          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Mouse
Match: Nedd9 (neural precursor cell expressed, developmentally down-regulated gene 9 [Source:MGI Symbol;Acc:MGI:97302])

HSP 1 Score: 89.3521 bits (220), Expect = 6.040e-20
Identity = 51/145 (35.17%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ TP            E P P     T+         NS+    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    1 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPVQETPG----------HEQPTPGPMHQTFGQQKLYQVPNSQAASRDTIYQVPPSYQNQGIYQVPTGHG-------TPEQDVYQVP 128          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Mouse
Match: Nedd9 (neural precursor cell expressed, developmentally down-regulated gene 9 [Source:MGI Symbol;Acc:MGI:97302])

HSP 1 Score: 89.3521 bits (220), Expect = 8.812e-18
Identity = 51/145 (35.17%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ TP            E P P     T+         NS+    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    7 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPVQETPG----------HEQPTPGPMHQTFGQQKLYQVPNSQAASRDTIYQVPPSYQNQGIYQVPTGHG-------TPEQDVYQVP 134          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Mouse
Match: Nedd9 (neural precursor cell expressed, developmentally down-regulated gene 9 [Source:MGI Symbol;Acc:MGI:97302])

HSP 1 Score: 88.9669 bits (219), Expect = 9.121e-18
Identity = 51/145 (35.17%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ TP            E P P     T+         NS+    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    7 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPVQETPG----------HEQPTPGPMHQTFGQQKLYQVPNSQAASRDTIYQVPPSYQNQGIYQVPTGHG-------TPEQDVYQVP 134          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Mouse
Match: Bcar1 (breast cancer anti-estrogen resistance 1 [Source:MGI Symbol;Acc:MGI:108091])

HSP 1 Score: 75.8702 bits (185), Expect = 1.402e-13
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLKIL 63          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Mouse
Match: Bcar1 (breast cancer anti-estrogen resistance 1 [Source:MGI Symbol;Acc:MGI:108091])

HSP 1 Score: 75.8702 bits (185), Expect = 1.414e-13
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLKIL 63          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. UniProt/SwissProt
Match: sp|O35177|CASL_MOUSE (Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 6.380e-17
Identity = 51/145 (35.17%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ TP            E P P     T+         NS+    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    7 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPVQETPG----------HEQPTPGPMHQTFGQQKLYQVPNSQAASRDTIYQVPPSYQNQGIYQVPTGHG-------TPEQDVYQVP 134          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. UniProt/SwissProt
Match: sp|Q14511|CASL_HUMAN (Enhancer of filamentation 1 OS=Homo sapiens OX=9606 GN=NEDD9 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 6.411e-15
Identity = 48/145 (33.10%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ T    +Q ++ L            T+         N +    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    7 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGL---------MQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHG-------TQEQEVYQVP 135          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. UniProt/SwissProt
Match: sp|P56945|BCAR1_HUMAN (Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 4.075e-13
Identity = 30/57 (52.63%), Postives = 43/57 (75.44%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL++  +G   WW+CSL  + G+ P NRL+ +
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKIL 63          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. UniProt/SwissProt
Match: sp|Q61140|BCAR1_MOUSE (Breast cancer anti-estrogen resistance protein 1 OS=Mus musculus OX=10090 GN=Bcar1 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 9.806e-13
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLKIL 63          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. UniProt/SwissProt
Match: sp|Q63767|BCAR1_RAT (Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.194e-12
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +
Sbjct:  101 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLKIL 157          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. TrEMBL
Match: A0A1I8GFK0 (Serine_rich domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 4.886e-18
Identity = 76/314 (24.20%), Postives = 152/314 (48.41%), Query Frame = 1
Query:  898 LKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSK--NCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFP---------EIPIETNFISNELSLTPSQKSDQSNAD--KANLL------------EVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELV 1764
            L++T  +AV + R+ +++ +  C+++ +F  ++WK+E  L + + S++    +  + +  L  F   +L N++   C D  L KK+WKHL++ +   +   DA+  +  L+W+P  +A++      +  D L   VS+AR++ IQ R+LS  +  NA +LFP          IPIET     +  +    ++  + +D  + NLL            E++ +++ ++   +E      +D   +LSS  R S S   + S  + +V  A +L   A  L +  +       +E   + L + LK ++  +K ++
Sbjct:  220 LRLTLADAVDRLRKLETDFSERCSRLYKFIHSRWKAEASLALNMASLRPTITELNELLGQLVEFHYGVLNNARLEACPDRALCKKVWKHLRVFERNAMEFADAVAGIRRLDWNPRLVAEACS---EQATDYLGFCVSSARDLQIQQRALSTAVHANAPLLFPVAFDQLDEKVIPIETEDWGQQQQMQRGSQNQNATSDYMRMNLLTDSTTGLPPGDRELLVIYSERLRMGSEAYAVMCQDLQGVLSS--RQS-SGAVIGSLCRSLVSRAYKLSQMAAMLHEGLHSVQLKSALEHLISRLGHQLKAILRTSKAVM 527          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. TrEMBL
Match: A0A267E4B0 (Serine_rich domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010386g1 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.001e-17
Identity = 52/177 (29.38%), Postives = 97/177 (54.80%), Query Frame = 1
Query:  898 LKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSK--NCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFP---------EIPIET 1395
            L++T  +AV + R+ +++ +  C+++ +F  ++WK+E  L + + S++    +  + +  L  F   +L N++   C D  L KK+WKHL++ +   +   DA+  +  L+W+P  +A++      +  D L   VS+AR++ IQ R+LS  +  NA +LFP          IPIET
Sbjct:  326 LRLTLADAVDRLRKLETDFSERCSRLYKFIHSRWKAEASLALNMASLRPTITELNELLGQLVEFHYGVLNNARLEACPDRALCKKVWKHLRVFERNAMEFADAVAGIRRLDWNPRLVAEACS---EQATDYLGFCVSSARDLQIQQRALSTAVHANAPLLFPVAFDQLDEKVIPIET 499          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. TrEMBL
Match: A0A267GYY6 (SH3 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009880g1 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.250e-16
Identity = 52/177 (29.38%), Postives = 97/177 (54.80%), Query Frame = 1
Query:  898 LKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSK--NCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFP---------EIPIET 1395
            L++T  +AV+  R+ +++ +  C+++ +F  ++WK+E  L + + S++    +  + +  L  F   +L N++   C D  L KK+WKHL++ +   +   DA+  +  L+W+P  +A++      +  D L   VS+AR++ IQ R+LS  +  NA +LFP          IPIET
Sbjct:  416 LRLTLADAVNMLRKLETDFSERCSRLYKFIHSRWKAEASLALNMASLRPTITELNELLGQLVEFHYGVLNNARLEACPDRALCKKVWKHLRVFERNAMEFADAVAGIRRLDWNPRLVAEACS---EQATDYLGFCVSSARDLQIQQRALSTAVHANAPLLFPVALDQLDEKVIPIET 589          

HSP 2 Score: 61.6178 bits (148), Expect = 5.574e-6
Identity = 26/60 (43.33%), Postives = 39/60 (65.00%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPIL 366
             A+AL+DN +    EL F++  ILTVL +   G   WW+C+ R + G+APANRL+ + +L
Sbjct:   39 LAKALYDNQSSYETELHFQRDAILTVLDQRPPGLTGWWLCAYRGRTGIAPANRLQLIGVL 98          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. TrEMBL
Match: A0A286YCE4 (Enhancer of filamentation 1 (Fragment) OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.252e-16
Identity = 51/145 (35.17%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ TP            E P P     T+         NS+    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:    1 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPVQETPG----------HEQPTPGPMHQTFGQQKLYQVPNSQAASRDTIYQVPPSYQNQGIYQVPTGHG-------TPEQDVYQVP 128          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. TrEMBL
Match: A0A1U8CTA1 (enhancer of filamentation 1-like OS=Mesocricetus auratus OX=10036 GN=LOC101826777 PE=4 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 2.128e-16
Identity = 50/145 (34.48%), Postives = 71/145 (48.97%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFP----NEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             ARAL+DN+ E   EL+F+KGDILTV+++   G   WW+CSL  + G+ P NR++ +   ++ T             E P P     T+         NS+    D+IYQ P    N+ IY  P  +G       T E  VYQ+P
Sbjct:   13 MARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPVQETSS----------HEQPTPGPMHQTFGQQKLYQVPNSQAASRDTIYQVPPSYQNQGIYQVPTGHG-------TPEQEVYQLP 140          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Cavefish
Match: nedd9 (neural precursor cell expressed, developmentally down-regulated 9 [Source:NCBI gene;Acc:103025873])

HSP 1 Score: 85.1149 bits (209), Expect = 1.430e-16
Identity = 56/151 (37.09%), Postives = 81/151 (53.64%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQ---FPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKS 630
             A+AL+DN+ E P EL+F+KGDILTV+++   G   WW+CSL  + G+AP NRL+   +LI   P  + Q ++S     P PS+   ++A+ P       RP     +YQ    P + IY  P    + Q  PS D   VYQ+P    L +
Sbjct:    7 MAKALYDNVPESPEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIAPGNRLK---LLI--GPMFENQTASS-----PAPSQ---SHAHQP-------RPHTPQGLYQPSPAPAQGIYQVPPPQDIYQVPPSQD---VYQVPQRSALAA 134          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Cavefish
Match: nedd9 (neural precursor cell expressed, developmentally down-regulated 9 [Source:NCBI gene;Acc:103025873])

HSP 1 Score: 85.1149 bits (209), Expect = 1.447e-16
Identity = 55/144 (38.19%), Postives = 79/144 (54.86%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQ---FPNEDIYVNPLNNGLIQSLPSTDEHSVYQMP 609
             A+AL+DN+ E P EL+F+KGDILTV+++   G   WW+CSL  + G+AP NRL+   +LI   P  + Q ++S     P PS+   ++A+ P       RP     +YQ    P + IY  P    + Q  PS D   VYQ+P
Sbjct:    1 MAKALYDNVPESPEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIAPGNRLK---LLI--GPMFENQTASS-----PAPSQ---SHAHQP-------RPHTPQGLYQPSPAPAQGIYQVPPPQDIYQVPPSQD---VYQVP 121          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Cavefish
Match: efs (embryonal Fyn-associated substrate-like [Source:NCBI gene;Acc:103023814])

HSP 1 Score: 84.7297 bits (208), Expect = 1.923e-16
Identity = 57/164 (34.76%), Postives = 71/164 (43.29%), Query Frame = 1
Query:  175 LQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPG 666
            L    A+ALFDN AE P EL+F+KGDIL VL++  +G P WW+CSL  + G+APANRL            LQ   +        D                 N R    DS+Y  P +   VN         L S D   VY  P   P    G Y +  G+PG
Sbjct:    3 LSTVLAKALFDNAAESPEELAFRKGDILMVLEQEQDGGPGWWLCSLHGRQGIAPANRLRL----------LQTAPAPGPVPPGTD-----------------NRRAPSVDSVYLSPGQQTRVN--------GLCSEDADGVYLSP---PSLGEGVYQSPGGAPG 128          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Cavefish
Match: bcar1 (BCAR1 scaffold protein, Cas family member [Source:NCBI gene;Acc:103028804])

HSP 1 Score: 76.2554 bits (186), Expect = 7.219e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +
Sbjct:    5 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLKIL 61          

HSP 2 Score: 61.6178 bits (148), Expect = 2.380e-9
Identity = 36/154 (23.38%), Postives = 70/154 (45.45%), Query Frame = 1
Query:  913 EEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            E+A+ +  + Q    +S + ++ F    W+S   ++  + SI+         ++ L  F+   + N+    D  L  K+ K +Q ++E+        + LD + W+P  +  +       GGD L  +V  AR V    + L+  + GNA++LF
Sbjct:  482 EQAMERLSRLQQAVESSASLLMSFISGNWRSPVQMESNLPSIRQAAERLRAAVRDLLEFARGAVANAAQATDRTLQAKLNKQVQKMEESFQGLVKYTQALDTIGWAPATLLAAPPTGT--GGDDLDRLVMCARGVPDDTKQLASFLHGNASLLF 633          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Cavefish
Match: bcar1 (BCAR1 scaffold protein, Cas family member [Source:NCBI gene;Acc:103028804])

HSP 1 Score: 76.2554 bits (186), Expect = 7.479e-14
Identity = 30/57 (52.63%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAM 357
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+ +
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLKIL 63          

HSP 2 Score: 61.6178 bits (148), Expect = 2.486e-9
Identity = 36/154 (23.38%), Postives = 70/154 (45.45%), Query Frame = 1
Query:  913 EEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            E+A+ +  + Q    +S + ++ F    W+S   ++  + SI+         ++ L  F+   + N+    D  L  K+ K +Q ++E+        + LD + W+P  +  +       GGD L  +V  AR V    + L+  + GNA++LF
Sbjct:  484 EQAMERLSRLQQAVESSASLLMSFISGNWRSPVQMESNLPSIRQAAERLRAAVRDLLEFARGAVANAAQATDRTLQAKLNKQVQKMEESFQGLVKYTQALDTIGWAPATLLAAPPTGT--GGDDLDRLVMCARGVPDDTKQLASFLHGNASLLF 635          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Yeast
Match: HSE1 (Subunit of the endosomal Vps27p-Hse1p complex; complex is required for sorting of ubiquitinated membrane proteins into intralumenal vesicles prior to vacuolar degradation, as well as for recycling of Golgi proteins and formation of lumenal membranes [Source:SGD;Acc:S000000994])

HSP 1 Score: 55.8398 bits (133), Expect = 1.214e-8
Identity = 24/53 (45.28%), Postives = 34/53 (64.15%), Query Frame = 1
Query:  184 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPAN 342
            R  RAL+D     P ELSF+KGD++TVL++ Y    +WW  +LR  +G+ P N
Sbjct:  220 RRVRALYDLTTNEPDELSFRKGDVITVLEQVYR---DWWKGALRGNMGIFPLN 269          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Yeast
Match: YSC84 (Actin-binding protein; involved in bundling of actin filaments and endocytosis of actin cortical patches; activity stimulated by Las17p; contains SH3 domain similar to Rvs167p; YSC84 has a paralog, LSB3, that arose from the whole genome duplication [Source:SGD;Acc:S000001058])

HSP 1 Score: 47.3654 bits (111), Expect = 7.043e-6
Identity = 20/51 (39.22%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  190 ARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPAN 342
            A AL++   E P +L+FKKGD++T+L+++ +   +WW      K G+ PAN
Sbjct:  414 AVALYNFAGEQPGDLAFKKGDVITILKKS-DSQNDWWTGRTNGKEGIFPAN 463          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Nematostella
Match: EDO49334 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHE5])

HSP 1 Score: 69.707 bits (169), Expect = 3.906e-15
Identity = 28/54 (51.85%), Postives = 41/54 (75.93%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRL 348
             A+AL+DNIA+   EL+F+KGD++TVL++  +G   WW+CSL  + G+AP NRL
Sbjct:    2 LAKALYDNIADSADELTFRKGDVITVLEKDIDGLFGWWLCSLHGRQGIAPGNRL 55          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Nematostella
Match: EDO45201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTF1])

HSP 1 Score: 48.1358 bits (113), Expect = 8.468e-6
Identity = 21/51 (41.18%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPA 339
            FA AL+D++   P EL+F+ GD++TV+  T   + +WW   +R +VG  PA
Sbjct:    7 FAEALWDHVTMDPEELTFRAGDVITVISMT---NVDWWFGQVRDQVGWFPA 54          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Medaka
Match: bcar1 (BCAR1 scaffold protein, Cas family member [Source:NCBI gene;Acc:101167688])

HSP 1 Score: 81.2629 bits (199), Expect = 2.058e-15
Identity = 44/103 (42.72%), Postives = 61/103 (59.22%), Query Frame = 1
Query:  166 IIILQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRS 474
            + + Q   A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+   IL+      Q+Q S S     PDP+  S     FP +S
Sbjct:    9 VFLSQNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLK---ILVGMYDNKQQQASPS----TPDPT--SQVLRPFPTKS 102          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Medaka
Match: cass4 (Cas scaffold protein family member 4 [Source:NCBI gene;Acc:101156487])

HSP 1 Score: 80.4925 bits (197), Expect = 3.545e-15
Identity = 55/175 (31.43%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  184 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPN-EDIYVNPLNNGL--IQSLPSTDE-------HSVYQMPVEDPLKSFGTYFNVAGSPGNTTY 678
            + A+AL+DN AE   EL+F+KGDILTVL +   G+ EWW C L  + GLAPANRL+                       LP P    N+     +R+  N +     +IYQ P+   +  +P+   +  I  +PS           S ++   E+P      +FN+A SP    Y
Sbjct:    3 KLAKALYDNTAECADELAFRKGDILTVLDQNVSGTSEWWRCLLYGRHGLAPANRLKL----------------------LPQPVATENSLNQETERANDNGQ-----NIYQIPSVPRVITSPVYEPMKAIYKVPSAPPSTSIFSVQSAFRHSTEEPSVDTPPFFNMASSPKGEVY 150          

HSP 2 Score: 65.0846 bits (157), Expect = 1.992e-10
Identity = 70/337 (20.77%), Postives = 136/337 (40.36%), Query Frame = 1
Query:  898 LKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF--PEI---PIETNFISNELSLTPSQKSDQSNADKANLLEVIRLFA------------------------------SQVTSQTEHVDETVKDFIKILSSQIRNSI-----------SKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLN 1770
            + ++P+E   K  + Q+    +  +++ F  + W+ +E LK  ++ I+       Q++    NF++ I  N++   D NL  +++K L +++++ +  +  ++ L+   W  DK+ Q       +  D L   V  AR V   V  L   I+ N  +LF  P+    P+ +    +    + + K D+ + +  N  + + L A                              S      EH    + +  ++    ++ +I             E  IS SK V+    +LV T   L     +  PNQ +  + N+LC  LK +  ATK+  L+
Sbjct:  434 VTLSPDEVCHKLLELQNSVVRAVPQLMVFVSSSWRHQEHLKKHLKEIRDAAELVSQSLLCFLNFTLDIKGNARRLTDTNLKTRLYKQLSIVEDSGVILQQTVKALNSEGWPLDKLCQDSGQV--QTPDQLDRFVMVARTVPDDVMRLVSIINANGKLLFRVPQKSAEPVSSPATGDAKKCSDANKQDEDSVEDNN--DYVELEAKTEEKKPKEMKETEAVTPASKTIGPDNQHPSSDKGTEEHKKSPMSEHCRLYFGALQKAIVGFVGSVSDGQPPEKFISQSKLVIMVGQRLVDT---LCREAQREKPNQTLLCKSNHLCALLKQLAVATKKAALH 763          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Medaka
Match: cass4 (Cas scaffold protein family member 4 [Source:NCBI gene;Acc:101156487])

HSP 1 Score: 80.1073 bits (196), Expect = 4.113e-15
Identity = 55/175 (31.43%), Postives = 80/175 (45.71%), Query Frame = 1
Query:  184 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPN-EDIYVNPLNNGL--IQSLPSTDE-------HSVYQMPVEDPLKSFGTYFNVAGSPGNTTY 678
            + A+AL+DN AE   EL+F+KGDILTVL +   G+ EWW C L  + GLAPANRL+                       LP P    N+     +R+  N +     +IYQ P+   +  +P+   +  I  +PS           S ++   E+P      +FN+A SP    Y
Sbjct:    3 KLAKALYDNTAECADELAFRKGDILTVLDQNVSGTSEWWRCLLYGRHGLAPANRLKL----------------------LPQPVATENSLNQETERANDNGQ-----NIYQIPSVPRVITSPVYEPMKAIYKVPSAPPSTSIFSVQSAFRHSTEEPSVDTPPFFNMASSPKGEVY 150          

HSP 2 Score: 62.003 bits (149), Expect = 1.720e-9
Identity = 37/159 (23.27%), Postives = 76/159 (47.80%), Query Frame = 1
Query:  898 LKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILF 1374
            + ++P+E   K  + Q+    +  +++ F  + W+ +E LK  ++ I+       Q++    NF++ I  N++   D NL  +++K L +++++ +  +  ++ L+   W  DK+ Q       +  D L   V  AR V   V  L   I+ N  +LF
Sbjct:  434 VTLSPDEVCHKLLELQNSVVRAVPQLMVFVSSSWRHQEHLKKHLKEIRDAAELVSQSLLCFLNFTLDIKGNARRLTDTNLKTRLYKQLSIVEDSGVILQQTVKALNSEGWPLDKLCQDSGQV--QTPDQLDRFVMVARTVPDDVMRLVSIINANGKLLF 590          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Medaka
Match: bcar1 (BCAR1 scaffold protein, Cas family member [Source:NCBI gene;Acc:101167688])

HSP 1 Score: 79.7221 bits (195), Expect = 5.935e-15
Identity = 43/96 (44.79%), Postives = 58/96 (60.42%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRS 474
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+   IL+      Q+Q S S     PDP+  S     FP +S
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLK---ILVGMYDNKQQQASPS----TPDPT--SQVLRPFPTKS 93          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Medaka
Match: bcar1 (BCAR1 scaffold protein, Cas family member [Source:NCBI gene;Acc:101167688])

HSP 1 Score: 79.7221 bits (195), Expect = 6.357e-15
Identity = 43/96 (44.79%), Postives = 58/96 (60.42%), Query Frame = 1
Query:  187 FARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRS 474
             A+AL+DN+AE P ELSF+KGDI+TVL+   +G   WW+CSL  + G+ P NRL+   IL+      Q+Q S S     PDP+  S     FP +S
Sbjct:    7 LAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLK---ILVGMYDNKQQQASPS----TPDPT--SQVLRPFPTKS 93          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Planmine SMEST
Match: SMESG000028562.1 (SMESG000028562.1)

HSP 1 Score: 1064.29 bits (2751), Expect = 0.000e+0
Identity = 562/566 (99.29%), Postives = 563/566 (99.47%), Query Frame = 1
Query:  184 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYNNRHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIPIETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ 1881
            RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGS GN TYFNIGPENEAFPAASNKINEYYNNRHDYSDSFSD TSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIP+ETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ
Sbjct:    8 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSQGNATYFNIGPENEAFPAASNKINEYYNNRHDYSDSFSDATSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIPLETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ 573          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Planmine SMEST
Match: SMESG000028562.1 (SMESG000028562.1)

HSP 1 Score: 1063.91 bits (2750), Expect = 0.000e+0
Identity = 562/566 (99.29%), Postives = 563/566 (99.47%), Query Frame = 1
Query:  184 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYNNRHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIPIETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ 1881
            RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGS GN TYFNIGPENEAFPAASNKINEYYNNRHDYSDSFSD TSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIP+ETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ
Sbjct:    2 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSQGNATYFNIGPENEAFPAASNKINEYYNNRHDYSDSFSDATSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIPLETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ 567          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Planmine SMEST
Match: SMESG000028562.1 (SMESG000028562.1)

HSP 1 Score: 1029.62 bits (2661), Expect = 0.000e+0
Identity = 543/566 (95.94%), Postives = 546/566 (96.47%), Query Frame = 1
Query:  184 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYNNRHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIPIETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ 1881
            RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGS GN TYFNIGPENEAFPAA    N + +            TSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIP+ETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ
Sbjct:    8 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSQGNATYFNIGPENEAFPAA----NSFSD-----------ATSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIPLETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ 558          
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Planmine SMEST
Match: SMESG000028562.1 (SMESG000028562.1)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 543/566 (95.94%), Postives = 546/566 (96.47%), Query Frame = 1
Query:  184 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYNNRHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIPIETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ 1881
            RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGS GN TYFNIGPENEAFPAA    N + +            TSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIP+ETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ
Sbjct:    2 RFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPEWWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFSNTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHSVYQMPVEDPLKSFGTYFNVAGSQGNATYFNIGPENEAFPAA----NSFSD-----------ATSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCAPLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKTNFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTKDALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSVTISGNANILFPEIPLETNFISNELSLTPSQKSDQSNADKANLLEVIRLFASQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVCTAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEFEPLVGLLKNVNASARNLQTIVVDSVTKEQ 552          
The following BLAST results are available for this feature:
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEDD94.975e-1835.17neural precursor cell expressed, developmentally d... [more]
NEDD91.301e-1533.10neural precursor cell expressed, developmentally d... [more]
NEDD91.335e-1533.10neural precursor cell expressed, developmentally d... [more]
BCAR16.088e-1450.82BCAR1 scaffold protein, Cas family member [Source:... [more]
BCAR16.088e-1450.82BCAR1 scaffold protein, Cas family member [Source:... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p130CAS1.866e-1450.00gene:FBgn0035101 transcript:FBtr0301889[more]
p130CAS2.621e-1450.00gene:FBgn0035101 transcript:FBtr0299864[more]
p130CAS1.630e-928.00gene:FBgn0035101 transcript:FBtr0299865[more]
p130CAS1.646e-928.00gene:FBgn0035101 transcript:FBtr0299866[more]
p130CAS1.646e-928.00gene:FBgn0035101 transcript:FBtr0072475[more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nedd97.239e-1832.81neural precursor cell expressed, developmentally d... [more]
nedd92.008e-1632.80neural precursor cell expressed, developmentally d... [more]
efs3.386e-1641.22embryonal Fyn-associated substrate [Source:ZFIN;Ac... [more]
bcar13.703e-1432.54BCAR1 scaffold protein, Cas family member [Source:... [more]
bcar13.910e-1432.54BCAR1 scaffold protein, Cas family member [Source:... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASS46.275e-1633.33Cas scaffold protein family member 4 [Source:NCBI ... [more]
CASS46.304e-1633.33Cas scaffold protein family member 4 [Source:NCBI ... [more]
bcar16.907e-1452.63BCAR1, Cas family scaffold protein [Source:NCBI ge... [more]
bcar16.914e-1452.63BCAR1, Cas family scaffold protein [Source:NCBI ge... [more]
srebf13.031e-1352.63sterol regulatory element binding transcription fa... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nedd96.040e-2035.17neural precursor cell expressed, developmentally d... [more]
Nedd98.812e-1835.17neural precursor cell expressed, developmentally d... [more]
Nedd99.121e-1835.17neural precursor cell expressed, developmentally d... [more]
Bcar11.402e-1352.63breast cancer anti-estrogen resistance 1 [Source:M... [more]
Bcar11.414e-1352.63breast cancer anti-estrogen resistance 1 [Source:M... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35177|CASL_MOUSE6.380e-1735.17Enhancer of filamentation 1 OS=Mus musculus OX=100... [more]
sp|Q14511|CASL_HUMAN6.411e-1533.10Enhancer of filamentation 1 OS=Homo sapiens OX=960... [more]
sp|P56945|BCAR1_HUMAN4.075e-1352.63Breast cancer anti-estrogen resistance protein 1 O... [more]
sp|Q61140|BCAR1_MOUSE9.806e-1352.63Breast cancer anti-estrogen resistance protein 1 O... [more]
sp|Q63767|BCAR1_RAT1.194e-1252.63Breast cancer anti-estrogen resistance protein 1 O... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GFK04.886e-1824.20Serine_rich domain-containing protein OS=Macrostom... [more]
A0A267E4B04.001e-1729.38Serine_rich domain-containing protein OS=Macrostom... [more]
A0A267GYY61.250e-1629.38SH3 domain-containing protein OS=Macrostomum ligna... [more]
A0A286YCE41.252e-1635.17Enhancer of filamentation 1 (Fragment) OS=Mus musc... [more]
A0A1U8CTA12.128e-1634.48enhancer of filamentation 1-like OS=Mesocricetus a... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nedd91.430e-1637.09neural precursor cell expressed, developmentally d... [more]
nedd91.447e-1638.19neural precursor cell expressed, developmentally d... [more]
efs1.923e-1634.76embryonal Fyn-associated substrate-like [Source:NC... [more]
bcar17.219e-1452.63BCAR1 scaffold protein, Cas family member [Source:... [more]
bcar17.479e-1452.63BCAR1 scaffold protein, Cas family member [Source:... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HSE11.214e-845.28Subunit of the endosomal Vps27p-Hse1p complex; com... [more]
YSC847.043e-639.22Actin-binding protein; involved in bundling of act... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO493343.906e-1551.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452018.468e-641.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bcar12.058e-1542.72BCAR1 scaffold protein, Cas family member [Source:... [more]
cass43.545e-1531.43Cas scaffold protein family member 4 [Source:NCBI ... [more]
cass44.113e-1531.43Cas scaffold protein family member 4 [Source:NCBI ... [more]
bcar15.935e-1544.79BCAR1 scaffold protein, Cas family member [Source:... [more]
bcar16.357e-1544.79BCAR1 scaffold protein, Cas family member [Source:... [more]
back to top
BLAST of Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000028562.10.000e+099.29SMESG000028562.1[more]
SMESG000028562.10.000e+099.29SMESG000028562.1[more]
SMESG000028562.10.000e+095.94SMESG000028562.1[more]
SMESG000028562.10.000e+095.94SMESG000028562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017834 ID=SMED30017834|Name=Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas|organism=Schmidtea mediterranea sexual|type=transcript|length=2211bp
GGCTTGGAAAAATTCGATTCTTATTTCTTCTGTTCTATTTTAATCTTTAT
TCCTTTTCATTGCTAGTTTCGACCAATAGAATTTCGGGAATATTTATCTA
TAAAATAGAATTTCTACGAGAAATATTGATTTATTTTGTTATATATGACA
AATCAAAAACATAATATTATTATTTTGCAACAGAGATTCGCTCGTGCATT
ATTCGATAATATAGCGGAAATGCCACGAGAATTATCCTTTAAAAAAGGAG
ATATTTTGACAGTTCTTCAAGAAACGTATGAAGGAAGCCCTGAGTGGTGG
GTTTGCTCTCTCAGAAGTAAAGTTGGATTGGCACCAGCAAATCGATTAGA
AGCTATGCCTATTTTGATTGAATCCACGCCACAGCTTCAGAAACAAATGT
CAGCTTCTTTGTATGATGAATTACCGGACCCATCGCGATTTTCTAACACC
TATGCTAACTTTCCAGACAGAAGTCAACAGAATTCAAGACCTAAAGATGA
AGATTCGATCTATCAATTTCCAAACGAGGACATATATGTCAATCCATTGA
ATAACGGTTTGATTCAATCTCTACCGTCAACTGATGAACATTCCGTTTAT
CAAATGCCAGTCGAGGATCCTTTGAAAAGTTTTGGTACATATTTCAACGT
TGCAGGATCACCGGGAAATACAACTTATTTTAACATTGGTCCTGAAAACG
AAGCATTTCCTGCTGCTAGTAACAAAATAAACGAGTATTACAACAATCGT
CATGATTATTCAGATTCATTCAGTGATACAACTTCGACGACTTTATCTGA
TACTGTTGGTTCATCTCTGAATAGTTTCAATCAACTTTCATTGAGCAGTT
CGGATTCTGGAGATTTGAGATCTCTTCCGGCATCTGTGTGTGCTCCGTTA
AAAATGACTCCCGAAGAAGCGGTCTCAAAATATAGGCAATATCAGTCAGA
AACAACTGCGTCTTGTAACAAAGTCATAGAATTCGCAAAGGCTAAATGGA
AATCTGAAGAAATGCTTAAAATCACAATCAGATCAATTAAAACAAACTTT
TTAGATTTTTATCAAAATATACAAGTTTTATGTAATTTTTCCATCTGTAT
ATTAGAGAATTCAAAAAATTGTGGAGATATAAATTTAACAAAAAAAATCT
GGAAGCATTTACAACTTCTACAAGAAGCAATTTTAACCACAAAGGATGCG
CTAGAGAAGTTGGACTTGTTAAATTGGAGTCCTGATAAAATTGCTCAGAG
CGTTCGATTGGCAATTAGAGAAGGTGGGGACTGTTTGAGTCATGTCGTTT
CTGCTGCTCGCAACGTTCTGATTCAAGTTAGATCCCTGAGCGTAACAATT
AGTGGCAACGCAAATATTTTATTTCCTGAAATTCCAATAGAAACAAATTT
TATAAGTAACGAATTGTCATTGACTCCATCGCAGAAATCTGACCAATCAA
ACGCCGACAAAGCGAATTTATTGGAGGTCATACGTCTATTCGCCAGTCAA
GTAACATCGCAAACCGAACATGTCGATGAGACCGTCAAAGATTTTATCAA
AATTCTTTCTTCGCAAATTCGTAATTCCATTTCTAAAGAAACCGTTATCA
GCCATTCAAAATTTGTCGTTCGAAGCGCAACTCAATTAGTTTGCACAGCA
AAGAATTTAACGGATGCTCAAAATAAAAATTTCCCTAATCAAAAAATAGA
AGAGGAAGGAAATAATCTCTGTAATTCGTTAAAAATTATGGTTAATGCAA
CAAAAGAACTCGTTCTGAATCCCGAATGTACCAGTGATGAGTTTGAGCCC
CTCGTAGGGCTTTTGAAAAATGTTAACGCTAGCGCTAGAAATCTTCAAAC
GATTGTGGTTGATTCAGTAACGAAAGAGCAGTAAAGATTACTAACTATAG
AAACTTAAAATTTTTACCTGATTATGTAGATATGTAAACATATTTTTTTA
AATTTAAGAAACTGCAATTTTTTGTCACTTAAAACTATTTACTGGTATTT
CTTTTAAGATATACATATATGCAATGATTAAATAACCAACTTTTAAGGCT
ACTTAGTCAACTTCAAAGTCTAATTTGACATTGTATATTGCGTTATTTTA
ATGTATATTTACGCGTGTGTATGTGTGTAAATGTTGCGTTAATAACGCAA
CCAAATGCCTAAAAACGGTTTTGTTTTAATTTGCTTTGAATTTTGATTGA
AAATAGATCGG
back to top

protein sequence of SMED30017834-orf-1

>SMED30017834-orf-1 ID=SMED30017834-orf-1|Name=SMED30017834-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=580bp
MTNQKHNIIILQQRFARALFDNIAEMPRELSFKKGDILTVLQETYEGSPE
WWVCSLRSKVGLAPANRLEAMPILIESTPQLQKQMSASLYDELPDPSRFS
NTYANFPDRSQQNSRPKDEDSIYQFPNEDIYVNPLNNGLIQSLPSTDEHS
VYQMPVEDPLKSFGTYFNVAGSPGNTTYFNIGPENEAFPAASNKINEYYN
NRHDYSDSFSDTTSTTLSDTVGSSLNSFNQLSLSSSDSGDLRSLPASVCA
PLKMTPEEAVSKYRQYQSETTASCNKVIEFAKAKWKSEEMLKITIRSIKT
NFLDFYQNIQVLCNFSICILENSKNCGDINLTKKIWKHLQLLQEAILTTK
DALEKLDLLNWSPDKIAQSVRLAIREGGDCLSHVVSAARNVLIQVRSLSV
TISGNANILFPEIPIETNFISNELSLTPSQKSDQSNADKANLLEVIRLFA
SQVTSQTEHVDETVKDFIKILSSQIRNSISKETVISHSKFVVRSATQLVC
TAKNLTDAQNKNFPNQKIEEEGNNLCNSLKIMVNATKELVLNPECTSDEF
EPLVGLLKNVNASARNLQTIVVDSVTKEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0006810transport
GO:0006886intracellular protein transport
GO:0015031protein transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR038319Serine_rich_sf
IPR037362CAS_fam
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR014928Serine_rich_dom
IPR021901CAS_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005768endosome
GO:0010008endosome membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainSMARTSM00326SH3_2coord: 14..72
e-value: 4.5E-15
score: 66.1
IPR001452SH3 domainPFAMPF00018SH3_1coord: 17..65
e-value: 1.2E-9
score: 37.6
IPR001452SH3 domainPROSITEPS50002SH3coord: 11..73
score: 23.625
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 12..72
e-value: 5.1E-16
score: 60.0
NoneNo IPR availableGENE3DG3DSA:1.20.120.230coord: 443..577
e-value: 3.1E-12
score: 48.2
IPR038319CAS, serine rich four helix bundle domain superfamilyGENE3DG3DSA:1.20.120.830coord: 242..414
e-value: 9.0E-23
score: 82.7
IPR021901CAS family, C-terminalPFAMPF12026CAS_Ccoord: 428..541
e-value: 2.3E-10
score: 40.9
IPR014928Serine rich protein interaction domainPFAMPF08824Serine_richcoord: 256..411
e-value: 2.3E-22
score: 79.7
IPR037362CAS familyPANTHERPTHR10654CAS SCAFFOLDING PROTEINcoord: 14..137
coord: 447..542
coord: 185..417
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 11..86