Polyphosphoinositide phosphatase

Overview
NamePolyphosphoinositide phosphatase
Smed IDSMED30017818
Length (bp)5094
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polyphosphoinositide phosphatase (SMED30017818) t-SNE clustered cells

Violin plots show distribution of expression levels for Polyphosphoinositide phosphatase (SMED30017818) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polyphosphoinositide phosphatase (SMED30017818) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polyphosphoinositide phosphatase (SMED30017818) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017818

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017818SMESG000033307.1 PL08009A2D03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Human
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:HGNC Symbol;Acc:HGNC:16873])

HSP 1 Score: 440.654 bits (1132), Expect = 1.559e-133
Identity = 267/680 (39.26%), Postives = 386/680 (56.76%), Query Frame = 2
Query:   14 IFPNLEFFDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASI-----TSM----TSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY---------SSIKGSNRIIFNSIHDQQLLVND-------------RFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            I  +++   +YE   +  ++G NN  +  ++LK+ R   +D         L II+D ++Y  + + +    +     T M    +SG        G+ GFVRF +GYY++LITK  ++A +G H IYKV++T MIY+P  +                 +  HPDE RYL +F +VDLS + YFSY+YDLS+++QYNL+          S +  + +  F+   D+ L+                ++VWN  L   D+  S    +   +WL+ +IHG+ GQS +L  G+    V V LIARRS  FAGTRF+KRG+N  G+VANEVE+EQI+ +     F     +S VQ+RGS+PL W Q+ +  + KPPI +   DP+  +   HF  +  R G+PIIILNLVK+REK   ER LSE+ + ++ YL      F   +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       T  LQ GI+RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q SINLFLG+F P   K   +W    +D +LH     M+L  T  S   W + E+I  +P P
Sbjct:    8 IISSVQKLVLYETRARYFLVGSNNAETKYRVLKIDRTEPKD---------LVIIDDRHVYTQQEVRELLGRLDLGNRTKMGQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIGGHAIYKVEDTNMIYIPNDSV----------------RVTHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSEMTQNRQESFDIFEDEGLITQGGSGVFGICSEPYMKYVWNGELL--DIIKS----TVHRDWLLYIIHGFCGQSKLLIYGR---PVYVTLIARRSSKFAGTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQADPFAHVAALHFDQMFQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLN----QFLPPEHTIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGCVIPTGRLQTGILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPH-LWELP-TDFYLHHKNT-MRLLPTRRSYTYWWTPEVIKHLPLP 646          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Human
Match: SACM1L (SAC1 like phosphatidylinositide phosphatase [Source:HGNC Symbol;Acc:HGNC:17059])

HSP 1 Score: 172.17 bits (435), Expect = 4.334e-44
Identity = 154/531 (29.00%), Postives = 246/531 (46.33%), Query Frame = 2
Query:  203 TIDQAKASITSMTSGKL----LHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDN-YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            TID+    +T      +    + + + GI G +    G Y+I+ITK  +V +   H ++K              + +D L+ ++        +  D K +LA+ N V L++D  YFS TYDL++T+Q  LS +S +           +  LL   + RFVWN  L      +P   R +      +P++HG++            D I  LI+RRS   AG R+  RG +  G+ AN VE+EQIV  N       SK  S VQ RGSIP+ W Q       KP  +++    + D   RHF   +  +G  +II NL+ Q+     E+PL + F   +          +LG  ++ YI FD  K  KN R + L  ++    E   +  +F  ++  +   + E         G+ R+NC+DCLDRTN  Q ++ + +L  QL  LG+++    + +    +++ +N + ++ N  A QY G+  +    T            D   ++ RYY N FSD  +Q SI+LFLG
Sbjct:   32 TIDRVSTEVTLAVKKDVPPSAVTRPIFGILGTIHLVAGNYLIVITKKIKVGEFFSHVVWK-------------ATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHV-LNVDGFYFSTTYDLTHTLQ-RLSNTSPE---------FQEMSLLERADQRFVWNGHLLRELSAQPEVHRFA------LPVLHGFITMHSCSINGKYFDWI--LISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYN------GSK-ASFVQTRGSIPVFWSQRPNLKY-KPLPQISKVANHMDGFQRHFDSQVIIYGKQVII-NLINQKGS---EKPLEQTFATMVS---------SLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQE---------GVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGFRQDSIDLFLG 500          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Human
Match: SACM1L (SAC1 like phosphatidylinositide phosphatase [Source:HGNC Symbol;Acc:HGNC:17059])

HSP 1 Score: 172.17 bits (435), Expect = 4.334e-44
Identity = 154/531 (29.00%), Postives = 246/531 (46.33%), Query Frame = 2
Query:  203 TIDQAKASITSMTSGKL----LHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDN-YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            TID+    +T      +    + + + GI G +    G Y+I+ITK  +V +   H ++K              + +D L+ ++        +  D K +LA+ N V L++D  YFS TYDL++T+Q  LS +S +           +  LL   + RFVWN  L      +P   R +      +P++HG++            D I  LI+RRS   AG R+  RG +  G+ AN VE+EQIV  N       SK  S VQ RGSIP+ W Q       KP  +++    + D   RHF   +  +G  +II NL+ Q+     E+PL + F   +          +LG  ++ YI FD  K  KN R + L  ++    E   +  +F  ++  +   + E         G+ R+NC+DCLDRTN  Q ++ + +L  QL  LG+++    + +    +++ +N + ++ N  A QY G+  +    T            D   ++ RYY N FSD  +Q SI+LFLG
Sbjct:   32 TIDRVSTEVTLAVKKDVPPSAVTRPIFGILGTIHLVAGNYLIVITKKIKVGEFFSHVVWK-------------ATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHV-LNVDGFYFSTTYDLTHTLQ-RLSNTSPE---------FQEMSLLERADQRFVWNGHLLRELSAQPEVHRFA------LPVLHGFITMHSCSINGKYFDWI--LISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYN------GSK-ASFVQTRGSIPVFWSQRPNLKY-KPLPQISKVANHMDGFQRHFDSQVIIYGKQVII-NLINQKGS---EKPLEQTFATMVS---------SLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQE---------GVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGFRQDSIDLFLG 500          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Human
Match: SACM1L (SAC1 like phosphatidylinositide phosphatase [Source:HGNC Symbol;Acc:HGNC:17059])

HSP 1 Score: 172.555 bits (436), Expect = 4.876e-44
Identity = 154/531 (29.00%), Postives = 246/531 (46.33%), Query Frame = 2
Query:  203 TIDQAKASITSMTSGKL----LHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDN-YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            TID+    +T      +    + + + GI G +    G Y+I+ITK  +V +   H ++K              + +D L+ ++        +  D K +LA+ N V L++D  YFS TYDL++T+Q  LS +S +           +  LL   + RFVWN  L      +P   R +      +P++HG++            D I  LI+RRS   AG R+  RG +  G+ AN VE+EQIV  N       SK  S VQ RGSIP+ W Q       KP  +++    + D   RHF   +  +G  +II NL+ Q+     E+PL + F   +          +LG  ++ YI FD  K  KN R + L  ++    E   +  +F  ++  +   + E         G+ R+NC+DCLDRTN  Q ++ + +L  QL  LG+++    + +    +++ +N + ++ N  A QY G+  +    T            D   ++ RYY N FSD  +Q SI+LFLG
Sbjct:   32 TIDRVSTEVTLAVKKDVPPSAVTRPIFGILGTIHLVAGNYLIVITKKIKVGEFFSHVVWK-------------ATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHV-LNVDGFYFSTTYDLTHTLQ-RLSNTSPE---------FQEMSLLERADQRFVWNGHLLRELSAQPEVHRFA------LPVLHGFITMHSCSINGKYFDWI--LISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYN------GSK-ASFVQTRGSIPVFWSQRPNLKY-KPLPQISKVANHMDGFQRHFDSQVIIYGKQVII-NLINQKGS---EKPLEQTFATMVS---------SLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQE---------GVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGFRQDSIDLFLG 500          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Human
Match: SACM1L (SAC1 like phosphatidylinositide phosphatase [Source:HGNC Symbol;Acc:HGNC:17059])

HSP 1 Score: 156.762 bits (395), Expect = 1.191e-39
Identity = 136/436 (31.19%), Postives = 209/436 (47.94%), Query Frame = 2
Query:  476 DEKRYLALFNSVDLSIDN-YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            D K +LA+ N V L++D  YFS TYDL++T+Q  LS +S +           +  LL   + RFVWN  L      +P   R +      +P++HG++            D I  LI+RRS   AG R+  RG +  G+ AN VE+EQIV  N       SK  S VQ RGSIP+ W Q       KP  +++    + D   RHF   +  +G  +II NL+ Q+     E+PL + F   +          +LG  ++ YI FD  K  KN R + L  ++    E   +  +F  ++  +   + E         G+ R+NC+DCLDRTN  Q ++ + +L  QL  LG+++    + +    +++ +N + ++ N  A QY G+  +    T            D   ++ RYY N FSD  +Q SI+LFLG
Sbjct:   11 DNKTFLAMLNHV-LNVDGFYFSTTYDLTHTLQ-RLSNTSPE---------FQEMSLLERADQRFVWNGHLLRELSAQPEVHRFA------LPVLHGFITMHSCSINGKYFDWI--LISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYN------GSK-ASFVQTRGSIPVFWSQRPNLKY-KPLPQISKVANHMDGFQRHFDSQVIIYGKQVII-NLINQKGS---EKPLEQTFATMVS---------SLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQE---------GVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIRYYKNNFSDGFRQDSIDLFLG 397          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Celegans
Match: C34B7.2 (pep chromosome:WBcel235:I:8336966:8341826:1 gene:WBGene00007912.1 transcript:C34B7.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C34B7.2)

HSP 1 Score: 383.259 bits (983), Expect = 1.498e-113
Identity = 245/638 (38.40%), Postives = 356/638 (55.80%), Query Frame = 2
Query:   41 VYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTS------------GKLLHKKVR--GIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMI--YLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFE--NEGFIFENSKVTSIVQLRGSIPLQWHQE--TTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRN----NVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTL------------QFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSY 1846
            VYE   +  IIG ++  S   +LK+ R          D   L   E EY Y  E I +  A+I+  +S              L+ +     GI G VRF +GYY+I+IT+   VA LG H +YK+ E  MI   + G +TS                    +E++Y+ LF SVDLS D YFSY+YD+S T Q N        S R  +N+   ++L  ++RFVWN  L    L P  K L S   W + ++HGYV Q ++    G + + +  I RRS  +AGTRF+KRG+N  GNVAN VE+EQIV++  + G +  + + +S VQ+RGS+P++W Q+  T   +GKP I +   +P+      HF D+  ++G PI+I+NL+K+ EK   E  L  +F+K+I+YL  +  N    +E L YI+FD+A+  K   +    NVL  M  ++ + I K G+F S  L +      R    TL            Q GI RTNC+DCLDRTN AQFVI + ALG QL A+GI++  N++    + R+L+++++ HG+ +ALQY GS LVH+++TY+KTA F  + RD  Q LSRYY+N F+D +KQM+INLFLG+F+P     + +W+   SD  LH  Y
Sbjct:   10 VYETKSRFYIIGCDSTGSRYNVLKIDR---------IDPKALITGEPEYDYTREEILELLATISDGSSVVYRSSSKKGTKSGLIERATNAFGILGCVRFVEGYYLIIITRAHAVATLGYHPVYKIVEVAMIPIAMDGVSTSS-------------------EEQKYVKLFQSVDLSTDFYFSYSYDMSRTFQEN--------SLRSDWNNHGQRRLEADERFVWNSFL----LEPLRKNLISE-RWFVEIVHGYVRQEYIFLPIGRISLTI--IGRRSTKYAGTRFLKRGANPTGNVANYVETEQIVWDMASSGNV-ADGRFSSFVQMRGSVPMRWSQDPSTRGVVGKPLILIDNHEPHAQTAASHFRDVRNKYGNPIVIMNLIKRNEKRRHEGVLHTQFLKNIEYLNQFLPN----EEKLCYISFDVARCNKAANSMPSINVLNVMEDLSMKSILKNGWFQSFPLSEALKIRPREAFATLDAHHSKDGRFMIQHGICRTNCVDCLDRTNVAQFVIAKVALGCQLCAMGILDEPNLTLQSEVCRLLEDMFDEHGDTMALQYAGSQLVHSIKTYKKTAAFQERRRDVFQTLSRYYSNTFNDWDKQMAINLFLGVFRPRITTMKNLWD-LTSDYNLHFPY 598          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Celegans
Match: sac-1 (SAC1 PIP phosphatase (Yeast Suppressor of ACtin) homolog [Source:UniProtKB/TrEMBL;Acc:Q93641])

HSP 1 Score: 174.866 bits (442), Expect = 2.389e-45
Identity = 158/518 (30.50%), Postives = 250/518 (48.26%), Query Frame = 2
Query:  260 KKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEK--RYLALFNSV---DLSIDN-YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCN-WLIPLIHGYVGQSHV-LAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAK----IQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGII-NNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIF 1774
            K + GI G ++   GY +I+ITK S + Q+  H I+ + + ++I    TT                    H  EK  RY  LF  +    LSI   Y+S T D+S T Q+    +      R + +         ++RF+WN  L       S+ R   G   + +P+IHG++GQ+ V + GK   ++ + +I+RRS + AG RF KRG +++G+ AN VE+EQIV     +   +  +TS VQLRGSIPL W Q+        P     +D       R FS     +G   +I+NLV Q+ +   E+ +  +       L+   R  N+  E + Y  FD  K    +Q +R + + E++    ++ I   G+FY +      P++    T   Q G  RTNC+DCLDRTN  Q ++ + +L  QL  LGI+ +   V  I  L+   + ++ ++G+  + QY G+  +    T      +    +D + A+SRY  N F D  +Q SI+LFLG F
Sbjct:   67 KFIYGILGTIKLVSGYALIVITKASLIGQVNNHNIWTIQDAEIIPYKKTTL-------------------HLTEKQIRYNRLFTDMLTHVLSIGGFYYSTTLDISRTFQWLQENAVPLFKTRSMLDR-------ASERFIWNGHLL------SQIRQVPGAERYTLPVIHGFIGQNRVNVNGK---EIKLTIISRRSIYRAGVRFYKRGVDVDGHAANFVETEQIV----EYTNPDKHLTSFVQLRGSIPLLWTQKPNLRWQPMPTLKPTDDQLAAF-NRAFSWHKQHYGGKHVIVNLVNQKGR---EKKVGGE-------LERISRQANI--EFVRYHQFDFHKECHSMQWHRIDLLREQL----SQEISSFGYFYLS------PNSME--TSRFQRGFFRTNCMDCLDRTNVVQSMLARESLTEQLRMLGILYSEQKVQDIPLLEDAFKQMWADNGDECSRQYAGTGALKADFTRHGRRTYVGAMKDGVNAVSRYVRNNFGDGYRQDSIDLFLGNF 520          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Celegans
Match: W09C5.7 (pep chromosome:WBcel235:I:13654009:13658167:1 gene:WBGene00012353.1 transcript:W09C5.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W09C5.7)

HSP 1 Score: 133.265 bits (334), Expect = 3.388e-31
Identity = 108/378 (28.57%), Postives = 179/378 (47.35%), Query Frame = 2
Query:  650 DRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHV-LAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQI--VFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPP--IEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            D F WN  +        E ++S    +  P++ GYV  S + +  +    + + +I+RRS   AG R+++RG +   NVAN VE+E I  +FE+E          S VQ RGSIP+ W Q   K   +PP  I  + E+ +  +   HF  L   + TP++ ++LV QR +   E PL+++F++               D  + + +FD+ +  +      L+ +I    E +K  GF +         D    + ++ Q G++RTNCIDCLDRTN  Q  I    +  Q   LGI   +       L + +Q ++ ++G+V++ QY G+  +    T     K     +D   + SRYY     D ++Q +IN+  G
Sbjct:  181 DSFFWNKRMVG---NLGEAKISD--KFTCPIMQGYVATSQLEITDQINAYLTITIISRRSTRRAGARYLRRGIDEASNVANFVETELILNIFEHE---------LSFVQCRGSIPVFWSQRGFKY--RPPLIINRSVEETHG-VFTEHFKRLKAHYDTPLVAVSLVDQRGR---ELPLAQRFLEHC---------VKADDNDVTFFSFDLHQHCRGLNFQKLQTLISSMEETLKTIGFCWV--------DKTGEVVQS-QKGVVRTNCIDCLDRTNLVQGQISLFVVLQQAQRLGIFGPL-CEPPEVLVQTMQTMWADNGDVISTQYAGTAALKGDVTRNGERKLMGVMKDGYNSASRYYLTHTKDAQRQKAINIVTG 519          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Celegans
Match: unc-26 (Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5ECL2])

HSP 1 Score: 126.716 bits (317), Expect = 6.192e-30
Identity = 131/427 (30.68%), Postives = 200/427 (46.84%), Query Frame = 2
Query:  518 SIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIH-DQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGC-NWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEM-TFEDPYNDIPG--RHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFD---MAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKI---RPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFL 1765
            S++N  S   DL   +   + Y S   S  +  ++ H D     + RF WN SL       S +R      NWL+  + G V    V  G     V   LI+R S    GTRF  RG+N  GNVAN VE+EQ++  +E       K  S++Q+RGSIPL W Q    ++G   +++  FE     +P   RH S L +R+G    I+NL+ ++E    ER L + F     +   +F        ++ +I+FD     KI K     + +KM P     + K GFFYS           + + K  Q G+IRTNC+DCLDRTN  Q  IG      Q+  L    N+N  K+   + ++ +L++L++ +G+  +  Y G+  +             ++ +D  ++L+R   N   D  KQ S +LFL
Sbjct:  108 SVENVDSRIIDLQRLLSSQMFYFSSLQSYDLTRSAQHRDSHDCSDARFFWNRSL-----HFSFQRYGIDTDNWLLKCMAGSVLVRVVYVGANTGRV--ALISRLSCERVGTRFNVRGANYLGNVANFVETEQLLLFDE-------KECSLLQIRGSIPLFWEQPGV-NVGSHKVKLRAFE---TSLPAYHRHLSQLQHRYG-EFAIVNLLGRKEG---ERVLGDAF--KTQHKSSHFA------PLVDFIDFDYHAQMKISKEAIVQLKKKMSP----HMTKHGFFYSMG---------KEIVKR-QTGVIRTNCLDCLDRTNAVQTAIGLQMSHDQVAFL----NLNAGKVNVEQRVEEILRDLWQKNGDQCSTIYAGTGALDG----------KSKLKDASRSLARTIQNNLMDGAKQESFDLFL 476          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Celegans
Match: unc-26 (Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5ECL2])

HSP 1 Score: 126.716 bits (317), Expect = 6.192e-30
Identity = 131/427 (30.68%), Postives = 200/427 (46.84%), Query Frame = 2
Query:  518 SIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIH-DQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGC-NWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEM-TFEDPYNDIPG--RHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFD---MAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKI---RPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFL 1765
            S++N  S   DL   +   + Y S   S  +  ++ H D     + RF WN SL       S +R      NWL+  + G V    V  G     V   LI+R S    GTRF  RG+N  GNVAN VE+EQ++  +E       K  S++Q+RGSIPL W Q    ++G   +++  FE     +P   RH S L +R+G    I+NL+ ++E    ER L + F     +   +F        ++ +I+FD     KI K     + +KM P     + K GFFYS           + + K  Q G+IRTNC+DCLDRTN  Q  IG      Q+  L    N+N  K+   + ++ +L++L++ +G+  +  Y G+  +             ++ +D  ++L+R   N   D  KQ S +LFL
Sbjct:  108 SVENVDSRIIDLQRLLSSQMFYFSSLQSYDLTRSAQHRDSHDCSDARFFWNRSL-----HFSFQRYGIDTDNWLLKCMAGSVLVRVVYVGANTGRV--ALISRLSCERVGTRFNVRGANYLGNVANFVETEQLLLFDE-------KECSLLQIRGSIPLFWEQPGV-NVGSHKVKLRAFE---TSLPAYHRHLSQLQHRYG-EFAIVNLLGRKEG---ERVLGDAF--KTQHKSSHFA------PLVDFIDFDYHAQMKISKEAIVQLKKKMSP----HMTKHGFFYSMG---------KEIVKR-QTGVIRTNCLDCLDRTNAVQTAIGLQMSHDQVAFL----NLNAGKVNVEQRVEEILRDLWQKNGDQCSTIYAGTGALDG----------KSKLKDASRSLARTIQNNLMDGAKQESFDLFL 476          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Fly
Match: FIG4 (gene:FBgn0031611 transcript:FBtr0077443)

HSP 1 Score: 387.111 bits (993), Expect = 3.607e-115
Identity = 246/659 (37.33%), Postives = 357/659 (54.17%), Query Frame = 2
Query:   41 VYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGS-------------NRIIFNSIHDQQLL-------VNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHV-LAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCK-NETIWNHKNSDVFLHDSYCQMKLDQTSESSAI--WMSCELIAIIPKPLALWNK 1945
            +YE   ++ ++G NN  +  ++L + R              LSI E+   +    I +  AS+    SG        G+ GFVRF +GYY++L+TK    A +G+H +Y + +T M+ +              E   Q P   HP E RY  +F ++DL  + YFSY+YDL+ T+QYN S     G+             N +  N     + +          RFVWN  L    L+P E  +    +WL+ + HG+V QS + + G+    V VCL+ARRS  FAGTRF+KRG+N  G+VANEVE+EQIV + +       ++ +  Q+RGSIP  W Q+ +K + KP I++   DPY   P  HF  L++ +G P+I+LNLVK+RE+   E  +S++   SI YL      F      + +I+FDMA+  +    NV+E++   A   ++ TG F+  A               LQ GI+RTNC+DCLDRTN+AQF IG+ ALG+QL  LG + +  +        ML+NLYE HG+ LALQYGGS LVH ++TYRKTA + +Q  D +Q LSRYY+N FSD EKQ SINLFLGI+KP   K    IW  + +D  +H+++        ++S AI  W+  ++ A +P   A  NK
Sbjct:   22 LYETRARLYLVGSNNRETRFRLLTIDRLAHNR---------LSIEENANEFNSLEIRRFVASL----SGSPKVTSAYGVLGFVRFLEGYYLLLVTKRKCCAHIGRHLVYTIKDTVMVRV-------------NEVTSQRP--PHPHEDRYKRMFQNIDLRSNFYFSYSYDLTRTLQYNESAPRYVGAKVDLDRDEPLPDWNTLTSNVDKAHERVDYAFRSDSRKRFVWNAYL----LQPMEGIMLK--DWLLEVTHGFVSQSCISIFGR---HVNVCLVARRSSRFAGTRFLKRGANFQGDVANEVETEQIVSDGQ-------RICAFTQMRGSIPSHWSQDISKMVPKPQIQLDICDPYAQTPSLHFERLLFHYGAPLIMLNLVKKRERRKHESIISKELEYSIRYLN----QFLPPPHRMKHIHFDMARQSRLSGGNVMEQLAIHAESIVQMTGMFFKAA----------GSEPGLQTGIVRTNCVDCLDRTNSAQFAIGKCALGHQLERLGFVKSAKLEFDSDCVTMLENLYEEHGDTLALQYGGSQLVHRIKTYRKTAPWGSQGSDVMQTLSRYYSNTFSDTEKQHSINLFLGIYKPSLTKQGPPIWELQ-TDYDMHNAFV-----PRADSKAITDWVRHKVRACLPYSCADSNK 616          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Fly
Match: CG7956 (gene:FBgn0038890 transcript:FBtr0084112)

HSP 1 Score: 145.206 bits (365), Expect = 1.687e-34
Identity = 112/417 (26.86%), Postives = 193/417 (46.28%), Query Frame = 2
Query:  530 YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQN----LYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            YFS+  D++N +Q + + S              + Q   ++RF WN  +    +  ++K       W++P+I G++   + + G  C    + L++RRSRH AGTR+ +RG +  GN AN VE+EQI+       F + ++ S  Q+RGS+P+ W Q   K    P ++    +        HF+  +  +G  + I+NLV+Q  K   E+ + + +   +           L ++ L Y+ FD     +  R   +  +I          GF +          ++R +    Q  + R NC+DCLDRTN  Q  IG+  L  QL  LG+          P+   L++    L+ N+G++++ QY G+  +    T     K S   +D + + +RYY  +F D  +Q +I+L LG
Sbjct:  206 YFSFDCDITNNLQRHEAKS-------------EESQSQPDERFFWNKHMIRDLINLNDK------TWILPIIQGFMQVENCVIGNECF--TLALVSRRSRHRAGTRYKRRGVDEKGNCANYVETEQILS------FRHHQL-SFTQVRGSVPIYWSQPGYKYRPPPRLDRGVAETQQAFE-LHFTKELETYGR-VCIVNLVEQSGK---EKTIGDAYADHV---------IKLNNDRLIYVTFDFHDYCRGMRFENVSALIDAVGPEAGAMGFHWR---------DQRGMICN-QKSVFRVNCMDCLDRTNVVQTAIGKAVLESQLVKLGL-----SPPYTPIPEQLKSPFMVLWANNGDIISRQYAGTNALKGDYTRTGERKISGMMKDGMNSANRYYLARFKDSYRQATIDLMLG 565          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Fly
Match: CG7956 (gene:FBgn0038890 transcript:FBtr0334664)

HSP 1 Score: 144.821 bits (364), Expect = 1.953e-34
Identity = 112/417 (26.86%), Postives = 193/417 (46.28%), Query Frame = 2
Query:  530 YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQN----LYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            YFS+  D++N +Q + + S              + Q   ++RF WN  +    +  ++K       W++P+I G++   + + G  C    + L++RRSRH AGTR+ +RG +  GN AN VE+EQI+       F + ++ S  Q+RGS+P+ W Q   K    P ++    +        HF+  +  +G  + I+NLV+Q  K   E+ + + +   +           L ++ L Y+ FD     +  R   +  +I          GF +          ++R +    Q  + R NC+DCLDRTN  Q  IG+  L  QL  LG+          P+   L++    L+ N+G++++ QY G+  +    T     K S   +D + + +RYY  +F D  +Q +I+L LG
Sbjct:  206 YFSFDCDITNNLQRHEAKS-------------EESQSQPDERFFWNKHMIRDLINLNDK------TWILPIIQGFMQVENCVIGNECF--TLALVSRRSRHRAGTRYKRRGVDEKGNCANYVETEQILS------FRHHQL-SFTQVRGSVPIYWSQPGYKYRPPPRLDRGVAETQQAFE-LHFTKELETYGR-VCIVNLVEQSGK---EKTIGDAYADHV---------IKLNNDRLIYVTFDFHDYCRGMRFENVSALIDAVGPEAGAMGFHWR---------DQRGMICN-QKSVFRVNCMDCLDRTNVVQTAIGKAVLESQLVKLGL-----SPPYTPIPEQLKSPFMVLWANNGDIISRQYAGTNALKGDYTRTGERKISGMMKDGMNSANRYYLARFKDSYRQATIDLMLG 565          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Fly
Match: CG7956 (gene:FBgn0038890 transcript:FBtr0301211)

HSP 1 Score: 144.436 bits (363), Expect = 2.733e-34
Identity = 112/417 (26.86%), Postives = 193/417 (46.28%), Query Frame = 2
Query:  530 YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQN----LYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            YFS+  D++N +Q + + S              + Q   ++RF WN  +    +  ++K       W++P+I G++   + + G  C    + L++RRSRH AGTR+ +RG +  GN AN VE+EQI+       F + ++ S  Q+RGS+P+ W Q   K    P ++    +        HF+  +  +G  + I+NLV+Q  K   E+ + + +   +           L ++ L Y+ FD     +  R   +  +I          GF +          ++R +    Q  + R NC+DCLDRTN  Q  IG+  L  QL  LG+          P+   L++    L+ N+G++++ QY G+  +    T     K S   +D + + +RYY  +F D  +Q +I+L LG
Sbjct:  206 YFSFDCDITNNLQRHEAKS-------------EESQSQPDERFFWNKHMIRDLINLNDK------TWILPIIQGFMQVENCVIGNECF--TLALVSRRSRHRAGTRYKRRGVDEKGNCANYVETEQILS------FRHHQL-SFTQVRGSVPIYWSQPGYKYRPPPRLDRGVAETQQAFE-LHFTKELETYGR-VCIVNLVEQSGK---EKTIGDAYADHV---------IKLNNDRLIYVTFDFHDYCRGMRFENVSALIDAVGPEAGAMGFHWR---------DQRGMICN-QKSVFRVNCMDCLDRTNVVQTAIGKAVLESQLVKLGL-----SPPYTPIPEQLKSPFMVLWANNGDIISRQYAGTNALKGDYTRTGERKISGMMKDGMNSANRYYLARFKDSYRQATIDLMLG 565          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Fly
Match: CG7956 (gene:FBgn0038890 transcript:FBtr0301212)

HSP 1 Score: 138.272 bits (347), Expect = 6.897e-33
Identity = 117/460 (25.43%), Postives = 206/460 (44.78%), Query Frame = 2
Query:  407 TTSPWDNLAKEEF--CCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQN----LYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            TT    NLA ++        + +H + +    L    D +   YFS+  D++N +Q + + S              + Q   ++RF WN  +    +  ++K       W++P+I G++   + + G  C    + L++RRSRH AGTR+ +RG +  GN AN VE+EQI+       F + ++ S  Q+RGS+P+ W Q   K    P ++    +        HF+  +  +G  + I+NLV+Q  K   E+ + + +   +           L ++ L Y+ FD     +  R   +  +I          GF +          ++R +    Q  + R NC+DCLDRTN  Q  IG+  L  QL  LG+          P+   L++    L+ N+G++++ QY G+  +    T     K S   +D + + +R++   F+D  +Q  I+L  G
Sbjct:  163 TTQQAANLATKQVKSSVGIREPRHIERRITEELHKIFDETDSFYFSFDCDITNNLQRHEAKS-------------EESQSQPDERFFWNKHMIRDLINLNDK------TWILPIIQGFMQVENCVIGNECF--TLALVSRRSRHRAGTRYKRRGVDEKGNCANYVETEQILS------FRHHQL-SFTQVRGSVPIYWSQPGYKYRPPPRLDRGVAETQQAFE-LHFTKELETYGR-VCIVNLVEQSGK---EKTIGDAYADHV---------IKLNNDRLIYVTFDFHDYCRGMRFENVSALIDAVGPEAGAMGFHWR---------DQRGMICN-QKSVFRVNCMDCLDRTNVVQTAIGKAVLESQLVKLGL-----SPPYTPIPEQLKSPFMVLWANNGDIISRQYAGTNALKGDYTRTGERKISGMMKDGMNSANRFFIQNFADSFRQCIIDLMQG 565          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Zebrafish
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase a [Source:NCBI gene;Acc:100334605])

HSP 1 Score: 194.512 bits (493), Expect = 1.810e-52
Identity = 111/274 (40.51%), Postives = 162/274 (59.12%), Query Frame = 2
Query: 1142 EKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLK-----QFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPL 1930
            EK   E+ LSE+  ++I  L      F   +  + YI +DMA+  K++  NVL+++  IA   +K+TGFF      Y ++L       Q P N      + Q G++RTNC+DCLDRTNTAQF++G+ AL YQL+ALG+I+   +       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFL +F+P   K   +W    +D +LH S   M L     S   W +  ++  +P P 
Sbjct:    1 EKRKHEKILSEELYRAITNLN----QFLPPEHNIEYIAWDMARYTKSKLCNVLDRLSMIAESVVKRTGFFVNRPDFYCHSLRPDERNLQIPWNNNFCCFSSQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYALGMIDKPKLQFDTDCVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLQVFQPSETKPH-LWELP-TDFYLHHSNT-MTLPHHRHSYTHWWTGGVLTYLPLPF 267          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Zebrafish
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase a [Source:NCBI gene;Acc:100334605])

HSP 1 Score: 182.57 bits (462), Expect = 9.918e-49
Identity = 99/234 (42.31%), Postives = 143/234 (61.11%), Query Frame = 2
Query: 1262 MAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLK-----QFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPL 1930
            MA+  K++  NVL+++  IA   +K+TGFF      Y ++L       Q P N      + Q G++RTNC+DCLDRTNTAQF++G+ AL YQL+ALG+I+   +       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFL +F+P   K   +W    +D +LH S   M L     S   W +  ++  +P P 
Sbjct:    1 MARYTKSKLCNVLDRLSMIAESVVKRTGFFVNRPDFYCHSLRPDERNLQIPWNNNFCCFSSQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYALGMIDKPKLQFDTDCVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLQVFQPSETKPH-LWELP-TDFYLHHSNT-MTLPHHRHSYTHWWTGGVLTYLPLPF 231          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Zebrafish
Match: sacm1lb (SAC1 like phosphatidylinositide phosphatase b [Source:NCBI gene;Acc:791142])

HSP 1 Score: 173.326 bits (438), Expect = 1.228e-44
Identity = 160/556 (28.78%), Postives = 252/556 (45.32%), Query Frame = 2
Query:  125 TTEDK--ILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETT-KSIGKPPIEMTFEDPYNDIPG--RHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQS--RDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            TT +K  I  CDD    ++  + +    T+   K    S  +     + + GI G +R   G Y+I+ITK  +V  L  H ++K  +  +I    T     DN             +  D K +L++ NSV  +   YF+  YDL++T+Q  LS +S +     +           + RFVWN  L    +   E        ++ P+IHG++            D    LI+RRS   AG R+  RG +  G+ AN VE+EQI       I  N    S +Q RGSIP  W Q    K   KP I  +     N + G  RHF   I  +G  +I LNLV Q+     E+PL + F K +          +LG+ ++ YI FD  K     R + L+ ++    E   + G+F          D++ S+ +  Q G  R+NC+DCLDRTN  Q ++ + +L  QL  + +++    + +    +++ +N + ++ N  A QY G+  +     + +T K +      D   ++ RYY N FSD  +Q SI+LFLG
Sbjct:   12 TTAEKFYIEACDDGVGDVLAIDRVSTEMTLTVRKDVPPSAVT-----RPICGIMGTIRLVAGVYLIVITKKKKVGDLLGHAVWKASDFDIISYKKTVLHLTDN-------------QMQDNKVFLSMLNSVLNTDGFYFATDYDLTHTLQ-RLSNTSPEFQEMTLLER-------ADQRFVWNGHLLREFMAQPELH-----RFVFPVIHGFIAMRSCCINGKIFDW--NLISRRSCFRAGVRYYVRGIDSEGHAANFVETEQI-------IQYNGAKASFIQTRGSIPFYWSQRPNLKYKPKPQISKSI----NHLDGFQRHFDSQIITYGKQVI-LNLVNQKGS---EKPLEQAFAKMVG---------SLGNGMIKYIAFDFHKECSRMRWHRLQILVDTVAELQDEFGYF--------LVDSDGSV-QMQQDGTFRSNCMDCLDRTNVIQSLLARRSLQSQLERMAVLHVGQRIEEQADFEKIYKNAWADNANACAKQYAGTGALKT--DFTRTGKRTQWGLLMDGWNSMIRYYKNNFSDGFRQDSIDLFLG 499          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Zebrafish
Match: sacm1la (SAC1 like phosphatidylinositide phosphatase a [Source:NCBI gene;Acc:558940])

HSP 1 Score: 161.77 bits (408), Expect = 7.413e-41
Identity = 140/508 (27.56%), Postives = 232/508 (45.67%), Query Frame = 2
Query:  254 LHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            + + + G+ G VR   G Y+I+IT+  +V  L  H ++K  E             +D ++ ++        +  D K +L + N+V  +   YF   YDL++T Q  LS +S             +  LL   + RF+WN +L    +   E        +  P+IHG++            + I+  I+RRS   AG R+  RG +  G+ AN VE+EQIV       F N++  S VQ RGSIP  W Q         P+ ++ +  + D   RHF   +  +G  +I LNLV Q+     E PL + F K +  ++  F         + YI FD  K     R + L+ ++   ++  ++ G+F  ++  K   +         Q G  R+NC+DCLDRTN  Q ++ + +L  QL  +G+++    + +    +++ +N + ++ N  A QY G+  +    T            D   ++ RYY N FSD  +Q SI+LFLG
Sbjct:   52 ITRPICGVMGTVRLVAGMYLIVITRKRKVGDLFGHTVWKAVE-------------FDVISYKKTILHLTDIQMQDNKTFLTMINNVLNTDGFYFCTDYDLTHT-QQRLSNTS---------PDFQEMSLLERADQRFMWNGNLLREIIAQPELH-----KFAFPVIHGFIVMKPCCINGKVFEWII--ISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIV------QFNNAR-ASFVQTRGSIPFFWSQRPNLKYKPKPL-ISKDTNHMDGLRRHFESQVLIYGKQVI-LNLVNQKGS---ELPLEQAFAKMVSSMENGF---------IKYIAFDFHKECSKMRWHRLQILVDAVSDMQEEFGYFMVSSDGKVLSE---------QSGTFRSNCMDCLDRTNVIQSLLARRSLQSQLQRMGVLHVGQKIEEQADFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHWGLVMDGWNSMIRYYKNNFSDGFRQDSIDLFLG 499          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Zebrafish
Match: inpp5f (inositol polyphosphate-5-phosphatase F [Source:NCBI gene;Acc:570007])

HSP 1 Score: 151.754 bits (382), Expect = 2.266e-36
Identity = 150/556 (26.98%), Postives = 244/556 (43.88%), Query Frame = 2
Query:  311 MILITKCSRVAQL-GQHKIYKVDETKMIYLPGTTTSPWDN----LAKEEFCCQFPQ--TKHPDEKRYL----------------------------------ALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPP--DLRPSEKRLSSGCNWLIPLIHGYVGQSHV------------------LAGKGCVDVI-----VCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFED--PYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLD--RMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            +ILI + + V QL G HK+YK+  TK++ +P +   P D       K  F    P+  T+ PDE ++L                                   L+     S   Y+S TYDL+NTVQ       +  S++ ++         V+DRF WN  +     DL+  +        W+IP+I G+V    +                  L    CVD I     V LI+RRSRH AG R+ +RG + +G+VAN VE+EQ+       I  +S   S VQ RGS+P+ W Q   +   +P IE    +  PY      HF   +  +   ++I+NLV Q  +   E+ + + ++K +      + N N     L Y++FD  +  +  +   ++ +     + I    + + +          ++     Q GI R NC+DCLDRTN  Q  I +  +  QL  LG++      +  PL   R+ Q ++ N+G+ ++ QY G+  +    T     K +   +D + + +RYY N+F D  +Q  I+L +G
Sbjct:   65 LILIRQKALVGQLPGDHKVYKI--TKIVVIPLSEDEPQDLELELCKKHHFGINKPERITQSPDETKFLMKTLSQIKSNVGAPIKKKVKENKEKERLERRLLDELYKIFMDSDSFYYSLTYDLTNTVQRQ---GELGKSDQPLWKR-------VDDRFFWNKHMIKDLVDLQAPQVDF-----WVIPIIQGFVQVEELVVNYNESSDEERSSPETPLQEPTCVDDIHPRFTVALISRRSRHRAGMRYKRRGVDTDGHVANYVETEQL-------IHVHSHTLSFVQTRGSVPVFWSQAGYRYNPRPRIEKGERETMPYF---ASHFEKEVETYKK-LVIINLVDQNGR---EKIIGDAYLKQV----LLYNNPN-----LTYVSFDFHEHCRGMKFENVQTLTDAIYDIITDMRWAWVD----------QAGVICQQEGIFRVNCMDCLDRTNVVQAAIARVIMEQQLKKLGVMPP---EQPLPLKCYRIYQVMWANNGDTISRQYAGTAALKGDFTRTGERKLAGVMKDGVNSANRYYLNRFRDAYRQAVIDLMMG 567          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Xenopus
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:100379892])

HSP 1 Score: 238.81 bits (608), Expect = 6.472e-67
Identity = 131/304 (43.09%), Postives = 187/304 (61.51%), Query Frame = 2
Query: 1049 DPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPL 1930
            DP+      HF  ++ R G+PIIILNLVK+REK   ER LSE+ + ++ YL  +       +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       +  LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFLG+F+P   K   +W    +D +LH     M LD    S   W + +++  +P PL
Sbjct:   23 DPFAYAAAIHFDKMLQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLNQFLP----PEHWIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDPYCSVLRPDEKWNELGGVVGQSGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLGVFRPAEGKPH-LWELP-TDFYLHHKNT-MGLDHAKRSYTFWWTPKVLENLPLPL 319          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Xenopus
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:100379892])

HSP 1 Score: 239.195 bits (609), Expect = 1.006e-65
Identity = 132/304 (43.42%), Postives = 187/304 (61.51%), Query Frame = 2
Query: 1049 DPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPL 1930
            DP+      HF  ++ R G+PIIILNLVK+REK   ER LSE+ + ++ YL      F   +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       +  LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFLG+F+P   K   +W    +D +LH     M LD    S   W + +++  +P PL
Sbjct:  166 DPFAYAAAIHFDKMLQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLN----QFLPPEHWIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDPYCSVLRPDEKWNELGGVVGQSGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLGVFRPAEGKPH-LWELP-TDFYLHHKNT-MGLDHAKRSYTFWWTPKVLENLPLPL 462          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Xenopus
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:100379892])

HSP 1 Score: 239.195 bits (609), Expect = 1.124e-65
Identity = 132/304 (43.42%), Postives = 187/304 (61.51%), Query Frame = 2
Query: 1049 DPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPL 1930
            DP+      HF  ++ R G+PIIILNLVK+REK   ER LSE+ + ++ YL      F   +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       +  LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFLG+F+P   K   +W    +D +LH     M LD    S   W + +++  +P PL
Sbjct:  185 DPFAYAAAIHFDKMLQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLN----QFLPPEHWIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDPYCSVLRPDEKWNELGGVVGQSGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLGVFRPAEGKPH-LWELP-TDFYLHHKNT-MGLDHAKRSYTFWWTPKVLENLPLPL 481          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Xenopus
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:100379892])

HSP 1 Score: 239.58 bits (610), Expect = 1.295e-65
Identity = 132/304 (43.42%), Postives = 187/304 (61.51%), Query Frame = 2
Query: 1049 DPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPL 1930
            DP+      HF  ++ R G+PIIILNLVK+REK   ER LSE+ + ++ YL      F   +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       +  LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFLG+F+P   K   +W    +D +LH     M LD    S   W + +++  +P PL
Sbjct:  204 DPFAYAAAIHFDKMLQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLN----QFLPPEHWIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDPYCSVLRPDEKWNELGGVVGQSGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLGVFRPAEGKPH-LWELP-TDFYLHHKNT-MGLDHAKRSYTFWWTPKVLENLPLPL 500          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Xenopus
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:100379892])

HSP 1 Score: 239.195 bits (609), Expect = 2.093e-65
Identity = 132/304 (43.42%), Postives = 187/304 (61.51%), Query Frame = 2
Query: 1049 DPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPL 1930
            DP+      HF  ++ R G+PIIILNLVK+REK   ER LSE+ + ++ YL      F   +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       +  LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFLG+F+P   K   +W    +D +LH     M LD    S   W + +++  +P PL
Sbjct:  185 DPFAYAAAIHFDKMLQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLN----QFLPPEHWIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDPYCSVLRPDEKWNELGGVVGQSGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLGVFRPAEGKPH-LWELP-TDFYLHHKNT-MGLDHAKRSYTFWWTPKVLENLPLPL 481          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Mouse
Match: Fig4 (FIG4 phosphoinositide 5-phosphatase [Source:MGI Symbol;Acc:MGI:2143585])

HSP 1 Score: 432.565 bits (1111), Expect = 9.994e-131
Identity = 261/680 (38.38%), Postives = 384/680 (56.47%), Query Frame = 2
Query:   14 IFPNLEFFDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASI-----TSMT----SGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY---------SSIKGSNRIIFNSIHDQQLLVND-------------RFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            I  +++   +YE   +  ++G N+  +  ++LK+ R   +D         L +I+D ++Y  + + +    +     T M+    SG        G+ GFVRF +GYY++LITK  ++A +G H IYK+++T MIY+P  +                 +  HPDE RYL +F +VDLS + YFSY+YDLS+++QYNL+          S    + +  F+   D+ L+                ++VWN  L    ++ +  R     +WL+ +IHG+ GQS +L  G+    V V LIARRS  FAGTRF+KRG+N  G+VANEVE+EQI+ +     F     +S VQ+RGS+PL W Q+ +  + KPPI +   DP+  +   HF  ++ R G+PIIILNLVK+REK   ER LSE+ + ++ YL      F   +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       T  LQ GI+RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q SINLFLG+F P   K   +W    +D +LH     M L     S   W + E++  +P P
Sbjct:    8 IISSVQKLVLYETRARYFLVGSNHAETKYRVLKIDRTEPKD---------LVVIDDRHVYTQQEVRELLGRLDLGNRTKMSQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIGGHAIYKIEDTSMIYIPNDSV----------------RISHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSETSKACQESFDIFEDEGLITQGGSGVFGISSEPYMKYVWNGELLD-IIKNTVHR-----DWLLYIIHGFCGQSKLLIYGR---PVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLFWSQDISTMMPKPPITLDQADPFAHVAALHFDQMLQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLN----QFLPPEHTIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGHVIPTGRLQTGILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPH-LWELP-TDFYLHHKNT-MSLLPPRRSYTYWWTPEVVKHLPLP 646          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Mouse
Match: Sacm1l (SAC1 suppressor of actin mutations 1-like (yeast) [Source:MGI Symbol;Acc:MGI:1933169])

HSP 1 Score: 168.318 bits (425), Expect = 5.373e-43
Identity = 150/510 (29.41%), Postives = 238/510 (46.67%), Query Frame = 2
Query:  260 KKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDN-YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQS--RDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            + + GI G +    G Y+++ITK  +V +   H +++              + +D L+ ++        +  D K +LA+ N V LS+D  YFS TYDL++T+Q  LS +S +           +  LL   + RFVWN  L      +P   R +      +P++HG++            D I  LI+RRS   AG R+  RG +  G+ AN VE+EQIV  +           S VQ RGSIP+ W Q       KP  +++    + D   RHF   +  +G  +II NLV  +     E+PL + F   +          +LG  ++ YI FD  K  KN R + L  ++    E   +  +F  ++  K           T Q G+ R+NC+DCLDRTN  Q ++ + +L  QL  LG+++    + +    ++  +N + ++ N  A QY G+  +     + +T K +      D   +L RYY N FSD  +Q SI+LFLG
Sbjct:   55 RPIFGILGTIHLVAGNYLVVITKKMKVGECFNHAVWR-------------ATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHV-LSMDGFYFSTTYDLTHTLQ-RLSNTSPE---------FQEMSLLERADQRFVWNGHLLRELSAQPEVHRFA------LPVLHGFITMHSCSINGKYFDWI--LISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYS-------GNRASFVQTRGSIPIFWSQRPNLKY-KPHPQISKVANHMDGFQRHFDSQVIIYGKQVII-NLVNHKGS---EKPLEQTFANMVS---------SLGSGMIRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGK---------VVTNQDGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKTYKNAWADNANACAKQYAGTGALKT--DFTRTGKRTQLGLLMDGFNSLLRYYKNNFSDGFRQDSIDLFLG 500          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Mouse
Match: Sacm1l (SAC1 suppressor of actin mutations 1-like (yeast) [Source:MGI Symbol;Acc:MGI:1933169])

HSP 1 Score: 168.318 bits (425), Expect = 5.373e-43
Identity = 150/510 (29.41%), Postives = 238/510 (46.67%), Query Frame = 2
Query:  260 KKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDN-YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQS--RDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            + + GI G +    G Y+++ITK  +V +   H +++              + +D L+ ++        +  D K +LA+ N V LS+D  YFS TYDL++T+Q  LS +S +           +  LL   + RFVWN  L      +P   R +      +P++HG++            D I  LI+RRS   AG R+  RG +  G+ AN VE+EQIV  +           S VQ RGSIP+ W Q       KP  +++    + D   RHF   +  +G  +II NLV  +     E+PL + F   +          +LG  ++ YI FD  K  KN R + L  ++    E   +  +F  ++  K           T Q G+ R+NC+DCLDRTN  Q ++ + +L  QL  LG+++    + +    ++  +N + ++ N  A QY G+  +     + +T K +      D   +L RYY N FSD  +Q SI+LFLG
Sbjct:   55 RPIFGILGTIHLVAGNYLVVITKKMKVGECFNHAVWR-------------ATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHV-LSMDGFYFSTTYDLTHTLQ-RLSNTSPE---------FQEMSLLERADQRFVWNGHLLRELSAQPEVHRFA------LPVLHGFITMHSCSINGKYFDWI--LISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYS-------GNRASFVQTRGSIPIFWSQRPNLKY-KPHPQISKVANHMDGFQRHFDSQVIIYGKQVII-NLVNHKGS---EKPLEQTFANMVS---------SLGSGMIRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGK---------VVTNQDGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKTYKNAWADNANACAKQYAGTGALKT--DFTRTGKRTQLGLLMDGFNSLLRYYKNNFSDGFRQDSIDLFLG 500          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Mouse
Match: Sacm1l (SAC1 suppressor of actin mutations 1-like (yeast) [Source:MGI Symbol;Acc:MGI:1933169])

HSP 1 Score: 168.318 bits (425), Expect = 8.318e-43
Identity = 150/510 (29.41%), Postives = 238/510 (46.67%), Query Frame = 2
Query:  260 KKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDN-YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQS--RDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            + + GI G +    G Y+++ITK  +V +   H +++              + +D L+ ++        +  D K +LA+ N V LS+D  YFS TYDL++T+Q  LS +S +           +  LL   + RFVWN  L      +P   R +      +P++HG++            D I  LI+RRS   AG R+  RG +  G+ AN VE+EQIV  +           S VQ RGSIP+ W Q       KP  +++    + D   RHF   +  +G  +II NLV  +     E+PL + F   +          +LG  ++ YI FD  K  KN R + L  ++    E   +  +F  ++  K           T Q G+ R+NC+DCLDRTN  Q ++ + +L  QL  LG+++    + +    ++  +N + ++ N  A QY G+  +     + +T K +      D   +L RYY N FSD  +Q SI+LFLG
Sbjct:   55 RPIFGILGTIHLVAGNYLVVITKKMKVGECFNHAVWR-------------ATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHV-LSMDGFYFSTTYDLTHTLQ-RLSNTSPE---------FQEMSLLERADQRFVWNGHLLRELSAQPEVHRFA------LPVLHGFITMHSCSINGKYFDWI--LISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYS-------GNRASFVQTRGSIPIFWSQRPNLKY-KPHPQISKVANHMDGFQRHFDSQVIIYGKQVII-NLVNHKGS---EKPLEQTFANMVS---------SLGSGMIRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGK---------VVTNQDGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHVGQKLEEQDEFEKTYKNAWADNANACAKQYAGTGALKT--DFTRTGKRTQLGLLMDGFNSLLRYYKNNFSDGFRQDSIDLFLG 500          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Mouse
Match: Synj1 (synaptojanin 1 [Source:MGI Symbol;Acc:MGI:1354961])

HSP 1 Score: 140.584 bits (353), Expect = 1.950e-33
Identity = 134/508 (26.38%), Postives = 228/508 (44.88%), Query Frame = 2
Query:  272 GIAGFVRFKQG----YYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHD-QQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCN-WLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMT--FED--PYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFL 1765
            G+ G +R   G    +Y++L+T C  V ++ + ++++V  T+ I L                                     VD S ++  S    + N+  +  ++S+   S  +  N+    Q+   ++RF WN SL         K     C+ WL+ L+ G V    + A         CLI+R S   AGTRF  RG+N +G+VAN VE+EQ+++ ++        V+S +Q+RGS+PL W Q   + +G   + M+  FE   P  D   RHF  L   +G  I++ NL+  +E    E  LS+ F       Q + +      +I H ++FD  ++ K  +   L  ++    +     GFFY +           S  +  Q G +RTNC+DCLDRTN+ Q  +G   L  QL ALG+     +  +     + ++++  +G+ ++  Y G+     +E   K  K     +D  ++++R   N F D  KQ +I++ L
Sbjct:   61 GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISL------------------------------------RVDASDEDRISEVRKVLNSGNFYFAWSASGVSLDLSLNAHRSMQEHTTDNRFFWNQSL-----HLHLKHYGVNCDDWLLRLMCGGVEIRTIYAAHK--QAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVIYLDDC-------VSSFIQIRGSVPLFWEQPGLQ-VGSHRVRMSRGFEANAPAFD---RHFRTLKDLYGKQIVV-NLLGSKEG---EHMLSKAF-------QSHLKASEHASDI-HMVSFDYHQMVKGGKAEKLHSILKPQVQKFLDYGFFYFDG----------SEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQL--VTRFQEVFRSMWSVNGDSISKIYAGT---GALEGKAKAGKL----KDGARSVTRTIQNNFFDSSKQEAIDVLL 483          
BLAST of Polyphosphoinositide phosphatase vs. UniProt/SwissProt
Match: sp|Q92562|FIG4_HUMAN (Polyphosphoinositide phosphatase OS=Homo sapiens OX=9606 GN=FIG4 PE=1 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 7.486e-133
Identity = 267/680 (39.26%), Postives = 386/680 (56.76%), Query Frame = 2
Query:   14 IFPNLEFFDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASI-----TSM----TSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY---------SSIKGSNRIIFNSIHDQQLLVND-------------RFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            I  +++   +YE   +  ++G NN  +  ++LK+ R   +D         L II+D ++Y  + + +    +     T M    +SG        G+ GFVRF +GYY++LITK  ++A +G H IYKV++T MIY+P  +                 +  HPDE RYL +F +VDLS + YFSY+YDLS+++QYNL+          S +  + +  F+   D+ L+                ++VWN  L   D+  S    +   +WL+ +IHG+ GQS +L  G+    V V LIARRS  FAGTRF+KRG+N  G+VANEVE+EQI+ +     F     +S VQ+RGS+PL W Q+ +  + KPPI +   DP+  +   HF  +  R G+PIIILNLVK+REK   ER LSE+ + ++ YL      F   +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       T  LQ GI+RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q SINLFLG+F P   K   +W    +D +LH     M+L  T  S   W + E+I  +P P
Sbjct:    8 IISSVQKLVLYETRARYFLVGSNNAETKYRVLKIDRTEPKD---------LVIIDDRHVYTQQEVRELLGRLDLGNRTKMGQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIGGHAIYKVEDTNMIYIPNDSV----------------RVTHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSEMTQNRQESFDIFEDEGLITQGGSGVFGICSEPYMKYVWNGELL--DIIKS----TVHRDWLLYIIHGFCGQSKLLIYGR---PVYVTLIARRSSKFAGTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPITLDQADPFAHVAALHFDQMFQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLN----QFLPPEHTIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGCVIPTGRLQTGILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPH-LWELP-TDFYLHHKNT-MRLLPTRRSYTYWWTPEVIKHLPLP 646          
BLAST of Polyphosphoinositide phosphatase vs. UniProt/SwissProt
Match: sp|Q91WF7|FIG4_MOUSE (Polyphosphoinositide phosphatase OS=Mus musculus OX=10090 GN=Fig4 PE=1 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 6.991e-130
Identity = 261/680 (38.38%), Postives = 384/680 (56.47%), Query Frame = 2
Query:   14 IFPNLEFFDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASI-----TSMT----SGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY---------SSIKGSNRIIFNSIHDQQLLVND-------------RFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNERS----LTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            I  +++   +YE   +  ++G N+  +  ++LK+ R   +D         L +I+D ++Y  + + +    +     T M+    SG        G+ GFVRF +GYY++LITK  ++A +G H IYK+++T MIY+P  +                 +  HPDE RYL +F +VDLS + YFSY+YDLS+++QYNL+          S    + +  F+   D+ L+                ++VWN  L    ++ +  R     +WL+ +IHG+ GQS +L  G+    V V LIARRS  FAGTRF+KRG+N  G+VANEVE+EQI+ +     F     +S VQ+RGS+PL W Q+ +  + KPPI +   DP+  +   HF  ++ R G+PIIILNLVK+REK   ER LSE+ + ++ YL      F   +  + YI +DMAK  K++  NVL+++  IA   +KKTGFF      Y + L      NE       T  LQ GI+RTNC+DCLDRTNTAQF++G+ AL YQL++LG+I+  N+       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q SINLFLG+F P   K   +W    +D +LH     M L     S   W + E++  +P P
Sbjct:    8 IISSVQKLVLYETRARYFLVGSNHAETKYRVLKIDRTEPKD---------LVVIDDRHVYTQQEVRELLGRLDLGNRTKMSQKGSSGLFRAVSAFGVVGFVRFLEGYYIVLITKRRKMADIGGHAIYKIEDTSMIYIPNDSV----------------RISHPDEARYLRIFQNVDLSSNFYFSYSYDLSHSLQYNLTVLRMPLEMLKSETSKACQESFDIFEDEGLITQGGSGVFGISSEPYMKYVWNGELLD-IIKNTVHR-----DWLLYIIHGFCGQSKLLIYGR---PVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVETEQILCDASVMSFTAGSYSSYVQVRGSVPLFWSQDISTMMPKPPITLDQADPFAHVAALHFDQMLQRFGSPIIILNLVKEREKRKHERILSEELVAAVTYLN----QFLPPEHTIVYIPWDMAKYTKSKLCNVLDRLNVIAESVVKKTGFFVNRPDSYCSILRPDEKWNELGGHVIPTGRLQTGILRTNCVDCLDRTNTAQFMVGKCALAYQLYSLGLIDKPNLQFDTDAVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDSINLFLGVFHPTEGKPH-LWELP-TDFYLHHKNT-MSLLPPRRSYTYWWTPEVVKHLPLP 646          
BLAST of Polyphosphoinositide phosphatase vs. UniProt/SwissProt
Match: sp|Q7Z9H9|FIG4_SCHPO (Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1093.03 PE=3 SV=3)

HSP 1 Score: 349.747 bits (896), Expect = 1.975e-101
Identity = 221/592 (37.33%), Postives = 325/592 (54.90%), Query Frame = 2
Query:   35 FDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKI-LNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKL-LHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPD--EKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHV-LAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVT-------SIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIF 1774
            F++Y+      I+  N   +I +ILK+ +  +ED++ ++ ++    +   +   Y E ++   A       GKL L  K   I G  RF  GYY+ L T+   VA +G H +Y VD+T+ I L                    P  +H    E++ ++    VDL+   YFSY+YDLS T+QY  ++             I   Q  V D FVWNW++    LRP    +     W IPLIHG+V Q+ + + GK    +IV LIARRSRHFAG RF++RG   +G VANEVE+EQIVF+     F  S  T       S VQ RGSIPL+W QE +    KPPI + F DP+      HF  L   +G P I+LNLVK  EK   E  L ++F  +I YL  + ++     + + YI +DM+   K ++  V + +  +A++ +KKTGFF +          +R    T Q G++RTNC+DCLDRTN AQFVIG+  L  QL ALG++++  +       R+L  +Y  HG+ +ALQYGGS+LV+ ++TYRK  ++S+ SRD ++++ R+Y+N F D ++Q +I+LFLG F
Sbjct:   13 FELYQLKKCYYIVSENATATIFRILKITQ--SEDELSISIEEAAKILFRQKLQLYLEKLENESAD------GKLILVTKAYAILGLFRFTAGYYLYLCTERKVVAVIGGHNVYHVDKTQFIELN-------------------PSRRHNTSVERKCMSSIEKVDLARTFYFSYSYDLSQTIQYGFTHP------------IPQHQ--VRDMFVWNWNM----LRPILDSVGIDSPWCIPLIHGFVDQAKLSVYGK---PIIVTLIARRSRHFAGARFLRRGIRDDGYVANEVETEQIVFDGSASSFPISSTTPGIPCYTSYVQHRGSIPLRWSQEFSNITPKPPIGIDFHDPFYASTALHFDRLFGHYGIPCIVLNLVKSSEKVKRESLLLDEFESAIQYLNQFLKD----SQKIQYIAWDMSAASK-KKVPVTKTLEQMASDIVKKTGFFCTA---------DRFFPGTFQTGVVRTNCVDCLDRTNAAQFVIGKCVLAAQLRALGVLDSPQLDYESDAVRLLAEMYHGHGDAIALQYGGSLLVNTLDTYRKNNQWSSTSRDLIESVKRFYSNSFVDFQRQEAISLFLGNF 542          
BLAST of Polyphosphoinositide phosphatase vs. UniProt/SwissProt
Match: sp|P42837|FIG4_YEAST (Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIG4 PE=1 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.796e-100
Identity = 229/620 (36.94%), Postives = 339/620 (54.68%), Query Frame = 2
Query:   35 FDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHKKVRG--IAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNR---IIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHV-LAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFE---------NEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPII-ILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSY 1846
            + +YE   ++ I+G N   ++ +IL++         L      L+++ED   +    I    AS+   T   L HKK+ G  + GF++F   YY+I++TK S+VA +G H IY +D   +I +      P                K  DE R L +F  +DL+   YFSYTYD++NT+Q N+    +K  +R    I   I D     N+ FVWN +L    L P    + +  +W   +IHG++ Q +V + GK    + + LIARRS HFAG RF+KRG N  G+VANEVE+EQIV +           GF F++ + TS VQ RGSIPL W Q+ +    KPPI +   DP+      HF +L  R+G   I ILNL+K +EK   E  L  +F + IDYL  +        + L Y ++DM++  K     V+E +   A   +  TG F++       PD     +  +Q GI R+NCIDCLDRTN AQFVIG+ ALG QL +LGII+N  +     +  +L  L+ + G+ +ALQYGGS LV+ +ETYRK  ++S+ SRD ++++ R+Y+N F D ++Q +INLFLG +  W     ++W   N+D +LH++Y
Sbjct:   33 YTLYETKDRMYIVGSNKRETMFRILEID--------LTVPRGELTVLEDNVFFTRNEIMNVLASLEEATEDGL-HKKITGYGLLGFIKFTCWYYLIMVTKYSQVAVIGGHGIYHIDGIDIIPITNNYKKP---------------EKSSDEARLLNIFKDLDLTKTFYFSYTYDITNTLQTNILREKLKAVDRCDITIPCGITD----YNEMFVWNNNL----LSPIFACIDTVFDWFQCIIHGFIDQVNVSVLGKS---IYITLIARRSHHFAGARFLKRGVNNKGHVANEVETEQIVTDMILTPFHQPGNGF-FDSDRYTSFVQHRGSIPLYWTQDASNLTTKPPIRINVVDPFFSPAALHFDNLFQRYGGGTIQILNLIKTKEKTPRETKLLWEFEQCIDYLNEFLPTL----KKLDYTSWDMSRASKQDGQGVIEFLEKYAVNTVTTTGIFHNG------PD---FASTKIQEGICRSNCIDCLDRTNAAQFVIGKRALGCQLKSLGIIDNSYLEYDSDIVNILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWSSHSRDMIESIKRFYSNSFVDAQRQDAINLFLGHYS-WREGFPSLW-EMNTDFYLHNAY 601          
BLAST of Polyphosphoinositide phosphatase vs. UniProt/SwissProt
Match: sp|Q7XZU3|SAC1_ARATH (Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana OX=3702 GN=SAC1 PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 1.407e-96
Identity = 225/667 (33.73%), Postives = 337/667 (50.52%), Query Frame = 2
Query:   26 LEFFDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETID---QAKASITSMTSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCN---WLIPLIHGYVGQSHV-LAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYS----------------------------------------NALLKQFPDNERSLTKT--------------LQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSA--QSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLH 1837
            LE F +YE   +  ++G + +    ++LK+ R    +         L+I ED  +Y P+ I    Q  A     T G     KV GIAG  +F + YY++L+TK  ++  +  H IY +DE++MI +P  T              Q        E RY  L +SVDL+ D ++SYTY +  ++Q N+  S  +G   + +++I          FVWN  L  P        + S CN   W + L+HG+  Q  + + G+   D  V L++RRSRHFAGTR++KRG N  G VAN+VE+EQ+V ++E    +  K++S+VQ+RGSIPL W QE ++   KP I +   DP  +    HF DL+ R+G PII+LNL+K  EK   E  L  +F  ++ YL   FR  N     L +I++D  K  K++  NVL  +  +A+E +  TG ++S                                        N +L    + E+ +  T               Q G++RTNCIDCLDRTN AQ+  G  ALG QL A+G+ +   +     +   L ++Y++ G+ LA QYGGS   HN     +  K+ A  QSR+FL+++ RYY+N ++D EKQ +INLFLG F+P   K   +W   +SD +LH
Sbjct:   34 LEKFKLYETRARFYLVGSDRNKRFFRVLKIDRSEPSE---------LNISEDPVVYSPQEIKSLLQRIAEGNRATGGLAFVAKVYGIAGCAKFMESYYLVLVTKRRQIGCICGHAIYAIDESQMISVPHAT-------------IQSDVANSKTELRYKKLLSSVDLTKDFFYSYTYPIMQSLQKNVLSSGEEG---MPYDNI----------FVWNSYLTQP--------IRSRCNNTIWTLALVHGHFKQIRLSIYGR---DFSVTLVSRRSRHFAGTRYLKRGVNDRGRVANDVETEQLVLDDEAGSCKG-KMSSVVQMRGSIPLFWSQEASRFSPKPDIFLQRYDPTYESTKMHFEDLVNRYGNPIIVLNLIKTVEKRPREMVLRREFANAVGYLNSIFREENH----LKFIHWDFHKFAKSKSANVLAVLGAVASEALDLTGLYFSGKPKIVKKKASQLSHANTAREPSLRDLRAYSAELSRGESANDILSALANREKEMKLTQQKKDEGTNSSAPRYQSGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHAMGLSDTPKIDPDSSIAAALMDMYQSMGDALAQQYGGSA-AHNTVFPERQGKWKATTQSREFLKSIKRYYSNTYTDGEKQDAINLFLGYFQPQEGK-PALW-ELDSDYYLH 646          
BLAST of Polyphosphoinositide phosphatase vs. TrEMBL
Match: A0A4S2M520 (SAC domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002657 PE=4 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 3.269e-140
Identity = 261/589 (44.31%), Postives = 355/589 (60.27%), Query Frame = 2
Query:  197 PETIDQAKAS-ITSMTSGK--LLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPG---------------------------------TTTSPWDNLAKEEFCCQFPQTKH-----PDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY---SSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTK-SIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYF------------RNFNLGDE----ILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKP 1780
            P  + Q+ AS +TS T+ +   L  K  G+AG +RF +GYY+ILITKC  VAQ+G+HKI+KV++T +IY+PG                                  + SP +  +   F  Q+ Q  +      DE RYL LFNSVDL+ + YFS TYDLS+T+QYNL         GS+    + +   + + NDRFVWNW L PP  RP         +W   L HG V Q+  LA  G   + V LI RRSRHFAG RF+KRGSNL G+VANEVE+EQIV +    +  NS+ +S VQLRGS+PL W QE TK  +G+PPIE+  EDPY +  G HF++L+ RHG+PI++ NL+K+REK  FE  LSE F   + YL  +              +   G E     + YI FD+A++QK++    LE++ P+ + C+K+TG F S+   +     + S     Q G+IR NC+DCLDRTNTAQFVIG+  L +QL+ LG +    +     +D +LQNLY+ HG++LALQYGGS LVHN++TY+KT + ++QSRDF+Q LSRYY NKFSD +KQ + NLFL I++P
Sbjct:  155 PREMQQSVASGLTSGTAERSLFLSTKCHGVAGVIRFLRGYYLILITKCRIVAQIGEHKIFKVEDTSLIYIPGNDLVSDASSSHTASSTARSRTASLISQDDLSNLPSISPCE--SSRRFLQQYNQATNSNRLMADEMRYLKLFNSVDLADNFYFSRTYDLSHTLQYNLKPVFNDQTPGSD----DDVWAVKPMPNDRFVWNWRLIPPRFRPDHSSQDLQPDWFTLLYHGTVSQA-ALAACG-TPLYVTLIGRRSRHFAGPRFLKRGSNLVGDVANEVETEQIVTDTSHALLRNSRCSSYVQLRGSVPLFWSQEPTKLGMGRPPIELLREDPYFEAFGAHFANLLERHGSPIVVFNLMKRREKRKFEHSLSEGFECGLAYLSQFLPSRVPLITSTTASSAQTGTEQANPPILYIAFDIARVQKHKSLVALEELRPVVDSCVKRTGIFLSSPGHRWTESGKSSELSNRQCGLIRVNCVDCLDRTNTAQFVIGRVVLAHQLYMLGFLTEPLIEADSKIDVLLQNLYDEHGDILALQYGGSQLVHNIDTYKKTRRLTSQSRDFVQTLSRYYANKFSDWDKQCATNLFLRIYRP 735          
BLAST of Polyphosphoinositide phosphatase vs. TrEMBL
Match: A0A419QBR8 (Polyphosphoinositide phosphatase OS=Clonorchis sinensis OX=79923 GN=FIG4 PE=4 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 1.575e-138
Identity = 264/592 (44.59%), Postives = 360/592 (60.81%), Query Frame = 2
Query:  197 PETIDQAKAS-ITSMTSGK--LLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPG---------------------------------TTTSPWDNLAKEEFCCQFPQTKHP-----DEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY---SSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRP---SEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTK-SIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYF------------RNFNLGDE----ILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKP 1780
            P  + Q+ AS +TS T+ +   L  K  GIAG +RF +GYY+ILITKC  VAQ+G+HKI+KV++T +IY+PG                                 ++ SP +      F  Q+ Q  +      DE RYL LFNSVDL+ + YFS+TYDLS+T+QYNL         GS     + +   + + NDRFVWNW L PP  RP   S++ L    +W   L HG V Q+  LA  G   + V LI RRSRHFAG RF+KRGSNL G+VANEVE+EQIV +    +  NS+ +S VQLRGS+PL W QE TK  +G+PPIE+  EDPY +  G HF++L+ RHG+PI++ NL+K+REK  FE  LSE F + + YL  +              +   G E     + YI FD+A++QK++    LE++ P+ + C+K+TG F S+   +     + S     Q G+IR NC+DCLDRTNTAQFVIG+  L +QL+ LG +    +     +D +LQNLY+ HG++LALQYGGS LVHN++TY+KT + ++QSRDF+Q LSRYY NKFSD +KQ + NLFL I++P
Sbjct:  155 PREMQQSVASGLTSGTAERSLFLSTKCHGIAGVIRFLRGYYLILITKCRIVAQIGEHKIFKVEDTSLIYIPGNDFISDASSSHTASSTARSRTASLISQEDLSNLSSVSPCE--GSRRFLQQYNQATNSNRLMTDEMRYLKLFNSVDLADNFYFSHTYDLSHTLQYNLKPVFNDQTPGSG----DDVWAVKPMPNDRFVWNWRLIPPRFRPDHSSQEDLQP--DWFTLLYHGTVSQA-ALAACG-TPLYVTLIGRRSRHFAGPRFLKRGSNLVGDVANEVETEQIVTDTSHALLRNSRCSSYVQLRGSVPLFWSQEPTKLGMGRPPIELLREDPYFEAFGAHFANLLERHGSPIVVFNLMKRREKRKFEHSLSEGFERGLAYLSQFLPSRVPLITNMTASSAQTGTEQANPPILYIAFDIARVQKHKYLVALEELRPVVDSCVKRTGIFLSSPGHRWTESGKSSELSNRQCGLIRVNCVDCLDRTNTAQFVIGRVVLAHQLYMLGFLTEPLIEADSKIDVLLQNLYDEHGDILALQYGGSQLVHNIDTYKKTRRLTSQSRDFVQTLSRYYANKFSDWDKQCATNLFLRIYRP 736          
BLAST of Polyphosphoinositide phosphatase vs. TrEMBL
Match: A0A4V3SG91 (SAC domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002657 PE=4 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 1.754e-138
Identity = 261/589 (44.31%), Postives = 355/589 (60.27%), Query Frame = 2
Query:  197 PETIDQAKAS-ITSMTSGK--LLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPG---------------------------------TTTSPWDNLAKEEFCCQFPQTKH-----PDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY---SSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTK-SIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYF------------RNFNLGDE----ILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKP 1780
            P  + Q+ AS +TS T+ +   L  K  G+AG +RF +GYY+ILITKC  VAQ+G+HKI+KV++T +IY+PG                                  + SP +  +   F  Q+ Q  +      DE RYL LFNSVDL+ + YFS TYDLS+T+QYNL         GS+    + +   + + NDRFVWNW L PP  RP         +W   L HG V Q+  LA  G   + V LI RRSRHFAG RF+KRGSNL G+VANEVE+EQIV +    +  NS+ +S VQLRGS+PL W QE TK  +G+PPIE+  EDPY +  G HF++L+ RHG+PI++ NL+K+REK  FE  LSE F   + YL  +              +   G E     + YI FD+A++QK++    LE++ P+ + C+K+TG F S+   +     + S     Q G+IR NC+DCLDRTNTAQFVIG+  L +QL+ LG +    +     +D +LQNLY+ HG++LALQYGGS LVHN++TY+KT + ++QSRDF+Q LSRYY NKFSD +KQ + NLFL I++P
Sbjct:  155 PREMQQSVASGLTSGTAERSLFLSTKCHGVAGVIRFLRGYYLILITKCRIVAQIGEHKIFKVEDTSLIYIPGNDLVSDASSSHTASSTARSRTASLISQDDLSNLPSISPCE--SSRRFLQQYNQATNSNRLMADEMRYLKLFNSVDLADNFYFSRTYDLSHTLQYNLKPVFNDQTPGSD----DDVWAVKPMPNDRFVWNWRLIPPRFRPDHSSQDLQPDWFTLLYHGTVSQA-ALAACG-TPLYVTLIGRRSRHFAGPRFLKRGSNLVGDVANEVETEQIVTDTSHALLRNSRCSSYVQLRGSVPLFWSQEPTKLGMGRPPIELLREDPYFEAFGAHFANLLERHGSPIVVFNLMKRREKRKFEHSLSEGFECGLAYLSQFLPSRVPLITSTTASSAQTGTEQANPPILYIAFDIARVQKHKSLVALEELRPVVDSCVKRTGIFLSSPGHRWTESGKSSELSNRQCGLIRVNCVDCLDRTNTAQFVIGRVVLAHQLYMLGFLTEPLIEADSKIDVLLQNLYDEHGDILALQYGGSQLVHNIDTYKKTRRLTSQSRDFVQTLSRYYANKFSDWDKQCATNLFLRIYRP 735          
BLAST of Polyphosphoinositide phosphatase vs. TrEMBL
Match: A0A0L8GHF2 (SAC domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22033901mg PE=4 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 3.100e-136
Identity = 273/659 (41.43%), Postives = 386/659 (58.57%), Query Frame = 2
Query:   41 VYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIE-DEYIYYPETIDQAKASITSMTSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYS-SIKGSNRIIFNSIHDQQLLVN------------DRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKG--CV---DVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYS------NALLKQFPDNERSLTKT----LQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPL 1930
            +YE   +I ++G NND +  +ILK+ R    D I+  D    +  E    +   E+ ++  +SI    SG    +   GIAGFVRF +GYYMILITK  RVA +G H IYKV++T MIY+P   T                   H DE RY+ +F +VDLS + YFSY+YDL++++QYN++ + S  GS     NS     L V+             +FVWN +L     +P +  + S  +W+I +IHG++GQ ++L      CV    + + LI RRS  FAGTRF+KRG+N  G VANEVE+EQIV +       ++ V+S VQLRGSIPL W Q+ +K + KP I +   DPY  + G+HF+D+I R G PII+LNLVK+REK   E  L+++FI +I+YL      F      + YI FDMA + K +  +V++++  IA  CIK+TGF++       + L    P       KT     Q G++RTNC+DCLDRTNTAQF +G+ ALGYQL+A+G+ ++ N+       RML+ LYE+ GN LALQYGGS LVH ++ YRK A ++  SRD +Q +SRYY+N FSD EKQ SINLFLG++ P N +   +W   ++D +LH+  C  K   + +S   W    +   +P PL
Sbjct:   17 LYETKARIYVVGSNNDETKFRILKIHRNEPRDLIMEDDMKVYTADEVRNTLAMIESGNRPLSSILKGGSGLFKSESAFGIAGFVRFLEGYYMILITKRRRVALIGPHTIYKVEDTCMIYIPNVGT----------------HHIHSDESRYVKMFQNVDLSSNFYFSYSYDLTHSLQYNMAQTNSPSGSKDSSHNSDSYSYLFVDRNCILGVKNVASSKFVWNAALQ----QPCKDMVHS--DWVINIIHGFIGQVNILLFYHYICVFGKPIYLTLIGRRSNQFAGTRFLKRGANNRGAVANEVETEQIVHDASVTFLNSACVSSFVQLRGSIPLFWSQDISKMVPKPQIVVDQADPYAFVAGQHFNDVIKRFGAPIIVLNLVKRREKRRHESILTKEFISAIEYLN----QFLAYSHNIQYIGFDMAGVSKKKDCSVMDRLGKIAKSCIKRTGFYFHSPSNVHDELWMSEPLKGIRGVKTEYGKKQTGVVRTNCVDCLDRTNTAQFAVGKCALGYQLYAMGVNSSPNLEYDTDCVRMLEKLYEDQGNTLALQYGGSQLVHRIKGYRKIATWTYNSRDLVQTISRYYSNAFSDAEKQQSINLFLGVYSP-NSRTPNLW-ELSTDYYLHNPDCFGKKLLSRKSYCQWWDPNVPYHLPLPL 647          
BLAST of Polyphosphoinositide phosphatase vs. TrEMBL
Match: A0A0X3PEL9 (Polyphosphoinositide phosphatase (Fragment) OS=Schistocephalus solidus OX=70667 GN=FIG4 PE=4 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 5.667e-136
Identity = 249/570 (43.68%), Postives = 356/570 (62.46%), Query Frame = 2
Query:  221 ASITSMTSGKLLHKKVR-GIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAK------EEFC-CQFPQTKH------------PDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNL-------SYSSIKGSNRII----FNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTK-SIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILH-------YINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQF-PDNERSLTKTL----------QFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKP 1780
            ASI  +++  L+      G+ GFVRF  GYY+I+IT+   VA++G+H+IYK+++TKMIY+PG    P+ +L K       E C    P                 +E RYL LF+S+DL+ + YFSY+YDL+N++Q NL       ++  + G N         S+   +LL NDRF WN+ L PP L   E++ +S  NW + L+HG++ Q+ V A  G + + + L+ARRSR FAGTRF+KRG NL G+VANEVE+EQIV +        ++ +S  QLRGS+PL W QETTK  +GKPP+E+ +EDP+ +  G HF++LI R G PII+LNL+KQ+EK  FE+ L+E + + IDYL  +    +   +  H       YI FDMA++QK+    VL+++ PIA  C+++TG F+S      F P  + S  +T           Q G+IR NC+DCLDRTN  Q+VIG   L +QL ALG++    ++    L R+LQ+LYE HG+ LALQYGGS LVHN+ETY++T K  +QSRD +Q LSRYY+N FSD EKQ++ ++FL +++P
Sbjct:   34 ASIRPLSTSSLVQSLTGFGLVGFVRFLFGYYLIVITQRREVARIGEHRIYKIEDTKMIYVPG---EPFVSLKKLLERSSAERCKASLPAWAQDSVGNSKLSRLVAEEMRYLKLFHSIDLNGNFYFSYSYDLTNSLQRNLEPFSEARNHPQLTGDNATATQCDLPSVLAFRLLPNDRFTWNFGLLPPRLCSPERQYTS--NWFVRLVHGFLKQA-VFACCG-MPITITLLARRSRFFAGTRFLKRGVNLTGDVANEVETEQIVADLSNSTLARARASSFTQLRGSVPLFWSQETTKLVVGKPPLEINWEDPFYEAFGLHFANLIERFGAPIIVLNLMKQKEKRRFEQQLTEGYCRGIDYLNLFAPILSSQPDRRHDEIPPIVYIGFDMARMQKSPNLLVLDRLRPIAEACVQRTGIFFSTGAESTFDPGLQSSTDRTRIFVGSDLWPRQHGVIRVNCVDCLDRTNAGQYVIGHVVLAHQLRALGLLPETGLTFSSALSRLLQDLYEEHGDTLALQYGGSCLVHNIETYQRTGKLRSQSRDLMQTLSRYYSNNFSDFEKQLATDIFLRVYRP 596          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Cavefish
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:103033692])

HSP 1 Score: 400.979 bits (1029), Expect = 4.673e-120
Identity = 247/671 (36.81%), Postives = 373/671 (55.59%), Query Frame = 2
Query:   41 VYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHK---------KVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRII------------FNSIHDQQLLVN----------DRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLK--QFPDNER--------SLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            +YE   +  ++G NN  +  ++LK+ R    D         L II+D+++Y  + + +    +      K+  K            GI GFVRF +G+Y+ILITK  ++A +G H IYK+++T MIY+P  +                 +  HPDE RY+ +F +VDLS + YFSY+YDLS+++Q+N++   +  S   +            F+   D+ L              ++VWN  L        + + +   +WL+ +IHG+ GQS +L  G+    V V LIARRS  FAGTRF+KRG+N  G+VANEVE+EQI+ +           +S VQ+RGS+PL W Q+ +  + KPPI +   DPY  +   HF  ++ R G+PIIILNLVK+REK   E+ LSE+   ++  L      F   +  + YI +DMA+  K++  NVL+++  IA   +K+TGF+ + A         +ER        +    LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL+ALG+ +   +       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFL +++P   K   +W    +D +LH S   M L Q   S   W S  +++ +P P
Sbjct:   16 LYETRARYFLVGSNNAQTKHRVLKIDRTEPRD---------LVIIDDKHVYSQKEVRELLGRLDLGNRTKIGQKGSSGLSRAVSAFGIVGFVRFLEGHYIILITKRRKMADIGGHSIYKIEDTNMIYIPNDSV----------------RVPHPDEARYVRMFQNVDLSSNFYFSYSYDLSHSLQHNVTLLKVPYSPGEVDKLHNSSSKLESFDIFEDEGLPTQVVYGLRNKPYAKYVWNSRLL------EKIQDTVHPDWLMYIIHGFCGQSKLLIYGR---PVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVETEQIIHDASVMSLTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPIRLDQADPYAHVAALHFDQMLQRFGSPIIILNLVKKREKRKHEKILSEELYPAVTNLN----QFLPPEHCIEYIAWDMARYTKSKLCNVLDRLGLIAENVVKRTGFYINRADFHCHTLRPDERWGDLGGLVTAHGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYALGLTDKPKLQFDTDCVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLQVYQPVESKPH-LWELP-TDFYLHHSNT-MALPQERRSYTYWWSEGVLSHLPVP 645          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Cavefish
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:103033692])

HSP 1 Score: 400.979 bits (1029), Expect = 1.380e-119
Identity = 247/671 (36.81%), Postives = 373/671 (55.59%), Query Frame = 2
Query:   41 VYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHK---------KVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRII------------FNSIHDQQLLVN----------DRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLK--QFPDNER--------SLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            +YE   +  ++G NN  +  ++LK+ R    D         L II+D+++Y  + + +    +      K+  K            GI GFVRF +G+Y+ILITK  ++A +G H IYK+++T MIY+P  +                 +  HPDE RY+ +F +VDLS + YFSY+YDLS+++Q+N++   +  S   +            F+   D+ L              ++VWN  L        + + +   +WL+ +IHG+ GQS +L  G+    V V LIARRS  FAGTRF+KRG+N  G+VANEVE+EQI+ +           +S VQ+RGS+PL W Q+ +  + KPPI +   DPY  +   HF  ++ R G+PIIILNLVK+REK   E+ LSE+   ++  L      F   +  + YI +DMA+  K++  NVL+++  IA   +K+TGF+ + A         +ER        +    LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL+ALG+ +   +       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFL +++P   K   +W    +D +LH S   M L Q   S   W S  +++ +P P
Sbjct:   16 LYETRARYFLVGSNNAQTKHRVLKIDRTEPRD---------LVIIDDKHVYSQKEVRELLGRLDLGNRTKIGQKGSSGLSRAVSAFGIVGFVRFLEGHYIILITKRRKMADIGGHSIYKIEDTNMIYIPNDSV----------------RVPHPDEARYVRMFQNVDLSSNFYFSYSYDLSHSLQHNVTLLKVPYSPGEVDKLHNSSSKLESFDIFEDEGLPTQVVYGLRNKPYAKYVWNSRLL------EKIQDTVHPDWLMYIIHGFCGQSKLLIYGR---PVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVETEQIIHDASVMSLTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPIRLDQADPYAHVAALHFDQMLQRFGSPIIILNLVKKREKRKHEKILSEELYPAVTNLN----QFLPPEHCIEYIAWDMARYTKSKLCNVLDRLGLIAENVVKRTGFYINRADFHCHTLRPDERWGDLGGLVTAHGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYALGLTDKPKLQFDTDCVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLQVYQPVESKPH-LWELP-TDFYLHHSNT-MALPQERRSYTYWWSEGVLSHLPVP 645          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Cavefish
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:103033692])

HSP 1 Score: 400.979 bits (1029), Expect = 1.380e-119
Identity = 247/671 (36.81%), Postives = 373/671 (55.59%), Query Frame = 2
Query:   41 VYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHK---------KVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRII------------FNSIHDQQLLVN----------DRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLK--QFPDNER--------SLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            +YE   +  ++G NN  +  ++LK+ R    D         L II+D+++Y  + + +    +      K+  K            GI GFVRF +G+Y+ILITK  ++A +G H IYK+++T MIY+P  +                 +  HPDE RY+ +F +VDLS + YFSY+YDLS+++Q+N++   +  S   +            F+   D+ L              ++VWN  L        + + +   +WL+ +IHG+ GQS +L  G+    V V LIARRS  FAGTRF+KRG+N  G+VANEVE+EQI+ +           +S VQ+RGS+PL W Q+ +  + KPPI +   DPY  +   HF  ++ R G+PIIILNLVK+REK   E+ LSE+   ++  L      F   +  + YI +DMA+  K++  NVL+++  IA   +K+TGF+ + A         +ER        +    LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL+ALG+ +   +       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFL +++P   K   +W    +D +LH S   M L Q   S   W S  +++ +P P
Sbjct:   16 LYETRARYFLVGSNNAQTKHRVLKIDRTEPRD---------LVIIDDKHVYSQKEVRELLGRLDLGNRTKIGQKGSSGLSRAVSAFGIVGFVRFLEGHYIILITKRRKMADIGGHSIYKIEDTNMIYIPNDSV----------------RVPHPDEARYVRMFQNVDLSSNFYFSYSYDLSHSLQHNVTLLKVPYSPGEVDKLHNSSSKLESFDIFEDEGLPTQVVYGLRNKPYAKYVWNSRLL------EKIQDTVHPDWLMYIIHGFCGQSKLLIYGR---PVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVETEQIIHDASVMSLTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPIRLDQADPYAHVAALHFDQMLQRFGSPIIILNLVKKREKRKHEKILSEELYPAVTNLN----QFLPPEHCIEYIAWDMARYTKSKLCNVLDRLGLIAENVVKRTGFYINRADFHCHTLRPDERWGDLGGLVTAHGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYALGLTDKPKLQFDTDCVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLQVYQPVESKPH-LWELP-TDFYLHHSNT-MALPQERRSYTYWWSEGVLSHLPVP 645          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Cavefish
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:103033692])

HSP 1 Score: 399.053 bits (1024), Expect = 3.998e-119
Identity = 247/677 (36.48%), Postives = 373/677 (55.10%), Query Frame = 2
Query:   41 VYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHK---------KVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRII------------FNSIHDQQLLVND----------------RFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLK--QFPDNER--------SLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            +YE   +  ++G NN  +  ++LK+ R    D         L II+D+++Y  + + +    +      K+  K            GI GFVRF +G+Y+ILITK  ++A +G H IYK+++T MIY+P  +                 +  HPDE RY+ +F +VDLS + YFSY+YDLS+++Q+N++   +  S   +            F+   D+ L                    ++VWN  L        + + +   +WL+ +IHG+ GQS +L  G+    V V LIARRS  FAGTRF+KRG+N  G+VANEVE+EQI+ +           +S VQ+RGS+PL W Q+ +  + KPPI +   DPY  +   HF  ++ R G+PIIILNLVK+REK   E+ LSE+   ++  L      F   +  + YI +DMA+  K++  NVL+++  IA   +K+TGF+ + A         +ER        +    LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL+ALG+ +   +       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFL +++P   K   +W    +D +LH S   M L Q   S   W S  +++ +P P
Sbjct:   16 LYETRARYFLVGSNNAQTKHRVLKIDRTEPRD---------LVIIDDKHVYSQKEVRELLGRLDLGNRTKIGQKGSSGLSRAVSAFGIVGFVRFLEGHYIILITKRRKMADIGGHSIYKIEDTNMIYIPNDSV----------------RVPHPDEARYVRMFQNVDLSSNFYFSYSYDLSHSLQHNVTLLKVPYSPGEVDKLHNSSSKLESFDIFEDEGLPTQGLYMSALVYGLRNKPYAKYVWNSRLL------EKIQDTVHPDWLMYIIHGFCGQSKLLIYGR---PVYVTLIARRSSRFAGTRFLKRGANCEGDVANEVETEQIIHDASVMSLTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPIRLDQADPYAHVAALHFDQMLQRFGSPIIILNLVKKREKRKHEKILSEELYPAVTNLN----QFLPPEHCIEYIAWDMARYTKSKLCNVLDRLGLIAENVVKRTGFYINRADFHCHTLRPDERWGDLGGLVTAHGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYALGLTDKPKLQFDTDCVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLQVYQPVESKPH-LWELP-TDFYLHHSNT-MALPQERRSYTYWWSEGVLSHLPVP 651          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Cavefish
Match: sacm1lb (phosphatidylinositide phosphatase SAC1-A [Source:NCBI gene;Acc:111190068])

HSP 1 Score: 173.326 bits (438), Expect = 9.936e-45
Identity = 148/509 (29.08%), Postives = 235/509 (46.17%), Query Frame = 2
Query:  260 KKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWN-WSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQS--RDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            + + G+ G +R   G Y+I+ITK  +V  L  H ++K  E  +I    T     DN             +  D K +L + N+V  +   YF+  YDL++T+Q  L+ +S +           +  LL   + RFVWN + L     +P   R +       P++HGY+            D  +  I+RRS   AG R+  RG +  G+ AN VE+EQIV  N       S   S VQ RGSIP  W Q       KP  +++    + D   RHF   I  +G  +I LNL+ Q+     E+PL   F K ++         NLG+ +L Y+ FD  K     R + L+ ++    +  ++ G+F  +A             +  Q G  R+NC+DCLDRTN  Q ++ + +L  QL  +G+++    +      +++ +N + ++ N  A QY G+  +     + +T K +      D   ++ RYY N FSD  +Q SI+LFLG
Sbjct:   54 RSICGVMGTIRLVAGMYLIVITKKRKVGDLLGHVVWKAVEFDVISYKKTVLHLTDN-------------QMQDNKAFLGMINNVLHTDGFYFATDYDLTHTLQ-RLANTSPE---------FQEMSLLERADQRFVWNGYLLRDFSTQPELHRFAC------PVVHGYITMKSCCINGKVFDWNI--ISRRSCFRAGVRYYVRGIDTEGHAANFVETEQIVQYN-------SAKASFVQTRGSIPFYWSQRPNLKY-KPKPQISKSSNHLDGFQRHFDSQIITYGKQVI-LNLINQKGS---EKPLELAFAKMVE---------NLGNGMLKYVAFDFHKECSRMRWHRLQILVDTVADLQEEFGYFLVDA---------DGSVQVQQEGTFRSNCMDCLDRTNVVQSLLARRSLQSQLQRMGVLHVGQRIEDQADFEKIYKNSWADNANACAKQYAGTGALKT--DFTRTGKRTQWGLLMDGWNSMIRYYKNNFSDGFRQDSIDLFLG 499          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Sea Lamprey
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:HGNC Symbol;Acc:HGNC:16873])

HSP 1 Score: 263.077 bits (671), Expect = 1.383e-77
Identity = 160/409 (39.12%), Postives = 224/409 (54.77%), Query Frame = 2
Query:  272 GIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQL------------------------------------LVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSH-VLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQR-EKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNAL 1366
            GI GFVRF +GYYM+LITK  +VA +G H IYK+++T M Y+P  +                 +  HPDE RY+ +F +VDLS + YFSY+Y+L++++QYNL+   + G+ R    S    Q                                     L + +FVWN  L  P       + S   +W++ + HG+  QS  V+ G+    V + LIARRS  FAGTRF+KRG+N  G+VANEVE+EQIV +     F + + +S VQLRGS+PL W Q+ +  I KPPI +   DPY  + G HF  ++ R G+PI+ILNLVK+R EK   E  LSE+ + ++    GY   F   +  +HYI +DMAK  K +  NVL+K+  IA   ++KTGFF      Y NAL
Sbjct:   45 GIVGFVRFLEGYYMVLITKRRKVADIGGHSIYKIEDTVMTYIPHESV----------------RVSHPDEARYVKIFQNVDLSSNFYFSYSYNLTHSLQYNLT---MMGTARDTTPSTSTAQASVLPLSHRAPPSSFDIFEEEGSAPHHSHGTGGVTHSLSHGKFVWNSFLLEP------FQGSVHPDWVLHITHGFCAQSKLVVYGR---PVYITLIARRSARFAGTRFLKRGANSEGDVANEVETEQIVQDASVMTFAHGRFSSYVQLRGSVPLHWSQDISSMIPKPPITLDQADPYMLVAGLHFDQMLQRFGSPIVILNLVKKRHEKRRHESLLSEELLAAV----GYLNLFLPPEHHIHYIAWDMAKYSKRKHVNVLDKLSDIAEGVLRKTGFFMNKRSYYCNAL 421          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Sea Lamprey
Match: synj1 (synaptojanin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9180])

HSP 1 Score: 121.709 bits (304), Expect = 7.477e-28
Identity = 130/497 (26.16%), Postives = 224/497 (45.07%), Query Frame = 2
Query:  308 YMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY-SSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCN-WLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPG--RHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQK--NRRNNVLE-----KMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFL 1765
            Y++L+T C+ V ++   ++ ++   +M+ L G    P D            + +  D +R L+           YFS +  + NT  Y+LS  + ++G                ++ F WN +L  P      ++    C  WL+ ++ G VG   + A        VC++AR S   AGTRF  RG++ +G VAN  E+EQI+F ++       +VTS VQLRGS+PL W Q   + +G   ++M+     N  P   RHF+ L   +G  +++ NL+  +E    E  LS+ F       Q + +      +I   +NFD   + K  ++R+  L+     K+ P   +C    GF+  +            +   +Q G +RTNC+DCLDRTN+ Q       L  QL  LG+     +  +   D + + L+   G++++  Y G+  +              + +D  ++++R   N F D  KQ +++L L
Sbjct:   80 YLVLVTGCASVGRIVDSEVMRITSVEMVSLQG---DPSD------------EDRVADLRRLLSTGTF-------YFSSSGGVGNT--YDLSIRAQLQGQG----------DPAQHNPFCWNAALHVP-----LRQCGVDCGAWLLRIMCGGVGVRTLYAAHQ--QAKVCVLARVSCARAGTRFNVRGADDSGQVANFCETEQIIFIDD-------EVTSFVQLRGSVPLFWEQPGLQ-VGSHRVKMSRGYEAN-APALDRHFAMLKELYGKQMVV-NLLGSKEG---EHMLSKAF-------QSHMQASRHASDI-PMLNFDYHLLLKGSSQRSERLQSGLGNKVRPFLEQC----GFYCFH----------EGVVSRVQKGTVRTNCLDCLDRTNSVQTHFAVDMLKRQLEDLGLAEKPQM--VARFDEVFRALWSAVGDLVSKMYAGTGALEG----------KTKLKDGARSVTRTIQNNFFDGAKQEAMDLLL 488          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Sea Lamprey
Match: inpp5f (inositol polyphosphate-5-phosphatase F [Source:NCBI gene;Acc:570007])

HSP 1 Score: 77.7962 bits (190), Expect = 8.100e-15
Identity = 40/121 (33.06%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 1409 LQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGI 1771
            +Q G+ R NC+DCLDRTN  Q  I +  +  QL  LG +   +   I+   R+ Q ++ NHG+ ++ QY G+  +    T     +F+   +D   + +RYY N+F D  +Q +I+L  G+
Sbjct:   35 VQQGVFRVNCMDCLDRTNVVQAAIARIVMESQLKKLGAMPPEHQLPIK-CRRIYQVMWANHGDTVSRQYAGTAALKGDFTRTGERRFAGVMKDGYNSANRYYLNQFRDAYRQAAIDLMQGL 154          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009281.1 (pep scaffold:Pmarinus_7.0:GL484989:833:10188:-1 gene:ENSPMAG00000008392.1 transcript:ENSPMAT00000009281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 4.645e-8
Identity = 53/205 (25.85%), Postives = 87/205 (42.44%), Query Frame = 2
Query:  254 LHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRG 862
            L + +  I G +R   G Y+I++TK  +  ++    I+K  E             +D L+ ++        +  D K  L +   V  +   +FS T+DL++++Q  L+ +S            H+  L    + RFVWN  L    L   E        + +PLIHG +     +      D I  LI+RRS + AG R+  RG
Sbjct:   53 LTQHICCIVGTIRLVAGMYLIVVTKKEKQGEISGQAIWKAVE-------------FDILSYQKTILHLTDLQAQDNKTLLMMLRGVLHTESFFFSCTFDLTHSLQ-RLANTS---------PDFHEMSLCERADQRFVWNGHLLRELLTVPELH-----RFAVPLIHGCILSYACVINGKVFDWI--LISRRSCYRAGVRYYLRG 227          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Yeast
Match: FIG4 (Phosphatidylinositol 3,5-bisphosphate (PtdIns[3,5]P) phosphatase; required for efficient mating and response to osmotic shock; physically associates with and regulated by Vac14p; contains a SAC1-like domain; homologous to human FIG4, which is associated with CMT4J, a form of Charcot-Marie-Tooth disorder [Source:SGD;Acc:S000005269])

HSP 1 Score: 348.206 bits (892), Expect = 2.586e-102
Identity = 229/620 (36.94%), Postives = 339/620 (54.68%), Query Frame = 2
Query:   35 FDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHKKVRG--IAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNR---IIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHV-LAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFE---------NEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPII-ILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSY 1846
            + +YE   ++ I+G N   ++ +IL++         L      L+++ED   +    I    AS+   T   L HKK+ G  + GF++F   YY+I++TK S+VA +G H IY +D   +I +      P                K  DE R L +F  +DL+   YFSYTYD++NT+Q N+    +K  +R    I   I D     N+ FVWN +L    L P    + +  +W   +IHG++ Q +V + GK    + + LIARRS HFAG RF+KRG N  G+VANEVE+EQIV +           GF F++ + TS VQ RGSIPL W Q+ +    KPPI +   DP+      HF +L  R+G   I ILNL+K +EK   E  L  +F + IDYL  +        + L Y ++DM++  K     V+E +   A   +  TG F++       PD     +  +Q GI R+NCIDCLDRTN AQFVIG+ ALG QL +LGII+N  +     +  +L  L+ + G+ +ALQYGGS LV+ +ETYRK  ++S+ SRD ++++ R+Y+N F D ++Q +INLFLG +  W     ++W   N+D +LH++Y
Sbjct:   33 YTLYETKDRMYIVGSNKRETMFRILEID--------LTVPRGELTVLEDNVFFTRNEIMNVLASLEEATEDGL-HKKITGYGLLGFIKFTCWYYLIMVTKYSQVAVIGGHGIYHIDGIDIIPITNNYKKP---------------EKSSDEARLLNIFKDLDLTKTFYFSYTYDITNTLQTNILREKLKAVDRCDITIPCGITD----YNEMFVWNNNL----LSPIFACIDTVFDWFQCIIHGFIDQVNVSVLGKS---IYITLIARRSHHFAGARFLKRGVNNKGHVANEVETEQIVTDMILTPFHQPGNGF-FDSDRYTSFVQHRGSIPLYWTQDASNLTTKPPIRINVVDPFFSPAALHFDNLFQRYGGGTIQILNLIKTKEKTPRETKLLWEFEQCIDYLNEFLPTL----KKLDYTSWDMSRASKQDGQGVIEFLEKYAVNTVTTTGIFHNG------PD---FASTKIQEGICRSNCIDCLDRTNAAQFVIGKRALGCQLKSLGIIDNSYLEYDSDIVNILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWSSHSRDMIESIKRFYSNSFVDAQRQDAINLFLGHYS-WREGFPSLW-EMNTDFYLHNAY 601          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Yeast
Match: SAC1 (Phosphatidylinositol phosphate (PtdInsP) phosphatase; involved in hydrolysis of PtdIns[4]P in the early and medial Golgi; regulated by interaction with Vps74p; ER localized transmembrane protein which cycles through the Golgi; involved in protein trafficking and processing, secretion, and cell wall maintenance; regulates sphingolipid biosynthesis through the modulation of PtdIns(4)P metabolism [Source:SGD;Acc:S000001695])

HSP 1 Score: 146.362 bits (368), Expect = 1.648e-36
Identity = 138/517 (26.69%), Postives = 226/517 (43.71%), Query Frame = 2
Query:  263 KVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDN---YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDM----AKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLT-KTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINV-SKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFS--AQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKP 1780
            K+  + GF++ K   Y I+        +   H  Y+V +  ++                    +F      +E  Y+ L   ++L + N   YFSYTYDL+N++Q N                        ++RF WN  L   DLR    +     +++ P+I+GY     V A      +++ LI RRS   AGTR+ +RG + +GNV N  E+EQI+   E    E   V S +Q RGS+P+ W  E      KP   +   +   D   +HF      +G   ++ NLV Q+     E P+ E +   +  L          D  +HY+ FD      K+Q +R        + +  + ++K G    +   K    N  ++     Q  ++RTNC+DCLDRTN  Q V+ Q  L  +  +  ++   +      PL    QNL+ ++ + +++ Y G+  +     + +T K +      DFL + SRYY N ++D  +Q S +LFLG F+P
Sbjct:   54 KIASLMGFIKLKLNRYAIIANTVEETGRFNGHVFYRVLQHSIV------------------STKFNSRIDSEEAEYIKL---LELHLKNSTFYFSYTYDLTNSLQRNEKVGPAASWK------------TADERFFWNHYL-TEDLRNFAHQDPRIDSFIQPVIYGYA--KTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLA-ENPESEKIHVFSFLQTRGSVPIYW-AEINNLKYKP--NLVLGENSLDATKKHFDQQKELYGDNYLV-NLVNQK---GHELPVKEGYESVVHALN---------DPKIHYVYFDFHHECRKMQWHR--------VKLLIDHLEKLGLSNEDFFHKVIDSNGNTVEIVNEQHSVVRTNCMDCLDRTNVVQSVLAQWVLQKEFESADVVATGSTWEDNAPLLTSYQNLWADNADAVSVAYSGTGALKT--DFTRTGKRTRLGAFNDFLNSASRYYQNNWTDGPRQDSYDLFLGGFRP 507          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Yeast
Match: INP53 (Polyphosphatidylinositol phosphatase; dephosphorylates multiple phosphatidylinositol phosphates; involved in trans Golgi network-to-early endosome pathway; hyperosmotic stress causes translocation to actin patches; contains Sac1 and 5-ptase domains; INP53 has a paralog, INP52, that arose from the whole genome duplication [Source:SGD;Acc:S000005635])

HSP 1 Score: 109.383 bits (272), Expect = 2.794e-24
Identity = 128/523 (24.47%), Postives = 235/523 (44.93%), Query Frame = 2
Query:  248 KLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQL--GQ--HKIYKVD-------ETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKG-SNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMT--FE--DPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            +L   ++ G+ G +      ++  IT  S+VAQ   G+  +KI+ VD           I +  +        A  E+    P  KHP  +    L N        Y+S  +DL++T+Q+       +G     +    ++++ + N   +     +   L  + K++     +L  +I G+         K  + V + +I+++S   AGTRF  RG +   NVAN VE+E I++ ++          +  Q+RGSIP+ W Q T  S+  P +++T  FE   P  D   +H    + ++G P+ ++NL+  +     E  LS+++ + + + +    NFN   + +    FD  K       + + K+IP+  + +  +G++  +   K+          + Q GI RTNC+DCLDRTN AQ +I   A    L    +I++ +             L+ +HG+ ++  Y G+  + +  + +     +    D  +++SR Y N F D EKQ +I+  LG
Sbjct:   54 RLTSHEIFGVIGLIEVNGLLFVGAITGKSKVAQPCPGETVNKIFAVDFFCLNDNSWDFIEIDSSGYPVLPETASTEYQDALP--KHPCYELKKLLSNG-----SFYYSSDFDLTSTLQH-------RGYGQHSLSTDTYEEEYMWNSFLMQEMITYRDHLDTNLKQILDDEGFLTTVIRGFAETFVSYVKK--LKVALTIISKQSWKRAGTRFNARGVDDEANVANFVETEFIMYSSQ-------YCYAFTQIRGSIPVFWEQGT--SLINPRVQITRSFEATQPVFD---KHIMKSVEKYG-PVHVVNLLSTKSS---EIELSKRYKEHLTHSKKL--NFN---KDIFLTEFDFHKETSQEGFSGVRKLIPLILDSLLSSGYYSYDVREKK--------NISEQHGIFRTNCLDCLDRTNLAQQIISLAAFRTFLEDFRLISSNSFIDDDDFVSKHNTLWADHGDQISQIYTGTNALKSSFSRKGKMSLAGALSDATKSVSRIYINNFMDKEKQQNIDTLLG 531          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Yeast
Match: INP52 (Polyphosphatidylinositol phosphatase; dephosphorylates a number of phosphatidylinositol phosphates (PtdInsPs, PIPs) to PI; involved in endocytosis; hyperosmotic stress causes translocation to actin patches; synaptojanin-like protein with a Sac1 domain; INP52 has a paralog, INP53, that arose from the whole genome duplication [Source:SGD;Acc:S000005050])

HSP 1 Score: 99.7525 bits (247), Expect = 2.286e-21
Identity = 106/424 (25.00%), Postives = 190/424 (44.81%), Query Frame = 2
Query:  530 YFSYTYDLSNTVQ------YNLSYSSIKGSNRIIFNS-IHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMT----FEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            Y+S  +DL+ T+Q      ++LS+         ++NS + D+ +   DR           L  + K L     +L  +I G+     + +    + V + +I+R+S   AGTRF  RG + +G+VAN VE+E I++ ++          +  Q+RGS+P+ W Q+T  S+  P I++T       P  D    HF  L  ++G P+ I+NL+  +   + E  LS ++ + +   +       +G ++    +FD  +           ++IP     I   G+F          D +     + Q G+ RTNC+DCLDRTN  Q  I        L    ++   +        + +  L+ ++G+ ++  Y G+  + +  + +    FS    D  +++SR Y N F D  KQ +I+  LG
Sbjct:  177 YYSTDFDLTCTLQKRGFTEHSLSFDDF--DREFMWNSFLMDEIITYRDR-----------LDVTAKELLDQRGFLTTVIRGFA--ETIFSYINRLKVGLTIISRQSWKRAGTRFNARGIDDDGHVANFVETEMIMYSSQ-------YCYAFTQIRGSLPIFWEQDT--SLISPKIQITRSVEATQPTFD---EHFIRLFKKYG-PVHIINLLSTK---SSEIQLSRRYKEQLKNSE----KMKIGRDVF-LTSFDFHRETSQDGFAAASRIIPKIRNTILDAGYFSY--------DVKEGRLISEQDGVFRTNCLDCLDRTNLIQQTISLAVFKLFLEDFRLVKPSSFIDDNEFVQKVNALWADNGDQISQIYTGTNALKSSYSRKGKMSFSGALSDATKSVSRMYINNFVDKGKQQNIDTLLG 556          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Yeast
Match: INP51 (Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; synaptojanin-like protein with an N-terminal Sac1 domain, plays a role in phosphatidylinositol 4,5-bisphosphate homeostasis and in endocytosis; null mutation confers cold-tolerant growth [Source:SGD;Acc:S000001264])

HSP 1 Score: 54.299 bits (129), Expect = 1.559e-7
Identity = 59/228 (25.88%), Postives = 101/228 (44.30%), Query Frame = 2
Query:  530 YFSYTYDLSNTVQ-----YNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSL------WPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFED-PYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEK 1177
            Y+S  +D+SN V+     +NL Y+            + +Q L     F+WN +L      W   +   EK+L +   +L  +I GY   + +  G     + +  I+R S           G + +G V+  VE+E IV   E FIF      S  Q+ GSIPL W    ++ +    I++T +         RHF +L  ++G  + I+N++K + +   +  L+ K
Sbjct:  161 YYSRDFDISNIVKNHGLSHNLEYT------------VDNQDL----SFIWNANLASEVINWRSKISNEEKQLFANAGFLTFVIRGYCKTALIEDGPNTASITI--ISRISTESKQDTLELEGISEDGRVSLFVETE-IVVTTEKFIF------SYTQVNGSIPLFWESVESQLLYGKKIKVTKDSIEAQGAFDRHFDNLTSKYGV-VSIVNIIKPKSESQEKLALTYK 362          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Nematostella
Match: EDO36706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY2])

HSP 1 Score: 148.288 bits (373), Expect = 7.481e-37
Identity = 140/505 (27.72%), Postives = 242/505 (47.92%), Query Frame = 2
Query:  272 GIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETT-KSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKF---IKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGII-NNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            GI G +    G Y+I+ITK   V  +   +++KV +T +I  P  T                 +++    K YL++  SV  +   YFS TYDL++T+Q  LS +S +     ++         V+ RFVWN  L  P  ++P  +R      +++P++HG++  +     +   D I  LI+RRS   AG R+  RG +  GN AN VE+EQI+  N G        +S VQ+RGSIPL W Q    K   KP +  + +   + +  ++  D    H   ++++NL+ Q+     E+ L ++F   I++  Y +  +  F+   E         +K++ +R N +++++ P      KK G+F          D +    ++ Q G+ RTNCID LDRTN  Q ++ + +L  QL   G++     +      +   +N++ ++ +  ++QY G+  +    T R+   F A  RD + ++   + + F     Q SI+LFLG
Sbjct:   61 GIMGIIHLLAGPYLIVITKKKLVGYIQGSEVWKVLQTNVIPFPRAT-------------LHLTESQQYHNKLYLSMVQSVLQTESFYFSCTYDLTHTLQ-RLSRTSPEFLQMPLYER-------VDPRFVWNSHLLTPFAVQPELQR------FILPVMHGFISITSCSIKQRSFDFI--LISRRSCFRAGVRYFMRGLDGEGNAANYVETEQIIQFNTG-------TSSFVQIRGSIPLYWTQRPNLKYKPKPQVNSSAD---HSLGFQYHIDNEIAHYKELVLINLIDQKGP---EKVLGDRFSTIIRNSPYKETSYEAFDFHKEC--------SKMRWDRLNLLIDRLSPDQ----KKFGYFSMGK------DKD---IQSEQKGVFRTNCIDSLDRTNVVQSMLARNSLQLQLEEYGVLATGERIVDHNDFEYTFKNVWADNADACSVQYAGTGALKTDFT-RQEVLFGAM-RDGVNSIVTCFIHIF--FSMQDSIDLFLG 498          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Nematostella
Match: EDO26203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCL6])

HSP 1 Score: 122.479 bits (306), Expect = 1.277e-31
Identity = 69/160 (43.12%), Postives = 96/160 (60.00%), Query Frame = 2
Query:  797 VIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQE--TTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAK 1270
            + V LIARRS  FAGTRF+KRG+N  G VANEVE+EQIV +     F + + TS VQ+RGS+P  W Q     K +      +   DPY +   +H + L+ R G P++ILNLVK+REK   E+ LSE+   +++YL      F   +  + YI +DMA+
Sbjct:   25 IYVTLIARRSARFAGTRFLKRGTNEEGFVANEVETEQIVHDASVLSFHSGRFTSYVQIRGSVPTFWSQIPFIIKLLSPSSFAVDRADPYCNAAAQHVNRLLGRFGAPLVILNLVKRREKKRHEQILSEELQTAVEYLN----QFLPPEHNIQYIPWDMAR 180          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Nematostella
Match: EDO43250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZB6])

HSP 1 Score: 124.02 bits (310), Expect = 2.538e-28
Identity = 148/578 (25.61%), Postives = 245/578 (42.39%), Query Frame = 2
Query:  266 VRGIAGFVRFKQG--YYMILITKCSRVAQL-GQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQ----------------------------------------TKHPDEKR-----------YLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQL----LVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVG---------------QSHVLAGK-GCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGR-HFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALG--IINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            V G+ G ++F  G  + +++ITK + +    G H++Y+VD  ++ YLP    SP D    E   C+  Q                                        TK P ++             L +FN  D     Y+S T D++NT+Q                   +D  L     V+ RF WN  +   DL  +E  L+S  +W++P+I GY                 QS +  G     +  + LI+RRS   AGTR+ +RG + +G VAN VE+EQIV      +       S VQ+RGS+P+ W Q   K   +PP  +  ++       R HFS  +  +G  ++++NLV Q  +   E+ +S+ F++ I               +L YI FD  +  +  +   +  ++    + IK   + +++   K     +RS        + R NC+DCLDRTN  Q  + +  L  QL  LG  + +    + IR      + ++ N+G+ ++ QY G+  +    T     KF+   +D   + +RYY N+F    +Q  I++ LG
Sbjct:   48 VYGVIGKIQFFPGGDWKLLVITKRTLLGLFPGNHEVYRVD--RVAYLP---LSPGDVPELELDPCEKHQSGGRGIKRDTEGQQKSFQQTWKSIKTAATNIKENVKSTSTTKEPKDRERDKLERRLVEELLKMFNDSD---SFYYSPTGDITNTLQRQC-------------GDHYDHSLPLWKRVDKRFFWNSHMLH-DLINNEDPLAS--SWILPVIQGYCSIVHCHNMFEEDDMEEQSDIQIGALPPEEFDLLLISRRSIFRAGTRYKRRGVDDDGEVANYVETEQIVRTEIHSV-------SFVQVRGSVPVFWSQPGYKY--RPPPRLDKDEMDTQAAFRHHFSHQLSLYGG-VVVVNLVDQTGR---EKIISDVFMRHI---------LAYNCPLLTYITFDFHEYCRGMKFENVSVLVDSIGDVIKDMRYCWTDP--KGIICEQRS--------VFRVNCMDCLDRTNVVQAALARHLLEMQLRKLGKLMPDQTLPASIRA---PFKEMWANNGDAISRQYAGTAALKGDFTRTGERKFTGLMKDGYNSANRYYLNRFKAAYRQTLIDMMLG 566          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Nematostella
Match: EDO33968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQQ5])

HSP 1 Score: 109.768 bits (273), Expect = 7.101e-24
Identity = 123/491 (25.05%), Postives = 212/491 (43.18%), Query Frame = 2
Query:  305 YYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCN-WLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMT--FEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQRE-KHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFL 1765
            +++IL+T C  V ++   +I+K+  T+ +        P      EE   +            + L NS        F +     +  + +LS S+     R   +S        ++RF+WN SL         +R    C+ WL  ++ G V    V AG        CLI+R S   AGTRF  RG++ +G+VAN VE+EQ++  ++        +TS VQ RGS+P+ W Q   + +G   ++++  FE        RH +     +G  + I+NL+  +E ++A  R   ++  +SI    G+             I FD  +  K  R + L+     A +       F+S               +  Q G++R+NC+DC+DRTN  Q  IG   L  QL  LG+      S +        +++  +G+ ++  Y G+  +         A+ +++ RD  +++ R   + F D  KQ +I+L L
Sbjct:   76 HFLILVTGCKSVGKVLDSEIFKITSTQFV--------PLQVDQDEEGIAEI-----------VKLLNS------GTFYFATGHGSQPELDLSLSA---QQRYDGHS-------PDNRFMWNRSL-----HFHVQRFGINCSEWLFSIMCGGVEIRTVYAG--VSQAKACLISRLSCERAGTRFYVRGTDDDGHVANFVETEQMIALDD-------MITSFVQTRGSVPVFWEQPGIQ-VGSHKVKLSRGFEAASAAF-DRHLTTQKGLYGD-VCIVNLLGMKEGENALSRIFQDELTESI---HGHDTPM---------ICFDYHRNCKGGRTSKLKDFADKARQLFNSNSLFFSKG----------GKLEKRQKGVMRSNCLDCIDRTNNMQTFIGLEMLLVQLQCLGL--GSKASLVPRFQEAFTSMWSQNGDHISRIYIGTGALDG------KARVASKLRDGARSVKRTIRSNFLDGSKQEAIDLLL 484          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Nematostella
Match: EDO48074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK06])

HSP 1 Score: 92.4337 bits (228), Expect = 3.919e-22
Identity = 49/105 (46.67%), Postives = 65/105 (61.90%), Query Frame = 2
Query:  824 SRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKP-PIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVK 1135
            S  FAGTRF+KRG+N  G VANEVE+EQIV +     F + + TS VQ+RGS+P  W Q   K +  P    +   DPY +   +H + L+ R G P++ILNLVK
Sbjct:    1 SARFAGTRFLKRGTNEEGFVANEVETEQIVHDASVLSFHSGRFTSYVQIRGSVPTFWSQ--VKGLLSPSSFAVDRADPYCNAAAQHVNRLLGRFGAPLVILNLVK 103          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Medaka
Match: FIG4 (FIG4 phosphoinositide 5-phosphatase [Source:NCBI gene;Acc:101159238])

HSP 1 Score: 396.356 bits (1017), Expect = 3.968e-118
Identity = 251/678 (37.02%), Postives = 378/678 (55.75%), Query Frame = 2
Query:   41 VYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNCDDWFLSIIEDEYIYYPETIDQAKASITSMTSGKL-------LHKKVR--GIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSY------------SSIKG-----SNRIIFNSIHDQQLLVND---------RFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLA-GKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF------YSNALLKQFPDNE-------RSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKP 1927
            +YE   +  ++G N   +  ++LK+ R   +D         L II+D+++Y  + + +  + +      K+       L K V   GI GFVRF +GYY++LITK   +A +G H IYK+++T MIY+P  +                 +  HPDE RY+ +F +VDLS + YFSY+YDLS+++Q NL+             SS +      S +  F+   ++ L             ++VWN  L          + +   +WL+ +IHG+ GQS +L  G+    V + LIARRS  FAGTRF+KRG+N  G+VANEVE+EQIV +     F     +S VQ+RGS+PL W Q+ +  + KPPI +   DPY  + G HF  ++ R G+PIIILNLVK+REK   E+ LSE    ++  L      F   +  + YI +DMA+  K++  NVL+++  IA   +K+TGFF      Y + L    PD+         + +  LQ G++RTNC+DCLDRTNTAQF++G+ AL YQL+ALG+I+   +       R+ + LYE+HG+ L+LQYGGS LVH V+TYRK A ++  S+D +Q LSRYY+N FSD ++Q +INLFL +++P   K   +W    +D +LH     + L     S  +W +  +++ +P P
Sbjct:   16 LYETRARYFLVGSNQAETKHRVLKIDRTEPKD---------LVIIDDKHVYNQQEVRELLSRLDLGNRTKMGQKGSSGLSKSVMAFGIVGFVRFLEGYYIVLITKRRVMADIGGHYIYKIEDTTMIYIPNDSV----------------RVTHPDEARYVRIFQNVDLSSNFYFSYSYDLSHSLQCNLTLLQRPYEQWLSEASSAEDKVHTQSKQDSFDIFEEEGLPTQGEQGSITPYYKYVWNGKLL------ERVKDTVHPDWLMYIIHGFCGQSKLLIYGR---PVHITLIARRSSRFAGTRFLKRGANCEGDVANEVETEQIVHDASVTSFTAGSYSSYVQVRGSVPLYWSQDISTMMPKPPIRLDQADPYAHVAGLHFDQMLQRFGSPIIILNLVKKREKRKHEKILSEDLYPAVVNLN----QFLPPEHCIEYIAWDMARYTKSKLCNVLDRLNMIAENVVKRTGFFINRSDFYCHTLR---PDDRWRDVGGYMTSSGRLQTGVLRTNCVDCLDRTNTAQFMVGKCALAYQLYALGMIDKPKLQFDTDCVRLFEELYEDHGDTLSLQYGGSQLVHRVKTYRKIAPWTQHSKDIMQTLSRYYSNAFSDADRQDAINLFLQVYQPSEGKAH-LWELP-TDFYLHQK-STLILPHDRRSYTMWWTQGILSYLPVP 649          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Medaka
Match: sacm1la (phosphatidylinositide phosphatase SAC1-B [Source:NCBI gene;Acc:101170855])

HSP 1 Score: 172.555 bits (436), Expect = 1.640e-44
Identity = 143/511 (27.98%), Postives = 243/511 (47.55%), Query Frame = 2
Query:  260 KKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPP-DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQS--RDFLQALSRYYNNKFSDHEKQMSINLFLGIF 1774
            + + GI G +R   G Y+I+IT+  +V ++  H ++KV +             +D ++ ++      +T+  + K +LA+ N++  +   YF   +DL++T+Q   + S              +  LL   + RFVWN +L      +P   R +      +P++HG++            + I  LI+RRS   AG R+  RG +  G+ AN VE+EQIV      ++E +K  S VQ RGS+P  W Q         PI ++    + D   RHF   +  +G   + LNLV Q+     E+PL E F K +           +   +++YI FD  K   + R + L+ ++    E  ++  +F  N+  K+          T Q G+ R+NC+DCLDRTN  Q ++ + +L  QL  +GI+N    + +    ++  +N + ++ N  A+QY G+  +     + +T K +      D   ++ RYY N FSD  +Q SI+LFLG F
Sbjct:   54 RPIFGIMGTIRLVAGMYLIVITRKKKVGEILGHAVWKVVD-------------FDVISYKKSVLHLSETQSQENKTFLAMINNILTTDGFYFCTDFDLTHTLQRLANTSP----------DFQEMSLLERADQRFVWNGNLLRELAGQPELHRFA------LPVVHGFIILKPCRINGKIFEWI--LISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIV------LYEGAKA-SFVQTRGSMPFYWSQRPNLKYKPKPI-ISKTSNHMDGFQRHFDSQLLIYGKQTV-LNLVNQKGS---EKPLEEAFAKMVA---------GMSSGLINYIAFDFHKECSHMRWDRLQILVDTVAETQEEYSYFMVNSDGKEL---------THQSGVFRSNCMDCLDRTNVIQSLLARRSLQSQLQRMGILNVGQRIEEQAEFEKTYKNAWADNANACAVQYAGTGALKT--DFTRTGKRTKWGLLMDGWNSMIRYYKNNFSDGFRQDSIDLFLGNF 501          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Medaka
Match: sacm1lb (phosphatidylinositide phosphatase SAC1-A [Source:NCBI gene;Acc:101167819])

HSP 1 Score: 163.696 bits (413), Expect = 1.576e-41
Identity = 147/509 (28.88%), Postives = 239/509 (46.95%), Query Frame = 2
Query:  272 GIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVG-QSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNF--NLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQS--RDFLQALSRYYNNKFSDHEKQMSINLFLGIF 1774
            GI G +    G Y+++IT   +V  L  H ++K     +I    T     DN             +  D K +L++ N V  +   YF+ TYDL++T+Q   + S              D  LL   + RFVWN  L    +   E        +++P+IHG++  +S  + GK        +I+RRS   AG R+  RG +++G+ AN VE+EQIV       +  SK  S VQ RGSIP  W Q       KP  +++    + D   RHF   +  +G  ++ LNL+ Q   +  E+PL           +  FRN   +LG  ++ Y+ FD  K     R + L+ ++ +  E  ++ GFF  ++      D +  L+   Q G  R+NC+DCLDRTN  Q ++ + +L  QL  +G+++    + +    ++  +N + ++ +  A QY G+  +     + +T K +      D   ++ RYY N FSD  +Q SI+LFLG F
Sbjct:   58 GIMGTIHLVAGMYLVVITDKVKVGDLLGHAVWKAVGFDVISYKKTILHLNDN-------------QMQDNKTFLSMINGVLHTDAFYFATTYDLTHTLQRLANTSP----------DFQDTSLLERADQRFVWNGHLLREFMSQPELH-----KFVVPVIHGFISIKSSCINGK---KFEWSIISRRSCFRAGVRYYVRGIDVDGHAANFVETEQIV------QYGGSK-ASFVQTRGSIPFFWSQRPNLKY-KPKPQISKAGNHLDGLQRHFDSQVLLYGRQVV-LNLINQ---NGSEKPL-----------ELAFRNLVTSLGTGMVRYVAFDFHKECSRMRWHRLQILLDMVAEAQEELGFFLVDS------DGKVLLS---QDGTFRSNCMDCLDRTNVIQSLLARNSLQAQLQRMGVLHLGQKLEEQLDFEKTFKNAWADNADACAKQYAGTGALKT--DFTRTGKRTQLGLLMDGWNSMIRYYKNNFSDGFRQDSIDLFLGNF 501          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Medaka
Match: sacm1lb (phosphatidylinositide phosphatase SAC1-A [Source:NCBI gene;Acc:101167819])

HSP 1 Score: 147.132 bits (370), Expect = 2.940e-36
Identity = 145/508 (28.54%), Postives = 231/508 (45.47%), Query Frame = 2
Query:  272 GIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLL--VNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNF--NLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIIN-NINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQS--RDFLQALSRYYNNKFSDHEKQMSINLFLGIF 1774
            GI G +    G Y+++IT   +V  L  H ++K     +I    T     DN             +  D K +L++ N V  +   YF+ TYDL++T+Q   + S              D  LL   + RFVWN  L    +   E         + P I   V +S  + GK        +I+RRS   AG R+  RG +++G+ AN VE+EQIV       +  SK  S VQ RGSIP  W Q       KP  +++    + D   RHF   +  +G  ++ LNL+ Q   +  E+PL           +  FRN   +LG  ++ Y+ FD  K     R + L+ ++ +  E   +  FF  ++      D +  L+   Q G  R+NC+DCLDRTN  Q ++ + +L  QL  +G+++    + +    ++  +N + ++ +  A QY G+  +     + +T K +      D   ++ RYY N FSD  +Q SI+LFLG F
Sbjct:   31 GIMGTIHLVAGMYLVVITDKVKVGDLLGHAVWKAVGFDVISYKKTILHLNDN-------------QMQDNKTFLSMINGVLHTDAFYFATTYDLTHTLQRLANTSP----------DFQDTSLLERADQRFVWNGHLLREFMSQPE---------VSPSITVVVIKSSCINGK---KFEWSIISRRSCFRAGVRYYVRGIDVDGHAANFVETEQIV------QYGGSK-ASFVQTRGSIPFFWSQRPNLKY-KPKPQISKAGNHLDGLQRHFDSQVLLYGRQVV-LNLINQ---NGSEKPL-----------ELAFRNLVTSLGTGMVRYVAFDFHKECSRMRWHRLQILLDMVAEA--QEDFFLVDS------DGKVLLS---QDGTFRSNCMDCLDRTNVIQSLLARNSLQAQLQRMGVLHLGQKLEEQLDFEKTFKNAWADNADACAKQYAGTGALKT--DFTRTGKRTQLGLLMDGWNSMIRYYKNNFSDGFRQDSIDLFLGNF 467          
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Medaka
Match: inpp5f (inositol polyphosphate-5-phosphatase F [Source:NCBI gene;Acc:101155539])

HSP 1 Score: 140.198 bits (352), Expect = 7.036e-33
Identity = 125/443 (28.22%), Postives = 205/443 (46.28%), Query Frame = 2
Query:  530 YFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPP--DLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKG------------------CVDVI-----VCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIP--GRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLD--RMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGI 1771
            Y+S TYDL+N+VQ        +G +      +  Q   V+DRF WN  +     DL+  E  L     W+ P+I G+V    ++                      CVD I     V LI+RRSRH AG R+ +RG + +G+VAN VE+EQ+       I  +S   S VQ RGS+P+ W Q   +   +P IE   ++    +P    HF + +  +   +II NL+ Q  +   E+ + + F+K +      + N N     L Y++FD  +  +  +   ++ +    ++ I    + +         D    + K  Q G  R NC+DCLDRTN  Q  I +  +  QL  LG++      +  PL   R+ Q ++ N+G+ ++ QY G+  +    T     K +   +D + + +RYY N+F D  +Q  I+L +G+
Sbjct:  183 YYSLTYDLTNSVQR-------QGDSDRSGLPLWKQ---VDDRFFWNKHMIQDVIDLQVPEADL-----WVTPIIQGFVQVEELVVNYNETSDEERSSPESPPKEITCVDDIHPRFTVALISRRSRHRAGMRYKRRGVDTDGHVANYVETEQL-------IHVHSHTLSFVQTRGSVPVFWSQAGYRYNPRPRIEKGEKE---TMPFFAAHFEEQLRLYKKQVII-NLIDQSGR---EKIIGDAFLKQV----LLYNNPN-----LTYVSFDFHEHCRGMKFENVQTLTDAISDIITDMKWAWV--------DQAGVICK--QEGFFRVNCVDCLDRTNVVQAAIARVVMEQQLKKLGVMPP---EQPLPLKCYRIYQVMWANNGDTISRQYAGTAALKGDFTRTGERKLAGVMKDGVNSANRYYLNRFRDAYRQAVIDLMMGV 574          
BLAST of Polyphosphoinositide phosphatase vs. Planmine SMEST
Match: SMESG000033307.1 (SMESG000033307.1)

HSP 1 Score: 1244.95 bits (3220), Expect = 0.000e+0
Identity = 593/593 (100.00%), Postives = 593/593 (100.00%), Query Frame = 2
Query:  236 MTSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPLALWNKRQTLNHLYEFALRADLLHSFRTR 2014
            MTSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPLALWNKRQTLNHLYEFALRADLLHSFRTR
Sbjct:    1 MTSGKLLHKKVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPLALWNKRQTLNHLYEFALRADLLHSFRTR 593          

HSP 2 Score: 464.151 bits (1193), Expect = 2.921e-143
Identity = 242/242 (100.00%), Postives = 242/242 (100.00%), Query Frame = 2
Query: 4322 RLSELNSVCDQSLNDCSFQRIYVSLFDVIFTSDVNLIDKSAFNEHESFKNHTTVFYDGCAKWDRIENDVTNQNDSVGTLTRGPVMAALRNENLNEPKXXXXXXXXXXXXXXCGESLKKNRQDQGFVTNCSLIANEEDINKNKLINFVVTDYSQLSKTSSDSANSSWNFYQSKDKFNINSMKVIGTYYPNSCYLFQTVEKSIYQDTVDFNTSGKIKINNIFAHKEYLNRRDFPIHVNVKSKFC 5047
            RLSELNSVCDQSLNDCSFQRIYVSLFDVIFTSDVNLIDKSAFNEHESFKNHTTVFYDGCAKWDRIENDVTNQNDSVGTLTRGPVMAALRNENLNEPKSTSSDDFSDISDEDCGESLKKNRQDQGFVTNCSLIANEEDINKNKLINFVVTDYSQLSKTSSDSANSSWNFYQSKDKFNINSMKVIGTYYPNSCYLFQTVEKSIYQDTVDFNTSGKIKINNIFAHKEYLNRRDFPIHVNVKSKFC
Sbjct:  593 RLSELNSVCDQSLNDCSFQRIYVSLFDVIFTSDVNLIDKSAFNEHESFKNHTTVFYDGCAKWDRIENDVTNQNDSVGTLTRGPVMAALRNENLNEPKSTSSDDFSDISDEDCGESLKKNRQDQGFVTNCSLIANEEDINKNKLINFVVTDYSQLSKTSSDSANSSWNFYQSKDKFNINSMKVIGTYYPNSCYLFQTVEKSIYQDTVDFNTSGKIKINNIFAHKEYLNRRDFPIHVNVKSKFC 834          
BLAST of Polyphosphoinositide phosphatase vs. Planmine SMEST
Match: SMESG000033307.1 (SMESG000033307.1)

HSP 1 Score: 1192.56 bits (3084), Expect = 0.000e+0
Identity = 568/568 (100.00%), Postives = 568/568 (100.00%), Query Frame = 2
Query:  311 MILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPLALWNKRQTLNHLYEFALRADLLHSFRTR 2014
            MILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPLALWNKRQTLNHLYEFALRADLLHSFRTR
Sbjct:    1 MILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNETIWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPLALWNKRQTLNHLYEFALRADLLHSFRTR 568          

HSP 2 Score: 463.766 bits (1192), Expect = 1.818e-143
Identity = 242/242 (100.00%), Postives = 242/242 (100.00%), Query Frame = 2
Query: 4322 RLSELNSVCDQSLNDCSFQRIYVSLFDVIFTSDVNLIDKSAFNEHESFKNHTTVFYDGCAKWDRIENDVTNQNDSVGTLTRGPVMAALRNENLNEPKXXXXXXXXXXXXXXCGESLKKNRQDQGFVTNCSLIANEEDINKNKLINFVVTDYSQLSKTSSDSANSSWNFYQSKDKFNINSMKVIGTYYPNSCYLFQTVEKSIYQDTVDFNTSGKIKINNIFAHKEYLNRRDFPIHVNVKSKFC 5047
            RLSELNSVCDQSLNDCSFQRIYVSLFDVIFTSDVNLIDKSAFNEHESFKNHTTVFYDGCAKWDRIENDVTNQNDSVGTLTRGPVMAALRNENLNEPKSTSSDDFSDISDEDCGESLKKNRQDQGFVTNCSLIANEEDINKNKLINFVVTDYSQLSKTSSDSANSSWNFYQSKDKFNINSMKVIGTYYPNSCYLFQTVEKSIYQDTVDFNTSGKIKINNIFAHKEYLNRRDFPIHVNVKSKFC
Sbjct:  568 RLSELNSVCDQSLNDCSFQRIYVSLFDVIFTSDVNLIDKSAFNEHESFKNHTTVFYDGCAKWDRIENDVTNQNDSVGTLTRGPVMAALRNENLNEPKSTSSDDFSDISDEDCGESLKKNRQDQGFVTNCSLIANEEDINKNKLINFVVTDYSQLSKTSSDSANSSWNFYQSKDKFNINSMKVIGTYYPNSCYLFQTVEKSIYQDTVDFNTSGKIKINNIFAHKEYLNRRDFPIHVNVKSKFC 809          
BLAST of Polyphosphoinositide phosphatase vs. Planmine SMEST
Match: SMESG000049450.1 (SMESG000049450.1)

HSP 1 Score: 182.57 bits (462), Expect = 8.356e-48
Identity = 158/518 (30.50%), Postives = 245/518 (47.30%), Query Frame = 2
Query:  263 KVRGIAGFVRFKQGYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIPGRHFSDLIYRHG-TPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNN----VLEKMIPIANECIKKTGFFYSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGII----NNINVSKIRPLDR-------MLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            K+ GI G ++   G+++I+I     V  L QH IYK+ E+++I L  +     D             T+   E+ YL +  +V  + D Y S T DL+++ Q   + SS        FN +   +   ++RFVWN  L    ++  E +      +++P++HG++G  +           + LI+RRS H AGTR+  RG + NGN +N VE+EQIV      +F  S++ S +Q RGSIPL W Q+        P     ED    I   HF+  IY H   P I++NL+ Q      E+PL   F +          + NL    + Y+ FD   + KN + +    ++E ++P  NE            L     D+++S+   +Q G+ RTNCIDCLDRTN  Q +I    L   L  L I+    N  N S+   LD+       + +NL+ ++G+ LA+QY G+  + +  T       S    D  ++  RY  N F D  +Q S+ LFLG
Sbjct:   52 KIWGIWGMIKLLSGHFLIVIKDVEMVGTLNQHDIYKITESQIIPLSRSNRHIVD-------------TQILIEREYLQMLETVLATQDFYLSSTMDLTHSFQRLQNVSSD-------FNKMSMFER-ADERFVWNRHLVNNFVQSPELQ-----KFVLPIMHGFIGSINYNFPHSGSPFSIWLISRRSVHRAGTRYYSRGCDNNGNASNFVETEQIV------VF-GSEIVSFIQTRGSIPLVWSQKPNLYYKPNPKMSVPEDEQIAILTEHFNSQIYFHKYGPQIVVNLLNQS---GSEKPLGSLFAR-------ILHDSNLKS--VKYVPFDFHHMCKNMKWDKLEILMETLVPDMNEM---------KYLHMSDKDSQKSIVTQMQNGVFRTNCIDCLDRTNVVQSMISWCVLERILIDLNILPTSSNAHNHSRGDLLDQTCPELHFLYKNLWADNGDTLAIQYTGTGALKSDFTRTGKRLASGVMADGYKSSVRYILNNFRDGFRQDSMELFLG 515          
BLAST of Polyphosphoinositide phosphatase vs. Planmine SMEST
Match: SMESG000079090.1 (SMESG000079090.1)

HSP 1 Score: 110.538 bits (275), Expect = 2.896e-24
Identity = 95/338 (28.11%), Postives = 164/338 (48.52%), Query Frame = 2
Query:  794 DVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIV-FENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYN-DIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFFYSN------ALLKQFPDNERSLTK-----TLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLG 1768
            ++IV LI+RR+R+ AGTRF +RG + NGNVAN VE+EQ +  EN+    ++  + S VQ+RGS+P+ W Q + K    PPI +   +  N +   +HF   +  +   ++++NLV    + + ER +++ +++                   H I F+  KI           M    + C    G  + N       + K F D + S          Q  I R NC+DCLDRTN  Q ++    +  QL  LG+++    S      +++Q+++ N+G+ L+ QY G+  +    T       +   +D + ++SRYY  +  +  +Q +I+L +G
Sbjct:  307 EMIVGLISRRNRNRAGTRFRRRGVDENGNVANYVETEQFLKVEND----KSPHLVSFVQIRGSVPVFWSQFSLKY--HPPIILERSEEENQEAFKKHFEAELNNY-EKVVVVNLVDTNIERS-ERKIADAYLQ-------------------HLIKFNSPKITC--------VMFDFHDYC---RGLQFDNVSILIKGVTKIFRDMKYSWVDKNGLICEQKSIFRVNCVDCLDRTNVVQCMLAGVVIETQLRKLGLLSP-EESLPSNFYQIMQSMWANNGDALSRQYSGTAAMKGDFTRTGARTMNGLVKDGMSSMSRYY-LRLREMSRQAAIDLIIG 604          
BLAST of Polyphosphoinositide phosphatase vs. Planmine SMEST
Match: SMESG000043682.1 (SMESG000043682.1)

HSP 1 Score: 110.923 bits (276), Expect = 5.229e-24
Identity = 123/502 (24.50%), Postives = 214/502 (42.63%), Query Frame = 2
Query:  308 YMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSP---WDNLAKEEFCCQFPQTKHPDEKRYLALFNSVDLSID---NYFSYTYDLSNTVQYNLSYSSIKGSNRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHGYVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVESEQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFEDPYNDIP-GRHFSDL--IYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYLQGYFRNFNLGDEILHYINFDMAKIQKNRRN-NVLEKMIPIANECIKKTGFFY-SNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGYQLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETYRKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKP 1780
            Y++++T    + +L +  ++K+   + I + G +  P     N+ K      F   K P  K       S+D+S +    Y   T D+                                 RFVWN  L  P +            W   +I G    + + +    + +  C+I+R S    GTRF  RG +  GNVAN +E+EQ    ++G     S + S +Q+RGS+PL W Q + + +G   I+ +     + I    HF  L  IY     ++I+NL+  +E    ER L+ +FI          +  +  D+I  +++FD  +   NR + N + K+    +E + ++ F +  N  + Q            QFG++RTNC+DCLDRTN  Q  IG   +  +  ++ I N    SK+  +    +++++++G+ +++ Y GS                ++  D  + + R Y   FSD  KQ   N  L + +P
Sbjct:   73 YLVVVTNADWITKLNETDVFKITSVQFIDMAGKSREPDSDLSNIHKLLESGSFYFGKGPKGK-------SMDISTNIQNTYLGKTMDM---------------------------------RFVWNKYLISPFIH-----FGLSNEWYNGIICGSFLANTIYSSTAHIKI--CVISRMSCQRVGTRFQTRGVDDAGNVANFIETEQCFIHSDG-----SLMASYIQIRGSVPLFWEQPSLQ-VGSHKIKFSRNFEMSSIAYENHFQSLKSIYNR---VLIVNLLGSKEG---ERNLASRFINC-------HKESSFQDDI-KFVSFDYHREISNRSSGNNINKLKSAISEFVDESHFCWIVNGEIVQ-----------KQFGVVRTNCVDCLDRTNAVQTAIGCELVLDKQLSVVIAN--QKSKLNSVLENFKSMWKSNGDNVSMIYAGS----------GALGVGSKLIDAQKTVKRTYQANFSDSYKQ---NAMLRLLRP 481          
The following BLAST results are available for this feature:
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIG41.559e-13339.26FIG4 phosphoinositide 5-phosphatase [Source:HGNC S... [more]
SACM1L4.334e-4429.00SAC1 like phosphatidylinositide phosphatase [Sourc... [more]
SACM1L4.334e-4429.00SAC1 like phosphatidylinositide phosphatase [Sourc... [more]
SACM1L4.876e-4429.00SAC1 like phosphatidylinositide phosphatase [Sourc... [more]
SACM1L1.191e-3931.19SAC1 like phosphatidylinositide phosphatase [Sourc... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C34B7.21.498e-11338.40pep chromosome:WBcel235:I:8336966:8341826:1 gene:W... [more]
sac-12.389e-4530.50SAC1 PIP phosphatase (Yeast Suppressor of ACtin) h... [more]
W09C5.73.388e-3128.57pep chromosome:WBcel235:I:13654009:13658167:1 gene... [more]
unc-266.192e-3030.68Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5E... [more]
unc-266.192e-3030.68Synaptojanin [Source:UniProtKB/Swiss-Prot;Acc:G5E... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIG43.607e-11537.33gene:FBgn0031611 transcript:FBtr0077443[more]
CG79561.687e-3426.86gene:FBgn0038890 transcript:FBtr0084112[more]
CG79561.953e-3426.86gene:FBgn0038890 transcript:FBtr0334664[more]
CG79562.733e-3426.86gene:FBgn0038890 transcript:FBtr0301211[more]
CG79566.897e-3325.43gene:FBgn0038890 transcript:FBtr0301212[more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIG41.810e-5240.51FIG4 phosphoinositide 5-phosphatase a [Source:NCBI... [more]
FIG49.918e-4942.31FIG4 phosphoinositide 5-phosphatase a [Source:NCBI... [more]
sacm1lb1.228e-4428.78SAC1 like phosphatidylinositide phosphatase b [Sou... [more]
sacm1la7.413e-4127.56SAC1 like phosphatidylinositide phosphatase a [Sou... [more]
inpp5f2.266e-3626.98inositol polyphosphate-5-phosphatase F [Source:NCB... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIG46.472e-6743.09FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
FIG41.006e-6543.42FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
FIG41.124e-6543.42FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
FIG41.295e-6543.42FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
FIG42.093e-6543.42FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fig49.994e-13138.38FIG4 phosphoinositide 5-phosphatase [Source:MGI Sy... [more]
Sacm1l5.373e-4329.41SAC1 suppressor of actin mutations 1-like (yeast) ... [more]
Sacm1l5.373e-4329.41SAC1 suppressor of actin mutations 1-like (yeast) ... [more]
Sacm1l8.318e-4329.41SAC1 suppressor of actin mutations 1-like (yeast) ... [more]
Synj11.950e-3326.38synaptojanin 1 [Source:MGI Symbol;Acc:MGI:1354961][more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92562|FIG4_HUMAN7.486e-13339.26Polyphosphoinositide phosphatase OS=Homo sapiens O... [more]
sp|Q91WF7|FIG4_MOUSE6.991e-13038.38Polyphosphoinositide phosphatase OS=Mus musculus O... [more]
sp|Q7Z9H9|FIG4_SCHPO1.975e-10137.33Polyphosphoinositide phosphatase OS=Schizosaccharo... [more]
sp|P42837|FIG4_YEAST1.796e-10036.94Polyphosphoinositide phosphatase OS=Saccharomyces ... [more]
sp|Q7XZU3|SAC1_ARATH1.407e-9633.73Phosphoinositide phosphatase SAC1 OS=Arabidopsis t... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M5203.269e-14044.31SAC domain-containing protein OS=Opisthorchis feli... [more]
A0A419QBR81.575e-13844.59Polyphosphoinositide phosphatase OS=Clonorchis sin... [more]
A0A4V3SG911.754e-13844.31SAC domain-containing protein OS=Opisthorchis feli... [more]
A0A0L8GHF23.100e-13641.43SAC domain-containing protein OS=Octopus bimaculoi... [more]
A0A0X3PEL95.667e-13643.68Polyphosphoinositide phosphatase (Fragment) OS=Sch... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIG44.673e-12036.81FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
FIG41.380e-11936.81FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
FIG41.380e-11936.81FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
FIG43.998e-11936.48FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
sacm1lb9.936e-4529.08phosphatidylinositide phosphatase SAC1-A [Source:N... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
FIG41.383e-7739.12FIG4 phosphoinositide 5-phosphatase [Source:HGNC S... [more]
synj17.477e-2826.16synaptojanin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-91... [more]
inpp5f8.100e-1533.06inositol polyphosphate-5-phosphatase F [Source:NCB... [more]
ENSPMAT00000009281.14.645e-825.85pep scaffold:Pmarinus_7.0:GL484989:833:10188:-1 ge... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FIG42.586e-10236.94Phosphatidylinositol 3,5-bisphosphate (PtdIns[3,5]... [more]
SAC11.648e-3626.69Phosphatidylinositol phosphate (PtdInsP) phosphata... [more]
INP532.794e-2424.47Polyphosphatidylinositol phosphatase; dephosphoryl... [more]
INP522.286e-2125.00Polyphosphatidylinositol phosphatase; dephosphoryl... [more]
INP511.559e-725.88Phosphatidylinositol 4,5-bisphosphate 5-phosphatas... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367067.481e-3727.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262031.277e-3143.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432502.538e-2825.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339687.101e-2425.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480743.919e-2246.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FIG43.968e-11837.02FIG4 phosphoinositide 5-phosphatase [Source:NCBI g... [more]
sacm1la1.640e-4427.98phosphatidylinositide phosphatase SAC1-B [Source:N... [more]
sacm1lb1.576e-4128.88phosphatidylinositide phosphatase SAC1-A [Source:N... [more]
sacm1lb2.940e-3628.54phosphatidylinositide phosphatase SAC1-A [Source:N... [more]
inpp5f7.036e-3328.22inositol polyphosphate-5-phosphatase F [Source:NCB... [more]
back to top
BLAST of Polyphosphoinositide phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033307.12.921e-143100.00SMESG000033307.1[more]
SMESG000033307.11.818e-143100.00SMESG000033307.1[more]
SMESG000049450.18.356e-4830.50SMESG000049450.1[more]
SMESG000079090.12.896e-2428.11SMESG000079090.1[more]
SMESG000043682.15.229e-2424.50SMESG000043682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017818 ID=SMED30017818|Name=Polyphosphoinositide phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=5094bp
ATCTTATATGAATATATTTCCTAATCTTGAATTTTTTGATGTATATGAAA
ATCTACATCAAATAATTATTATTGGATACAATAATGATCACTCAATATCC
AAAATTTTAAAGTTAGCAAGATGGACAACTGAAGATAAAATTTTGAATTG
CGATGATTGGTTCCTAAGTATTATTGAAGATGAATATATTTATTATCCTG
AAACAATTGATCAGGCGAAAGCTTCAATAACTTCAATGACAAGCGGAAAG
TTACTGCATAAAAAGGTGCGTGGAATTGCAGGATTTGTACGATTTAAACA
AGGTTACTACATGATTTTAATAACCAAATGTTCTCGAGTAGCTCAACTCG
GTCAACATAAAATATATAAAGTGGACGAAACCAAAATGATCTATTTACCA
GGAACAACCACAAGTCCCTGGGATAATTTAGCTAAAGAGGAGTTTTGTTG
CCAATTTCCTCAAACAAAGCATCCAGATGAAAAACGTTACTTAGCTCTGT
TTAACTCTGTCGATTTGTCCATTGACAATTATTTCAGTTACACATATGAT
CTTAGTAACACTGTACAATACAATTTGTCATATTCTTCAATAAAAGGATC
AAACCGTATTATTTTCAACAGCATTCACGACCAGCAATTGTTAGTCAATG
ATCGTTTTGTTTGGAATTGGTCATTATGGCCGCCAGATTTGAGGCCTAGT
GAGAAACGACTCAGTTCTGGGTGCAATTGGTTGATACCGCTGATCCATGG
CTATGTTGGACAATCACATGTATTAGCAGGTAAAGGATGTGTCGATGTTA
TAGTTTGTTTGATTGCCAGGCGAAGTCGTCATTTTGCTGGAACAAGATTT
ATGAAAAGAGGATCTAATTTAAATGGGAATGTTGCAAATGAGGTGGAAAG
TGAACAAATTGTTTTTGAAAACGAGGGATTTATATTTGAAAACAGTAAAG
TAACTAGTATCGTTCAATTGAGGGGATCAATTCCTCTGCAGTGGCACCAA
GAAACTACAAAGTCTATCGGAAAACCTCCAATTGAAATGACTTTCGAAGA
TCCTTATAACGATATTCCGGGTCGGCATTTTTCAGATCTTATCTATCGAC
ATGGGACTCCGATTATCATCCTAAATTTAGTTAAACAAAGAGAAAAACAT
GCGTTTGAAAGACCTCTATCCGAAAAATTTATAAAATCCATAGATTATTT
GCAAGGCTATTTTCGGAACTTTAATTTAGGCGATGAAATTTTACACTATA
TAAATTTTGATATGGCAAAAATTCAAAAAAATCGTCGCAATAATGTTTTA
GAGAAAATGATTCCAATTGCCAACGAATGTATAAAGAAGACCGGATTTTT
CTATTCCAATGCTTTACTGAAGCAGTTTCCAGATAATGAAAGGTCATTAA
CAAAGACTCTTCAATTTGGAATAATTCGGACAAATTGCATAGATTGTTTG
GATCGTACAAATACTGCACAATTTGTAATTGGACAAACGGCCTTAGGATA
TCAGTTGTTTGCATTGGGAATCATTAATAATATCAATGTTAGCAAAATTA
GACCTCTAGATCGAATGCTTCAGAATCTTTATGAAAACCATGGTAACGTT
TTAGCTCTTCAATACGGTGGGAGTGTTTTGGTCCATAATGTCGAAACTTA
TAGAAAAACCGCGAAATTTTCTGCCCAGTCTCGCGATTTTCTTCAAGCAT
TGTCAAGATATTACAACAACAAATTCTCGGATCATGAAAAACAAATGTCA
ATCAATCTTTTTCTTGGAATTTTCAAACCATGGAATTGCAAAAACGAAAC
TATTTGGAATCATAAAAATTCTGACGTATTTTTACATGACAGTTACTGTC
AAATGAAACTGGATCAAACCAGTGAAAGTTCCGCTATTTGGATGTCTTGT
GAACTGATTGCAATCATTCCCAAACCTTTAGCTTTGTGGAATAAGCGGCA
AACTCTCAATCATTTATACGAGTTTGCGTTACGCGCGGATTTACTACATT
CATTTAGAACAAGGTATTTAATATAACATATTTATTATTTAAAATAATAT
TTAAAAAATATCTCAACTAACATTTAAAGATAATATTTTCAACACGAATT
TTAAAACGATCCCATATAGGCTTAGAACAAATAAAAATAATTCAACCAAA
ATTTCAAAGTTCTCGTTTAAATTTTATTACATCAGTTTCAACTGAATAAC
AACTATTTTAATACAAGTTATCTGTGGAACTATTCATCAAAACATCGCTA
TGGAAGACCTCCTGTTACCACCCAGCGCGATGATGCTATTATTCACAGGT
CTGTTATCCATTGATATCAGCTCGTCATATTATTGGTGAATTACCTGGGA
ATTGAAATTCTATGATTCTTACTATTCACGGCTTACTCACAAATCCAAGC
TTTTACCTATCGTTCAGCAGCAAAATTATGTTTCTTTAACAAGCACATCG
CAGATCGACTGGCTTTCTGTCACAGCTACAAATATTGTATATCTGTTGGC
TGACATAAAGTCATGTTTGCTGATGAGGCCCTTGTACAGCAGCTCCATTG
AAATCCTCCATATGTTAGTCGACCTCCTAATCAACGTTATGATTACCGAT
TTACTATCAATACTGTACAATATTCACCGTCTGTGATGATTTGGTCTGAC
ATTAGCAGTATTGGAATGTGCGAAATTTGGATCATGTCTTCAGGCACAAC
AATTAATACAGTTTATGTTGATATACTGTCACATCATATCCTGCCATACA
TGGAAGATCATAATTGCACCCATCTGCTTCATGCAGGGCTCCATGCCACT
CAGATAAGGTTGTGCAAAAATGGCTCATGGAACATTATTCCTGTGGTGGA
TGGCTGGCCTGGATCATCACCAGATCTAAACACAATTGAAAACTGCTAGA
CACAATCAAAGAAAAAAGATTCAGCTAAGAAGCCATAATTTGTGCCTGAT
TTAAAACAGAACAAACAGGAGGTTTGGTCAACAGAAATATCACTCCTGCT
TATTGCTGCAGCCTAGTGGATTCTATGCCAGCAAGGGTATCTGCTATCAT
CAAGGCTTAAATACTCTTTTCTGCCGAATAATAATTACAACTTCAAATAA
ATTAATATGTTTATTAACATTTAAATTGATTGTTTACTGTTATTTAATAA
ATTAATATATATTTGAATAGGTTCTGCTAAACCCTTGTTCGCCACTATAT
ATCAAATAATATTAAGTATTATTTATTATTTTGTAAAATTTATGTGTTTT
ATTATATTTACTTTTGGTGTGCCACGAAATTTGAAGAAAATTTTTGATTT
GACATGAATAAGAAAAGACTGCGGAGCTCTGATTTATACCCATGCTGTAA
GATTTAACTTACTCCTGATTTAATTTGTAAATAAAATAAAACTTTATACA
TGGAATTTAAAAATAAGAAGATTGGTGGTTAGTAGTACGATAGAATTTTA
CTATGTGGCTGTTAATTTCATTGATTTAATTATGCGTCAATATGTATTAA
AACATAGGTTAATTGACCCCATAAGGGTATGTAGAGCCCTTCTCAGGGGT
ATGTAGAGAGCTGAACCCGATGGTTGATTGGTAAAATAATTTCCTCTAAG
AATGAGAACATTTGGTTCGAACCATGTTGAAGATCAATTAATGTGATTAT
ATTAATAAACATTTTTGCTATATATAAATTTAAAAAATATTAAGAGGTTC
GAATGACCCTAAATGTTGGGAACTCCTGCCTTAAAACGTTGACGTTAACC
TATTAGTAACATTATCTATGCTAATAGTAAACAAAGTATTACTGATTAAT
ACTTGTCTCATTACTGGATAAAGCAGGTGAATTTGGAATTATTATTCTTT
TTAAAGAAATGAATATAATATATTTCACTCTGATGTTCATTTTTGAAAGT
TATAATTCAGCTTAAGAAACAGAAATTGTTGATATTTCTTTCTCTAGCTT
GACCGGAGAAATTTCAGCTCGTGAGCAATGAAAAAGCCCTATAAAAGAAA
CTAAAAACTTTTATAGATAGAGTGAGTAAATAGTGAACCAATGGTAACAT
TTTATAAAAGAGTAGTAGAGAAATTTCTATTAAGTTAAATCATTTTCGTT
TTCCACTTTAGGCAATTTCCGTTAGGGTCACTGGCCCTTTTATCCAGCAA
AGGTGATTTATGTGATTTATTGTGATTTATGATAATAATAAAATGTATTG
TGTTGAGTTCTTATTCCGATAGAGAACACAGAGAGTTAGATTTATAGCTC
TTTTCTGTCGAATAATAATTACAACCCAAAATAAATTAAGAAATACAATA
ACGAATGGCTACGTTAATTTCAGGTTATCAGAATTAAATAGCGTTTGTGA
TCAATCATTAAATGATTGCAGCTTCCAACGTATTTATGTCAGTCTTTTTG
ATGTTATTTTTACGTCTGATGTAAACCTTATTGATAAAAGTGCATTTAAT
GAACATGAAAGTTTTAAAAATCACACTACTGTATTTTATGATGGATGTGC
AAAATGGGACAGAATTGAAAATGATGTTACTAATCAAAATGATTCGGTTG
GAACTCTTACCCGTGGTCCTGTAATGGCAGCGTTAAGAAATGAAAATTTA
AATGAACCAAAATCGACATCAAGTGATGATTTTAGCGATATTAGCGATGA
AGATTGTGGGGAGAGTTTGAAAAAAAATCGCCAGGATCAGGGATTTGTGA
CTAACTGTTCTTTGATAGCGAATGAAGAAGACATTAATAAAAATAAATTA
ATTAATTTTGTAGTTACGGATTATTCTCAACTTTCCAAAACATCTTCCGA
TTCTGCTAATAGTTCGTGGAATTTTTATCAATCTAAAGATAAATTTAATA
TAAATTCCATGAAAGTTATTGGAACTTATTATCCGAATTCCTGTTACCTT
TTCCAAACAGTTGAAAAGAGTATTTATCAGGACACTGTGGACTTCAACAC
ATCTGGCAAAATAAAAATTAATAATATTTTTGCACATAAAGAATATTTGA
ACCGTCGAGATTTTCCGATCCATGTAAACGTGAAATCGAAATTTTGCTAA
TCTTATTGTACAATAGATTTTTTAATATATGATTCAGTATGTAA
back to top

protein sequence of SMED30017818-orf-1

>SMED30017818-orf-1 ID=SMED30017818-orf-1|Name=SMED30017818-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=675bp
SYMNIFPNLEFFDVYENLHQIIIIGYNNDHSISKILKLARWTTEDKILNC
DDWFLSIIEDEYIYYPETIDQAKASITSMTSGKLLHKKVRGIAGFVRFKQ
GYYMILITKCSRVAQLGQHKIYKVDETKMIYLPGTTTSPWDNLAKEEFCC
QFPQTKHPDEKRYLALFNSVDLSIDNYFSYTYDLSNTVQYNLSYSSIKGS
NRIIFNSIHDQQLLVNDRFVWNWSLWPPDLRPSEKRLSSGCNWLIPLIHG
YVGQSHVLAGKGCVDVIVCLIARRSRHFAGTRFMKRGSNLNGNVANEVES
EQIVFENEGFIFENSKVTSIVQLRGSIPLQWHQETTKSIGKPPIEMTFED
PYNDIPGRHFSDLIYRHGTPIIILNLVKQREKHAFERPLSEKFIKSIDYL
QGYFRNFNLGDEILHYINFDMAKIQKNRRNNVLEKMIPIANECIKKTGFF
YSNALLKQFPDNERSLTKTLQFGIIRTNCIDCLDRTNTAQFVIGQTALGY
QLFALGIINNINVSKIRPLDRMLQNLYENHGNVLALQYGGSVLVHNVETY
RKTAKFSAQSRDFLQALSRYYNNKFSDHEKQMSINLFLGIFKPWNCKNET
IWNHKNSDVFLHDSYCQMKLDQTSESSAIWMSCELIAIIPKPLALWNKRQ
TLNHLYEFALRADLLHSFRTRYLI*
back to top

protein sequence of SMED30017818-orf-2

>SMED30017818-orf-2 ID=SMED30017818-orf-2|Name=SMED30017818-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
MAALRNENLNEPKSTSSDDFSDISDEDCGESLKKNRQDQGFVTNCSLIAN
EEDINKNKLINFVVTDYSQLSKTSSDSANSSWNFYQSKDKFNINSMKVIG
TYYPNSCYLFQTVEKSIYQDTVDFNTSGKIKINNIFAHKEYLNRRDFPIH
VNVKSKFC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR002013SAC_dom
Vocabulary: molecular function
TermDefinition
GO:0042578phosphoric ester hydrolase activity
GO:0004438phosphatidylinositol-3-phosphatase activity
GO:0005515protein binding
GO:0016787hydrolase activity
GO:0034593phosphatidylinositol bisphosphate phosphatase activity
GO:0043812phosphatidylinositol-4-phosphate phosphatase activity
GO:0043813phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005768endosome
GO:0005783endoplasmic reticulum
GO:0005794Golgi apparatus
GO:0005811lipid particle
GO:0010008endosome membrane
GO:0016020membrane
GO:0031901early endosome membrane
GO:0031902late endosome membrane
GO:0043231intracellular membrane-bounded organelle
GO:0055037recycling endosome
Vocabulary: biological process
TermDefinition
GO:0006661phosphatidylinositol biosynthetic process
GO:0007033vacuole organization
GO:0007626locomotory behavior
GO:0010976positive regulation of neuron projection development
GO:0016311dephosphorylation
GO:0031642negative regulation of myelination
GO:0032288myelin assembly
GO:0036092phosphatidylinositol-3-phosphate biosynthetic process
GO:0043473pigmentation
GO:0046488phosphatidylinositol metabolic process
GO:0048666neuron development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002013SAC domainPFAMPF02383Syja_Ncoord: 88..421
e-value: 2.8E-69
score: 233.9
IPR002013SAC domainPROSITEPS50275SACcoord: 164..537
score: 64.445
NoneNo IPR availablePANTHERPTHR45738:SF5POLYPHOSPHOINOSITIDE PHOSPHATASEcoord: 6..629
NoneNo IPR availablePANTHERPTHR45738FAMILY NOT NAMEDcoord: 6..629