Alpha actinin

Overview
NameAlpha actinin
Smed IDSMED30017811
Length (bp)4405
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha actinin (SMED30017811) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha actinin (SMED30017811) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha actinin (SMED30017811) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha actinin (SMED30017811) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017811

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017811SMESG000047739.1 dd_Smed_v4_1492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017811SMESG000047739.1 dd_Smed_v4_1492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017811SMESG000047739.1 dd_Smed_v4_1492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017811SMESG000047739.1 dd_Smed_v4_1492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017811SMESG000047739.1 dd_Smed_v4_1492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017811SMESG000047739.1 dd_Smed_v4_1492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017811SMESG000062022.1 dd_Smed_v4_6167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017811SMESG000062022.1 dd_Smed_v4_6167_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017811SMESG000047739.1 Contig48639uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017811SMESG000047739.1 Contig48639newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017811SMESG000062022.1 Contig54890uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017811SMESG000062022.1 Contig54890newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017811SMESG000047739.1 Contig11904uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017811SMESG000047739.1 Contig11904newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30017811SMESG000047739.1 dd_Smed_v6_1492_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017811SMESG000047739.1 dd_Smed_v4_1492_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha actinin vs. Ensembl Human
Match: ACTN4 (actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 262/399 (65.66%), Postives = 325/399 (81.45%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE LPKP++GKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRPELI+Y  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+++   +++ EMQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W+ LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  MLK   Y+ + L
Sbjct:   48 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATL 446          

HSP 2 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 190/397 (47.86%), Postives = 274/397 (69.02%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   + LE IDQ+ L+YAK+ APF NW+E A EDLQD  I+H I+E++ LI   ++FK ++ +A  E   +  I  + ++ A  NH+     NPYT +  +I++ +W K+  L+P RD  L +E S+Q  NE LR +F S AN +GPW+  K + +  +S   N  T+E Q S L+Q E  I +Y+     +++  Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM EFR  FNHFDK+    L P+EFKACL+SLG +++ ++ GEAEF +IM+ VDP+ SG+VTF AFID+M++ETT+ DT +Q++ SFKVL  D+++ITAEELRRELP ++AEYCIA MAPY  P+   GALDYK F+++LYG SDL
Sbjct:  516 LEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMN-GTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          

HSP 3 Score: 66.2402 bits (160), Expect = 0.000e+0
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LS+++A+++K EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT  ++
Sbjct:  444 ATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRR 513          
BLAST of Alpha actinin vs. Ensembl Human
Match: ACTN4 (actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 262/399 (65.66%), Postives = 325/399 (81.45%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE LPKP++GKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRPELI+Y  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+++   +++ EMQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W+ LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  MLK   Y+ + L
Sbjct:   48 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATL 446          

HSP 2 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 190/397 (47.86%), Postives = 274/397 (69.02%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   + LE IDQ+ L+YAK+ APF NW+E A EDLQD  I+H I+E++ LI   ++FK ++ +A  E   +  I  + ++ A  NH+     NPYT +  +I++ +W K+  L+P RD  L +E S+Q  NE LR +F S AN +GPW+  K + +  +S   N  T+E Q S L+Q E  I +Y+     +++  Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM EFR  FNHFDK+    L P+EFKACL+SLG +++ ++ GEAEF +IM+ VDP+ SG+VTF AFID+M++ETT+ DT +Q++ SFKVL  D+++ITAEELRRELP ++AEYCIA MAPY  P+   GALDYK F+++LYG SDL
Sbjct:  516 LEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMN-GTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          

HSP 3 Score: 66.2402 bits (160), Expect = 0.000e+0
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LS+++A+++K EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT  ++
Sbjct:  444 ATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRR 513          
BLAST of Alpha actinin vs. Ensembl Human
Match: ACTN3 (actinin alpha 3 (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:165])

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 263/403 (65.26%), Postives = 325/403 (80.65%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LP+PDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAFE+AEKYLDIP+ML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+ G  S++ MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLS+RPAFMP EG L+SDI N W+ LE+ EK YE+WL+SE++R+++L HL + FR +   HEAW++GK EML    Y  + L
Sbjct:   39 LDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRIQEKCQLEINFNTLQTKLRLSHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFRQKASLHEAWTRGKEEMLSQRDYDSALL 441          

HSP 2 Score: 354.755 bits (909), Expect = 0.000e+0
Identity = 174/402 (43.28%), Postives = 270/402 (67.16%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGG--NGALDYKLFASSLYGHSDL 4221
            ++++  +E + +LLE ID++QL++A++ APF NW++ A EDLQD  ++H ++E + L+   ++FK ++  A  E   +  I  +I++      L   S NPY  L+ + ++ +W+ +  L+P  D+ LQ+EL++Q  NE+LR +F + AN +GPW+  K + V  L++G    ++E Q + L Q E +I  Y+     ++   Q LQ++++F+  +  +SME +RV WEQL +S+ R+  E+ENQ+LTRD+KG+SQ Q++EFR  FNHFD+ +   +EP +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D++YIT EELRRELP+++AEYCI  M PY   G   GALDY  F+S+LYG SDL
Sbjct:  505 QKRRDALERMEKLLETIDRLQLEFARRAAPFNNWLDGAVEDLQDVWLVHSVEETQSLLTAHDQFKATLPEADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQTLQEELARQQVNERLRRQFAAQANAIGPWIQAKVEEVGRLAAG-LAGSLEEQMAGLRQQEQNIINYKTNIDRLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKQNGMMEPDDFRACLISMGYDL----GEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTTEQVVASFKILAGDKNYITPEELRRELPAKQAEYCIRRMVPYKGSGAPAGALDYVAFSSALYGESDL 901          

HSP 3 Score: 70.0922 bits (170), Expect = 0.000e+0
Identity = 31/70 (44.29%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A L E+RA++++ EAFESD  AH  RV+ I  +A EL  L+YH+  S+NSR   I ++W+ +  LT+K++
Sbjct:  439 ALLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYHEAASVNSRCQAICDQWDNLGTLTQKRR 508          
BLAST of Alpha actinin vs. Ensembl Human
Match: ACTN1 (actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 260/403 (64.52%), Postives = 326/403 (80.89%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    +++ MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W  LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  ML+   Y+ + L
Sbjct:   25 LDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATL 427          

HSP 2 Score: 344.739 bits (883), Expect = 0.000e+0
Identity = 178/445 (40.00%), Postives = 273/445 (61.35%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDR-------------------------------------------DYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E   +LLE IDQ+ L+YAK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++ +A  E   +  I +++ +     H+     NPYT +  + ++ +W+ +  L+P RD+ L +E ++Q  NE+LR++FG+ AN +GPW+  K + +  +S  +   T+E Q S L Q E  I  Y+    +++   Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM+EFR  FNHFD+ KT  ++  +F+ACL+S+G N+    GEAEF +IM+ VDP+R GVVTF AFID+M++ET + DT +Q++ SFK+L  D+                                           +YIT +ELRRELP ++AEYCIA MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  491 QKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISI-EMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNM----GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKLQEGGKMQTAHAAFTPPGFAAVSGRAALRLLDFAAFLTTLSSQNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 930          

HSP 3 Score: 73.9442 bits (180), Expect = 0.000e+0
Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LSE++A++KK EAFESD  AH  RV++I  IA EL  L+Y+D  S+N+R   I ++W+ +  LT+K++
Sbjct:  425 ATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRR 494          
BLAST of Alpha actinin vs. Ensembl Human
Match: ACTN1 (actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 260/403 (64.52%), Postives = 326/403 (80.89%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    +++ MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W  LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  ML+   Y+ + L
Sbjct:   25 LDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATL 427          

HSP 2 Score: 364.77 bits (935), Expect = 0.000e+0
Identity = 178/402 (44.28%), Postives = 273/402 (67.91%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E   +LLE IDQ+ L+YAK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++ +A  E   +  I +++ +     H+     NPYT +  + ++ +W+ +  L+P RD+ L +E ++Q  NE+LR++FG+ AN +GPW+  K + +  +S  +   T+E Q S L Q E  I  Y+    +++   Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM+EFR  FNHFD+ KT  ++  +F+ACL+S+G N+    GEAEF +IM+ VDP+R GVVTF AFID+M++ET + DT +Q++ SFK+L  D++YIT +ELRRELP ++AEYCIA MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  491 QKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISI-EMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNM----GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 887          

HSP 3 Score: 73.9442 bits (180), Expect = 0.000e+0
Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LSE++A++KK EAFESD  AH  RV++I  IA EL  L+Y+D  S+N+R   I ++W+ +  LT+K++
Sbjct:  425 ATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRR 494          
BLAST of Alpha actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 254/417 (60.91%), Postives = 330/417 (79.14%), Query Frame = 2
Query: 1580 DCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            D  + ++  ++   ++  WEKQQK TFTAWCNSHLRK  T+I  I EDFR+GL LM LLEVISGE LPKPD+GKMR HKIANVNK L++I+ KGVKLV + AEEIVDGNVKMTLG+IWTIILRFAIQDI ++++SA++GLLLWCQRKT+PY NV V NFH S+KDGLAFCALIHRHRP+L+DY  L K +P HNLN AF+IAEK+LDIP+ML+ EDM NS +PDE +VM YVS YYH F+G  KAETA+NRIC+V+ VN+ENE ++  Y+ LASDL+ WI   + +L N++  +++ + Q   +++R YRR +KPPR+E+KG+LE+ +NTLQTRLRLSNRPAF+P++G LI DIN  W  LE +EK +EEWL+SE+ R+E+L+HL + FR +C  HE W+ GK + L+S+ ++   L
Sbjct:   17 DYTQQEEEWDREGLLDPAWEKQQKKTFTAWCNSHLRKAGTSIDTIEEDFRNGLKLMLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDMANS-QPDEKAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGL 432          

HSP 2 Score: 305.834 bits (782), Expect = 0.000e+0
Identity = 155/398 (38.94%), Postives = 255/398 (64.07%), Query Frame = 1
Query: 3025 RKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHL-TQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGNG--ALDYKLFASSLY 4206
            +++  +E   R+ E +D + LD+AK+ APF NW++ A+EDL D  I+H + E++ L+   ++FK ++ +A  EF+ ++QI+ ++      + L  ++  NPYT L+   +  +W ++   +P RD  LQ EL +Q  NE+LR  F   AN++GPWL+ + + V  +  G     +E    QL  ++ ++  Y+    E+++  QE+Q+N +FE    R+SME+LRV WE L +S+ ++  E ENQ+L RDSKGIS+ Q+ EFR  F+HFDK +   L+P++ ++CL+S+G  ++  + G+AE  +++A VDP+R G V F AF+D+M KE ++QDT+EQ++ SF++L   + +ITA+EL RELP ++A YC+A MAP  E G    + DY  F+ SLY
Sbjct:  497 KRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLG-GRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERA-GLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLY 892          

HSP 3 Score: 59.6918 bits (143), Expect = 0.000e+0
Identity = 28/72 (38.89%), Postives = 45/72 (62.50%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            +   L +++A+ K+ EAFESD  AH  RV++I  IA EL  L Y D+  IN+R   I ++W+ +  L+ K++
Sbjct:  428 RSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRR 499          
BLAST of Alpha actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 250/444 (56.31%), Postives = 325/444 (73.20%), Query Frame = 2
Query: 1580 DCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAH---------------------------KAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            D  + ++  ++   ++  WEKQQK TFTAWCNSHLRK  T+I  I EDFR+GL LM LLEVISGE LPKPD+GKMR HKIANVNK L++I+ KGVKLV + AEEIVDGNVKMTLG+IWTIILRFAIQDI ++++SA++GLLLWCQRKT+PY NV V NFH S+KDGLAFCALIHRHRP+L+DY  L K +P HNLN AF+IAEK+LDIP+ML+ ED+  S  PDE S M YVS +YHAF                                AETA+NRIC+V+ VN+ENE ++  Y+ LASDL+ WI   + +L N++  +++ + Q   +++R YRR +KPPR+E+KG+LE+ +NTLQTRLRLSNRPAF+P++G LI DIN  W  LE +EK +EEWL+SE+ R+E+L+HL + FR +C  HE W+ GK + L+S+ ++   L
Sbjct:   17 DYTQQEEEWDREGLLDPAWEKQQKKTFTAWCNSHLRKAGTSIDTIEEDFRNGLKLMLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDV--SRHPDEKSTMTYVSCFYHAFRNMRDPPPPVIRQPPPQRVVVAPPPERDWRKDAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGL 458          

HSP 2 Score: 305.834 bits (782), Expect = 0.000e+0
Identity = 155/398 (38.94%), Postives = 255/398 (64.07%), Query Frame = 1
Query: 3025 RKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHL-TQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGNG--ALDYKLFASSLY 4206
            +++  +E   R+ E +D + LD+AK+ APF NW++ A+EDL D  I+H + E++ L+   ++FK ++ +A  EF+ ++QI+ ++      + L  ++  NPYT L+   +  +W ++   +P RD  LQ EL +Q  NE+LR  F   AN++GPWL+ + + V  +  G     +E    QL  ++ ++  Y+    E+++  QE+Q+N +FE    R+SME+LRV WE L +S+ ++  E ENQ+L RDSKGIS+ Q+ EFR  F+HFDK +   L+P++ ++CL+S+G  ++  + G+AE  +++A VDP+R G V F AF+D+M KE ++QDT+EQ++ SF++L   + +ITA+EL RELP ++A YC+A MAP  E G    + DY  F+ SLY
Sbjct:  523 KRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLG-GRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERA-GLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLY 918          

HSP 3 Score: 59.6918 bits (143), Expect = 0.000e+0
Identity = 28/72 (38.89%), Postives = 45/72 (62.50%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            +   L +++A+ K+ EAFESD  AH  RV++I  IA EL  L Y D+  IN+R   I ++W+ +  L+ K++
Sbjct:  454 RSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRR 525          
BLAST of Alpha actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 492.271 bits (1266), Expect = 0.000e+0
Identity = 225/362 (62.15%), Postives = 292/362 (80.66%), Query Frame = 2
Query: 1745 MKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            M LLEVISGE LPKPD+GKMR HKIANVNK L++I+ KGVKLV + AEEIVDGNVKMTLG+IWTIILRFAIQDI ++++SA++GLLLWCQRKT+PY NV V NFH S+KDGLAFCALIHRHRP+L+DY  L K +P HNLN AF+IAEK+LDIP+ML+ EDM NS +PDE +VM YVS YYH F+G  KAETA+NRIC+V+ VN+ENE ++  Y+ LASDL+ WI   + +L N++  +++ + Q   +++R YRR +KPPR+E+KG+LE+ +NTLQTRLRLSNRPAF+P++G LI DIN  W  LE +EK +EEWL+SE+ R+E+L+HL + FR +C  HE W+ GK + L+S+ ++   L
Sbjct:    1 MLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDMANS-QPDEKAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGL 361          

HSP 2 Score: 306.605 bits (784), Expect = 0.000e+0
Identity = 155/398 (38.94%), Postives = 255/398 (64.07%), Query Frame = 1
Query: 3025 RKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHL-TQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGNG--ALDYKLFASSLY 4206
            +++  +E   R+ E +D + LD+AK+ APF NW++ A+EDL D  I+H + E++ L+   ++FK ++ +A  EF+ ++QI+ ++      + L  ++  NPYT L+   +  +W ++   +P RD  LQ EL +Q  NE+LR  F   AN++GPWL+ + + V  +  G     +E    QL  ++ ++  Y+    E+++  QE+Q+N +FE    R+SME+LRV WE L +S+ ++  E ENQ+L RDSKGIS+ Q+ EFR  F+HFDK +   L+P++ ++CL+S+G  ++  + G+AE  +++A VDP+R G V F AF+D+M KE ++QDT+EQ++ SF++L   + +ITA+EL RELP ++A YC+A MAP  E G    + DY  F+ SLY
Sbjct:  426 KRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLG-GRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERA-GLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLY 821          

HSP 3 Score: 59.6918 bits (143), Expect = 0.000e+0
Identity = 28/72 (38.89%), Postives = 45/72 (62.50%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            +   L +++A+ K+ EAFESD  AH  RV++I  IA EL  L Y D+  IN+R   I ++W+ +  L+ K++
Sbjct:  357 RSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRR 428          
BLAST of Alpha actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 464.922 bits (1195), Expect = 0.000e+0
Identity = 221/389 (56.81%), Postives = 287/389 (73.78%), Query Frame = 2
Query: 1745 MKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAH---------------------------KAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            M LLEVISGE LPKPD+GKMR HKIANVNK L++I+ KGVKLV + AEEIVDGNVKMTLG+IWTIILRFAIQDI ++++SA++GLLLWCQRKT+PY NV V NFH S+KDGLAFCALIHRHRP+L+DY  L K +P HNLN AF+IAEK+LDIP+ML+ ED+  S  PDE S M YVS +YHAF                                AETA+NRIC+V+ VN+ENE ++  Y+ LASDL+ WI   + +L N++  +++ + Q   +++R YRR +KPPR+E+KG+LE+ +NTLQTRLRLSNRPAF+P++G LI DIN  W  LE +EK +EEWL+SE+ R+E+L+HL + FR +C  HE W+ GK + L+S+ ++   L
Sbjct:    1 MLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDV--SRHPDEKSTMTYVSCFYHAFRNMRDPPPPVIRQPPPQRVVVAPPPERDWRKDAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGL 387          

HSP 2 Score: 306.22 bits (783), Expect = 0.000e+0
Identity = 155/398 (38.94%), Postives = 255/398 (64.07%), Query Frame = 1
Query: 3025 RKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHL-TQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGNG--ALDYKLFASSLY 4206
            +++  +E   R+ E +D + LD+AK+ APF NW++ A+EDL D  I+H + E++ L+   ++FK ++ +A  EF+ ++QI+ ++      + L  ++  NPYT L+   +  +W ++   +P RD  LQ EL +Q  NE+LR  F   AN++GPWL+ + + V  +  G     +E    QL  ++ ++  Y+    E+++  QE+Q+N +FE    R+SME+LRV WE L +S+ ++  E ENQ+L RDSKGIS+ Q+ EFR  F+HFDK +   L+P++ ++CL+S+G  ++  + G+AE  +++A VDP+R G V F AF+D+M KE ++QDT+EQ++ SF++L   + +ITA+EL RELP ++A YC+A MAP  E G    + DY  F+ SLY
Sbjct:  452 KRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLG-GRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERA-GLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLY 847          

HSP 3 Score: 59.6918 bits (143), Expect = 0.000e+0
Identity = 28/72 (38.89%), Postives = 45/72 (62.50%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            +   L +++A+ K+ EAFESD  AH  RV++I  IA EL  L Y D+  IN+R   I ++W+ +  L+ K++
Sbjct:  383 RSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRR 454          
BLAST of Alpha actinin vs. Ensembl Celegans
Match: gsa-1 (G protein, Subunit Alpha [Source:UniProtKB/TrEMBL;Acc:Q7KPV0])

HSP 1 Score: 483.026 bits (1242), Expect = 4.088e-158
Identity = 237/377 (62.86%), Postives = 289/377 (76.66%), Query Frame = -3
Query:  303 LSCAAFKTETEEQKNRKESNXXXXXXXXXXXRSFKSTHRLLLLGAGESGKSTIVKQMRILHIDGFSNEEKKQKAEDIRKNLRDAILTITSAMSNINPPTKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGVLETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYLRYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTCAVDTENIRRVFNDCKDIIQRMHLRQYELL 1433
            + C     + E ++ RK  NK+IE+ + K+K+  ++THRLLLLGAGESGKSTIVKQMRILHI+GF+  EK++K  DIR+N+RDA+  I  AM  I P   L +P      DY+    + P+  YPSEFY++    W DKGV+  YERS+EYQLIDCA+YFLD+  ++ Q NY P+EQDILRCRV+T+GIFETKF VDKV FHMFDVGGQRDERRKWIQCFNDVTAIIFV A SSYN+VL ED +QNRLRESL L K+IWNNRWL+ ISVILFLNKQD+L EK+ A +  +E +FP++  Y LP D    N  E+ +  RAKYF R EFL+I+T  +DGRH+CY HFTCAVDTENIRRVFNDC+DIIQR+HLRQYELL
Sbjct:    4 MGCVGAGADAEGREARK-VNKQIEEQLAKDKQVMRATHRLLLLGAGESGKSTIVKQMRILHINGFNEAEKREKITDIRRNVRDAMQVILRAMDEIVPKVSLDDPSTAISRDYILRITNDPEDNYPSEFYDHILTCWKDKGVMACYERSSEYQLIDCAQYFLDKVDVVRQNNYDPSEQDILRCRVMTTGIFETKFEVDKVRFHMFDVGGQRDERRKWIQCFNDVTAIIFVCASSSYNLVLWEDNTQNRLRESLALFKNIWNNRWLKTISVILFLNKQDLLSEKIKAKRYLLESFFPEFEGYNLPNDAVFDNQ-EDKDVVRAKYFIRGEFLRISTANSDGRHHCYPHFTCAVDTENIRRVFNDCRDIIQRIHLRQYELL 378          
BLAST of Alpha actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0333801)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 259/403 (64.27%), Postives = 328/403 (81.39%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  TAI  I EDFR+GL LM LLEVISGE+LPKPD+GKMR HKIANVNK L FI  KGV LV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++M+AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRP+LIDY  LSK+NP  NLNTAF++AEKYLDIPRML+ +D++N+ KPDE ++M YVS YYHAF GA +AETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L ++    S+  +Q   + +R YRR  KPPR+E+K KLE+++NTLQT+LRLSNRPA++P EG  +SDI+N WK LE  EK +EEWL++E  R+E+L+HL + F+ + + HE W++GK EML+S  +++ +L
Sbjct:   28 LDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKL 430          

HSP 2 Score: 356.295 bits (913), Expect = 0.000e+0
Identity = 177/407 (43.49%), Postives = 273/407 (67.08%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVL----HQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +R++  ++   R+LE+ID + L++AK+ APF NW++  +EDL D  I+H ++E++ LI+  ++FK ++  A  EFN++     +++S ++Q  +   L    +NPYT L    ++ +W+ +  L+P RD+ L  EL +Q  NE LR +F   AN +GPW++ +   V  +  G   S +E Q  +L++ E  +  Y+    E++K  Q +Q++MIFE     ++METLRV WEQL +S+ R+  E+ENQILTRDSKGISQ Q++EFR  FNHFDKN+T  L P+EFK+CLVSLG ++ K+ +G+ +F +I+A VDP+ +G V F AF+D+M +E+T+ DT EQ++ SF++L  D+ YI  +ELRRELP ++AEYCI  M PY  P G  GALDY  F+++LYG +DL
Sbjct:  494 QRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL----ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGS-LEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          

HSP 3 Score: 72.4034 bits (176), Expect = 0.000e+0
Identity = 32/73 (43.84%), Postives = 50/73 (68.49%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKS 3035
            ++  L+EL+A+ KK EAFESD  AH  RV++I  IA EL  L YHD  S+N+R   I ++W+ +  LT+++++
Sbjct:  426 RQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRT 498          
BLAST of Alpha actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0070343)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 259/403 (64.27%), Postives = 328/403 (81.39%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  TAI  I EDFR+GL LM LLEVISGE+LPKPD+GKMR HKIANVNK L FI  KGV LV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++M+AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRP+LIDY  LSK+NP  NLNTAF++AEKYLDIPRML+ +D++N+ KPDE ++M YVS YYHAF GA +AETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L ++    S+  +Q   + +R YRR  KPPR+E+K KLE+++NTLQT+LRLSNRPA++P EG  +SDI+N WK LE  EK +EEWL++E  R+E+L+HL + F+ + + HE W++GK EML+S  +++ +L
Sbjct:   28 LDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKL 430          

HSP 2 Score: 356.295 bits (913), Expect = 0.000e+0
Identity = 177/407 (43.49%), Postives = 273/407 (67.08%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVL----HQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +R++  ++   R+LE+ID + L++AK+ APF NW++  +EDL D  I+H ++E++ LI+  ++FK ++  A  EFN++     +++S ++Q  +   L    +NPYT L    ++ +W+ +  L+P RD+ L  EL +Q  NE LR +F   AN +GPW++ +   V  +  G   S +E Q  +L++ E  +  Y+    E++K  Q +Q++MIFE     ++METLRV WEQL +S+ R+  E+ENQILTRDSKGISQ Q++EFR  FNHFDKN+T  L P+EFK+CLVSLG ++ K+ +G+ +F +I+A VDP+ +G V F AF+D+M +E+T+ DT EQ++ SF++L  D+ YI  +ELRRELP ++AEYCI  M PY  P G  GALDY  F+++LYG +DL
Sbjct:  494 QRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL----ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGS-LEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          

HSP 3 Score: 72.4034 bits (176), Expect = 0.000e+0
Identity = 32/73 (43.84%), Postives = 50/73 (68.49%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKS 3035
            ++  L+EL+A+ KK EAFESD  AH  RV++I  IA EL  L YHD  S+N+R   I ++W+ +  LT+++++
Sbjct:  426 RQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRT 498          
BLAST of Alpha actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0303048)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 259/403 (64.27%), Postives = 328/403 (81.39%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  TAI  I EDFR+GL LM LLEVISGE+LPKPD+GKMR HKIANVNK L FI  KGV LV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++M+AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRP+LIDY  LSK+NP  NLNTAF++AEKYLDIPRML+ +D++N+ KPDE ++M YVS YYHAF GA +AETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L ++    S+  +Q   + +R YRR  KPPR+E+K KLE+++NTLQT+LRLSNRPA++P EG  +SDI+N WK LE  EK +EEWL++E  R+E+L+HL + F+ + + HE W++GK EML+S  +++ +L
Sbjct:   28 LDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKL 430          

HSP 2 Score: 356.295 bits (913), Expect = 0.000e+0
Identity = 177/407 (43.49%), Postives = 273/407 (67.08%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVL----HQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +R++  ++   R+LE+ID + L++AK+ APF NW++  +EDL D  I+H ++E++ LI+  ++FK ++  A  EFN++     +++S ++Q  +   L    +NPYT L    ++ +W+ +  L+P RD+ L  EL +Q  NE LR +F   AN +GPW++ +   V  +  G   S +E Q  +L++ E  +  Y+    E++K  Q +Q++MIFE     ++METLRV WEQL +S+ R+  E+ENQILTRDSKGISQ Q++EFR  FNHFDKN+T  L P+EFK+CLVSLG ++ K+ +G+ +F +I+A VDP+ +G V F AF+D+M +E+T+ DT EQ++ SF++L  D+ YI  +ELRRELP ++AEYCI  M PY  P G  GALDY  F+++LYG +DL
Sbjct:  494 QRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL----ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGS-LEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          

HSP 3 Score: 72.4034 bits (176), Expect = 0.000e+0
Identity = 32/73 (43.84%), Postives = 50/73 (68.49%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKS 3035
            ++  L+EL+A+ KK EAFESD  AH  RV++I  IA EL  L YHD  S+N+R   I ++W+ +  LT+++++
Sbjct:  426 RQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRT 498          
BLAST of Alpha actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0310657)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 260/403 (64.52%), Postives = 327/403 (81.14%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  TAI  I EDFR+GL LM LLEVISGE+LPKPD+GKMR HKIANVNK L FI  KGV LV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++M+AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRP+LIDY  LSK+NP  NLNTAF++AEKYLDIPRML+ +D+ N+  PDE +VM YVSSYYH F+GA KAETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L ++    S+  +Q   + +R YRR  KPPR+E+K KLE+++NTLQT+LRLSNRPA++P EG  +SDI+N WK LE  EK +EEWL++E  R+E+L+HL + F+ + + HE W++GK EML+S  +++ +L
Sbjct:   28 LDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLQNTALPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKL 430          

HSP 2 Score: 357.066 bits (915), Expect = 0.000e+0
Identity = 177/407 (43.49%), Postives = 273/407 (67.08%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVL----HQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +R++  ++   R+LE+ID + L++AK+ APF NW++  +EDL D  I+H ++E++ LI+  ++FK ++  A  EFN++     +++S ++Q  +   L    +NPYT L    ++ +W+ +  L+P RD+ L  EL +Q  NE LR +F   AN +GPW++ +   V  +  G   S +E Q  +L++ E  +  Y+    E++K  Q +Q++MIFE     ++METLRV WEQL +S+ R+  E+ENQILTRDSKGISQ Q++EFR  FNHFDKN+T  L P+EFK+CLVSLG ++ K+ +G+ +F +I+A VDP+ +G V F AF+D+M +E+T+ DT EQ++ SF++L  D+ YI  +ELRRELP ++AEYCI  M PY  P G  GALDY  F+++LYG +DL
Sbjct:  496 QRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL----ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGS-LEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 897          

HSP 3 Score: 67.3958 bits (163), Expect = 0.000e+0
Identity = 32/75 (42.67%), Postives = 50/75 (66.67%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAEL--QRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKS 3035
            ++  L+EL+A+ KK EAFESD  AH  RV++I  IA EL    L YHD  S+N+R   I ++W+ +  LT+++++
Sbjct:  426 RQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNVSTLEYHDCVSVNARCQRICDQWDRLGALTQRRRT 500          
BLAST of Alpha actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0070344)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 260/403 (64.52%), Postives = 327/403 (81.14%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  TAI  I EDFR+GL LM LLEVISGE+LPKPD+GKMR HKIANVNK L FI  KGV LV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++M+AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRP+LIDY  LSK+NP  NLNTAF++AEKYLDIPRML+ +D+ N+  PDE +VM YVSSYYH F+GA KAETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L ++    S+  +Q   + +R YRR  KPPR+E+K KLE+++NTLQT+LRLSNRPA++P EG  +SDI+N WK LE  EK +EEWL++E  R+E+L+HL + F+ + + HE W++GK EML+S  +++ +L
Sbjct:   28 LDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLQNTALPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKL 430          

HSP 2 Score: 356.681 bits (914), Expect = 0.000e+0
Identity = 177/407 (43.49%), Postives = 273/407 (67.08%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVL----HQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +R++  ++   R+LE+ID + L++AK+ APF NW++  +EDL D  I+H ++E++ LI+  ++FK ++  A  EFN++     +++S ++Q  +   L    +NPYT L    ++ +W+ +  L+P RD+ L  EL +Q  NE LR +F   AN +GPW++ +   V  +  G   S +E Q  +L++ E  +  Y+    E++K  Q +Q++MIFE     ++METLRV WEQL +S+ R+  E+ENQILTRDSKGISQ Q++EFR  FNHFDKN+T  L P+EFK+CLVSLG ++ K+ +G+ +F +I+A VDP+ +G V F AF+D+M +E+T+ DT EQ++ SF++L  D+ YI  +ELRRELP ++AEYCI  M PY  P G  GALDY  F+++LYG +DL
Sbjct:  494 QRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL----ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGS-LEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          

HSP 3 Score: 72.4034 bits (176), Expect = 0.000e+0
Identity = 32/73 (43.84%), Postives = 50/73 (68.49%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKS 3035
            ++  L+EL+A+ KK EAFESD  AH  RV++I  IA EL  L YHD  S+N+R   I ++W+ +  LT+++++
Sbjct:  426 RQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRT 498          
BLAST of Alpha actinin vs. Ensembl Zebrafish
Match: actn3b (actinin alpha 3b [Source:ZFIN;Acc:ZDB-GENE-030131-2040])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 263/400 (65.75%), Postives = 325/400 (81.25%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAFE+AEKYLDIP+ML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+LDHL + F+ +C  HE+W+ GK  +L    Y+ + L+
Sbjct:   40 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFICSKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYEKLASELLEWIRRTIPWLENRAAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFKQKCSLHESWTTGKEHLLSQKDYETASLM 439          

HSP 2 Score: 364.77 bits (935), Expect = 0.000e+0
Identity = 177/402 (44.03%), Postives = 273/402 (67.91%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E   +  I ++I + A    +  +  NPY++L+ + ++ +W  +  L+P+RD+ LQ+E+++Q  NE+LR  F + AN +GPW+  K + + H+S  D   ++E Q + L+Q E +I  Y+    +++   Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI+ M  Y  PEG  GALDY  F+S+LYG SDL
Sbjct:  502 QKRRDSLERVEKLWETIDQLYLEFAKRAAPFNNWMDGAIEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMAVMGIQNEIVKIAQTYGIKLVGVNPYSVLSPQDITNKWEAVKQLVPLRDQMLQEEVARQQANERLRRSFAAQANIIGPWIQTKMEEIGHVSV-DIAGSLEEQMNNLKQYEQNIINYKSNIDKLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKPYITVEELRRELPPEQAEYCISRMTKYVGPEGALGALDYISFSSALYGESDL 898          

HSP 3 Score: 75.0998 bits (183), Expect = 0.000e+0
Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+YHD  ++N+R   I ++W+ +  LT+K++
Sbjct:  436 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAATVNARCQGICDQWDNLGTLTQKRR 505          
BLAST of Alpha actinin vs. Ensembl Zebrafish
Match: actn3b (actinin alpha 3b [Source:ZFIN;Acc:ZDB-GENE-030131-2040])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 263/400 (65.75%), Postives = 325/400 (81.25%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAFE+AEKYLDIP+ML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+LDHL + F+ +C  HE+W+ GK  +L    Y+ + L+
Sbjct:   40 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFICSKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYEKLASELLEWIRRTIPWLENRAAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFKQKCSLHESWTTGKEHLLSQKDYETASLM 439          

HSP 2 Score: 364.77 bits (935), Expect = 0.000e+0
Identity = 177/402 (44.03%), Postives = 273/402 (67.91%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E   +  I ++I + A    +  +  NPY++L+ + ++ +W  +  L+P+RD+ LQ+E+++Q  NE+LR  F + AN +GPW+  K + + H+S  D   ++E Q + L+Q E +I  Y+    +++   Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI+ M  Y  PEG  GALDY  F+S+LYG SDL
Sbjct:  502 QKRRDSLERVEKLWETIDQLYLEFAKRAAPFNNWMDGAIEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMAVMGIQNEIVKIAQTYGIKLVGVNPYSVLSPQDITNKWEAVKQLVPLRDQMLQEEVARQQANERLRRSFAAQANIIGPWIQTKMEEIGHVSV-DIAGSLEEQMNNLKQYEQNIINYKSNIDKLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKPYITVEELRRELPPEQAEYCISRMTKYVGPEGALGALDYISFSSALYGESDL 898          

HSP 3 Score: 75.0998 bits (183), Expect = 0.000e+0
Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+YHD  ++N+R   I ++W+ +  LT+K++
Sbjct:  436 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAATVNARCQGICDQWDNLGTLTQKRR 505          
BLAST of Alpha actinin vs. Ensembl Zebrafish
Match: actn3a (actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-9])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 260/413 (62.95%), Postives = 333/413 (80.63%), Query Frame = 2
Query: 1595 DDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            +D+ ++   ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAF+IAEK+LDIP+ML+ +D+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   ++++ MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+LDHL + FR +   H++W+ GK E+L    Y+ + L+
Sbjct:   25 EDDWDRDLFLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFISSKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDIAEKFLDIPKMLDADDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIQRTIPWLENRVAEQTMHAMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFRQKSTLHQSWTTGKEELLSQKDYETASLM 437          

HSP 2 Score: 361.303 bits (926), Expect = 0.000e+0
Identity = 178/403 (44.17%), Postives = 274/403 (67.99%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGN---GALDYKLFASSLYGHSDL 4221
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E   +  I S++ + A    +  +S+NPYT+L+ + +  +W  +  L+P+RD+ LQ+E+++Q  NE+LR +F + AN +GPW+  K + ++H+S  D   ++E Q S L+  E +I  Y+    +++   Q  Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI+ M  Y  GG+   GALDY  F+S+LYG SDL
Sbjct:  500 QKRRESLERVEKLWETIDQLYLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMAIMGIHSEVLKIAQTYGIKIVSENPYTVLSHQNIVNKWEAVKQLVPMRDQMLQEEVARQQSNERLRRQFAAQANIIGPWIQTKMEEISHVSI-DIAGSLEEQMSNLKTYEQNIINYKSNIDKLEGDHQLSQEGLIFDNKHTNYTMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKAYITVEELRRELPPEQAEYCISRMTKYM-GGDAPPGALDYISFSSALYGESDL 896          

HSP 3 Score: 70.0922 bits (170), Expect = 0.000e+0
Identity = 31/70 (44.29%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+++D  +IN++   I ++W+ +  LT+K++
Sbjct:  434 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDFYDAATINAQCQGICDQWDNLGTLTQKRR 503          
BLAST of Alpha actinin vs. Ensembl Zebrafish
Match: actn3a (actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-9])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 260/413 (62.95%), Postives = 333/413 (80.63%), Query Frame = 2
Query: 1595 DDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            +D+ ++   ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAF+IAEK+LDIP+ML+ +D+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   ++++ MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+LDHL + FR +   H++W+ GK E+L    Y+ + L+
Sbjct:   25 EDDWDRDLFLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFISSKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDIAEKFLDIPKMLDADDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIQRTIPWLENRVAEQTMHAMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFRQKSTLHQSWTTGKEELLSQKDYETASLM 437          

HSP 2 Score: 361.303 bits (926), Expect = 0.000e+0
Identity = 178/403 (44.17%), Postives = 274/403 (67.99%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGN---GALDYKLFASSLYGHSDL 4221
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E   +  I S++ + A    +  +S+NPYT+L+ + +  +W  +  L+P+RD+ LQ+E+++Q  NE+LR +F + AN +GPW+  K + ++H+S  D   ++E Q S L+  E +I  Y+    +++   Q  Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI+ M  Y  GG+   GALDY  F+S+LYG SDL
Sbjct:  500 QKRRESLERVEKLWETIDQLYLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMAIMGIHSEVLKIAQTYGIKIVSENPYTVLSHQNIVNKWEAVKQLVPMRDQMLQEEVARQQSNERLRRQFAAQANIIGPWIQTKMEEISHVSI-DIAGSLEEQMSNLKTYEQNIINYKSNIDKLEGDHQLSQEGLIFDNKHTNYTMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKAYITVEELRRELPPEQAEYCISRMTKYM-GGDAPPGALDYISFSSALYGESDL 896          

HSP 3 Score: 70.0922 bits (170), Expect = 0.000e+0
Identity = 31/70 (44.29%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+++D  +IN++   I ++W+ +  LT+K++
Sbjct:  434 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDFYDAATINAQCQGICDQWDNLGTLTQKRR 503          
BLAST of Alpha actinin vs. Ensembl Zebrafish
Match: actn3a (actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-9])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 260/413 (62.95%), Postives = 333/413 (80.63%), Query Frame = 2
Query: 1595 DDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            +D+ ++   ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAF+IAEK+LDIP+ML+ +D+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   ++++ MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+LDHL + FR +   H++W+ GK E+L    Y+ + L+
Sbjct:   14 EDDWDRDLFLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFISSKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDIAEKFLDIPKMLDADDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIQRTIPWLENRVAEQTMHAMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFRQKSTLHQSWTTGKEELLSQKDYETASLM 426          

HSP 2 Score: 360.918 bits (925), Expect = 0.000e+0
Identity = 177/402 (44.03%), Postives = 272/402 (67.66%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGN--GALDYKLFASSLYGHSDL 4221
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E   +  I S++ + A    +  +S+NPYT+L+ + +  +W  +  L+P+RD+ LQ+E+++Q  NE+LR +F + AN +GPW+  K + ++H+S  D   ++E Q S L+  E +I  Y+    +++   Q  Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI+ M  Y  G    GALDY  F+S+LYG SDL
Sbjct:  489 QKRRESLERVEKLWETIDQLYLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMAIMGIHSEVLKIAQTYGIKIVSENPYTVLSHQNIVNKWEAVKQLVPMRDQMLQEEVARQQSNERLRRQFAAQANIIGPWIQTKMEEISHVSI-DIAGSLEEQMSNLKTYEQNIINYKSNIDKLEGDHQLSQEGLIFDNKHTNYTMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKAYITVEELRRELPPEQAEYCISRMTKYMGGDAPPGALDYISFSSALYGESDL 885          

HSP 3 Score: 70.0922 bits (170), Expect = 0.000e+0
Identity = 31/70 (44.29%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+++D  +IN++   I ++W+ +  LT+K++
Sbjct:  423 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDFYDAATINAQCQGICDQWDNLGTLTQKRR 492          
BLAST of Alpha actinin vs. Ensembl Xenopus
Match: gss (glutathione synthetase [Source:Xenbase;Acc:XB-GENE-976512])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 260/400 (65.00%), Postives = 325/400 (81.25%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL+ E++R+E+L+HL + F+ +   HE+W++GK E+L    Y+ + L+
Sbjct:   48 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRTPEKNMGAMQKKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLLEIRRLERLEHLAEKFKQKASLHESWTRGKEELLTQRDYESASLM 447          

HSP 2 Score: 355.91 bits (912), Expect = 0.000e+0
Identity = 179/402 (44.53%), Postives = 270/402 (67.16%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E + +LLE IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI    +FK ++  A  E   +  I ++I++ A    +     NPYT L    +S +W  +  L+P RD+ LQ+EL++Q  NE+LR +F + AN +GPW+  K + +  +S  D ++++E Q + L+Q E +I  Y+    +++   Q +Q+++IF+  +  +SME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM+EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI  M  Y   +  +GALDY  F+S+LYG SDL
Sbjct:  510 QKRRDALERVEKLLETIDQLYLEFAKRAAPFNNWMDGAVEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADKEKMSILGIQAEIQKIAQTYGIKLSGINPYTNLTHLDISNKWETVKQLVPHRDQTLQEELARQQANERLRRQFAAQANVIGPWIQSKMEEIGRISV-DISASLEDQMNHLKQYEQNIISYKSNIDKLEGDHQLIQESLIFDNKHTNYSMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKSYITIEELRRELPPEQAEYCITRMTKYTGADAISGALDYMSFSSALYGESDL 906          

HSP 3 Score: 75.485 bits (184), Expect = 0.000e+0
Identity = 34/70 (48.57%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+++K EAFESD  AH  RV++I  IA EL  L+YHD  S+NSR   I ++W+ +  LT+K++
Sbjct:  444 ASLMEIRALVRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNSRCQAICDQWDNLGTLTQKRR 513          
BLAST of Alpha actinin vs. Ensembl Xenopus
Match: gss (glutathione synthetase [Source:Xenbase;Acc:XB-GENE-976512])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 260/400 (65.00%), Postives = 325/400 (81.25%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL+ E++R+E+L+HL + F+ +   HE+W++GK E+L    Y+ + L+
Sbjct:   44 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRTPEKNMGAMQKKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLLEIRRLERLEHLAEKFKQKASLHESWTRGKEELLTQRDYESASLM 443          

HSP 2 Score: 355.91 bits (912), Expect = 0.000e+0
Identity = 179/402 (44.53%), Postives = 270/402 (67.16%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E + +LLE IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI    +FK ++  A  E   +  I ++I++ A    +     NPYT L    +S +W  +  L+P RD+ LQ+EL++Q  NE+LR +F + AN +GPW+  K + +  +S  D ++++E Q + L+Q E +I  Y+    +++   Q +Q+++IF+  +  +SME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM+EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI  M  Y   +  +GALDY  F+S+LYG SDL
Sbjct:  506 QKRRDALERVEKLLETIDQLYLEFAKRAAPFNNWMDGAVEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADKEKMSILGIQAEIQKIAQTYGIKLSGINPYTNLTHLDISNKWETVKQLVPHRDQTLQEELARQQANERLRRQFAAQANVIGPWIQSKMEEIGRISV-DISASLEDQMNHLKQYEQNIISYKSNIDKLEGDHQLIQESLIFDNKHTNYSMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKSYITIEELRRELPPEQAEYCITRMTKYTGADAISGALDYMSFSSALYGESDL 902          

HSP 3 Score: 75.485 bits (184), Expect = 0.000e+0
Identity = 34/70 (48.57%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+++K EAFESD  AH  RV++I  IA EL  L+YHD  S+NSR   I ++W+ +  LT+K++
Sbjct:  440 ASLMEIRALVRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNSRCQAICDQWDNLGTLTQKRR 509          
BLAST of Alpha actinin vs. Ensembl Xenopus
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:780123])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 257/399 (64.41%), Postives = 322/399 (80.70%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AE+YLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    ++  MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W  LE+ EK YEEW+++E++R+E+LDHL + FR +   HEAW+ GK  ML+   Y+ + L
Sbjct:   27 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAEKGYEEWMLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLQKKDYETASL 425          

HSP 2 Score: 360.533 bits (924), Expect = 0.000e+0
Identity = 176/396 (44.44%), Postives = 270/396 (68.18%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   +LLE IDQ+ L+YAK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++  A  E   +  I ++I +     H+     NPYT +  + ++ +W+ +  L+P RD+ L +E ++Q +NE+LR++F + AN +GPW+  K Q +  ++  +   T+E Q + L Q E  I  Y+    +++   Q++Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQ+LTRD+KGISQ QM+EFR  F+HFD+ K+  LE  +F+ACL+S+G N+    GEAEF +IM+ VDP+R G+VTF AFID+M++ET + DT +Q++ SFK+L  D++YITA+ELRRELP ++AEYCIA MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  495 LERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPEADKERQAILGIQNEISKIMQTYHVNMSGSNPYTSITPQEINNKWDHVRQLVPRRDQALTEEHARQQQNERLRKQFAAQANVIGPWIQTKMQEIGRIAI-EMHGTLEDQLNNLRQYEKSIVNYKPKIDQLESDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQVLTRDAKGISQEQMNEFRNSFSHFDRKKSGFLESDDFRACLISMGYNM----GEAEFARIMSIVDPNRLGLVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITADELRRELPPDQAEYCIARMAPYLGPDAVPGALDYMSFSTALYGESDL 885          

HSP 3 Score: 69.707 bits (169), Expect = 0.000e+0
Identity = 30/70 (42.86%), Postives = 51/70 (72.86%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+LS+++A++KK EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT++++
Sbjct:  423 ASLSDIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSQTVNARCQRICDQWDNLGALTQQRR 492          
BLAST of Alpha actinin vs. Ensembl Xenopus
Match: gss (glutathione synthetase [Source:Xenbase;Acc:XB-GENE-976512])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 260/400 (65.00%), Postives = 325/400 (81.25%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL+ E++R+E+L+HL + F+ +   HE+W++GK E+L    Y+ + L+
Sbjct:   38 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRTPEKNMGAMQKKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLLEIRRLERLEHLAEKFKQKASLHESWTRGKEELLTQRDYESASLM 437          

HSP 2 Score: 349.362 bits (895), Expect = 0.000e+0
Identity = 179/408 (43.87%), Postives = 270/408 (66.18%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDK------NKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E + +LLE IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI    +FK ++  A  E   +  I ++I++ A    +     NPYT L    +S +W  +  L+P RD+ LQ+EL++Q  NE+LR +F + AN +GPW+  K + +  +S  D ++++E Q + L+Q E +I  Y+    +++   Q +Q+++IF+  +  +SME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM+EFR  FNHFD+       +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI  M  Y   +  +GALDY  F+S+LYG SDL
Sbjct:  500 QKRRDALERVEKLLETIDQLYLEFAKRAAPFNNWMDGAVEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADKEKMSILGIQAEIQKIAQTYGIKLSGINPYTNLTHLDISNKWETVKQLVPHRDQTLQEELARQQANERLRRQFAAQANVIGPWIQSKMEEIGRISV-DISASLEDQMNHLKQYEQNIISYKSNIDKLEGDHQLIQESLIFDNKHTNYSMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRLLYDVPKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKSYITIEELRRELPPEQAEYCITRMTKYTGADAISGALDYMSFSSALYGESDL 902          

HSP 3 Score: 75.485 bits (184), Expect = 0.000e+0
Identity = 34/70 (48.57%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+++K EAFESD  AH  RV++I  IA EL  L+YHD  S+NSR   I ++W+ +  LT+K++
Sbjct:  434 ASLMEIRALVRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNSRCQAICDQWDNLGTLTQKRR 503          
BLAST of Alpha actinin vs. Ensembl Xenopus
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:780123])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 257/399 (64.41%), Postives = 322/399 (80.70%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AE+YLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    ++  MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W  LE+ EK YEEW+++E++R+E+LDHL + FR +   HEAW+ GK  ML+   Y+ + L
Sbjct:   27 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAEKGYEEWMLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLQKKDYETASL 425          

HSP 2 Score: 363.229 bits (931), Expect = 0.000e+0
Identity = 177/403 (43.92%), Postives = 277/403 (68.73%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E   +LLE IDQ+ L+YAK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++  A  E   +  I ++I +     H+     NPYT +  + ++ +W+ +  L+P RD+ L +E ++Q +NE+LR++F + AN +GPW+  K Q +  ++  +   T+E Q + L Q E  I  Y+    +++   Q++Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQ+LTRD+KGISQ QM+EFR  F+HFD++ +  L P+EFKACL+SLG ++  + +GEAEF +IM+ VDP+R G+VTF AFID+M++ET + DT +Q++ SFK+L  D++YITA+ELRRELP ++AEYCIA MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  489 QQRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPEADKERQAILGIQNEISKIMQTYHVNMSGSNPYTSITPQEINNKWDHVRQLVPRRDQALTEEHARQQQNERLRKQFAAQANVIGPWIQTKMQEIGRIAI-EMHGTLEDQLNNLRQYEKSIVNYKPKIDQLESDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQVLTRDAKGISQEQMNEFRNSFSHFDRDHSGRLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGLVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITADELRRELPPDQAEYCIARMAPYLGPDAVPGALDYMSFSTALYGESDL 890          

HSP 3 Score: 69.707 bits (169), Expect = 0.000e+0
Identity = 30/70 (42.86%), Postives = 51/70 (72.86%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+LS+++A++KK EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT++++
Sbjct:  423 ASLSDIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSQTVNARCQRICDQWDNLGALTQQRR 492          
BLAST of Alpha actinin vs. Ensembl Mouse
Match: Actn4 (actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 261/399 (65.41%), Postives = 325/399 (81.45%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE LPKP++GKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRPELI+Y  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L+++   +++ EMQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W+ LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  MLK   Y+ + L
Sbjct:   49 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKQRDYETATL 447          

HSP 2 Score: 371.318 bits (952), Expect = 0.000e+0
Identity = 189/417 (45.32%), Postives = 274/417 (65.71%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK---------------------GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   + LE IDQ+ L+YAK+ APF NW+E A EDLQD  I+H I+E++ LI   ++FK ++ +A  E   +  I  + ++ A  NH+     NPYT +  +I++ +W K+  L+P RD  L +E S+Q  NE LR +F S AN +GPW+  K + +  +S   N  T+E Q S L+Q E  I +Y+     +++  Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM EFR  FNHFDK+    L P+EFKACL+SLG +++ ++                     G+AEF +IM+ VDP+ SG+VTF AFID+M++ETT+ DT +Q++ SFKVL  D+++ITAEELRRELP ++AEYCIA MAPY  P+   GALDYK F+++LYG SDL
Sbjct:  517 LEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANMVGPWIQTKMEEIGRISIEMN-GTLEDQLSHLKQYERSIVDYKPSLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQTGSMDSDDFRALLISTGYSLGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYKSFSTALYGESDL 932          

HSP 3 Score: 65.855 bits (159), Expect = 0.000e+0
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LS+++A+++K EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT  ++
Sbjct:  445 ATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDNLGSLTHSRR 514          
BLAST of Alpha actinin vs. Ensembl Mouse
Match: Actn4 (actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 261/399 (65.41%), Postives = 325/399 (81.45%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE LPKP++GKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRPELI+Y  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L+++   +++ EMQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W+ LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  MLK   Y+ + L
Sbjct:   49 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKQRDYETATL 447          

HSP 2 Score: 379.022 bits (972), Expect = 0.000e+0
Identity = 189/397 (47.61%), Postives = 274/397 (69.02%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   + LE IDQ+ L+YAK+ APF NW+E A EDLQD  I+H I+E++ LI   ++FK ++ +A  E   +  I  + ++ A  NH+     NPYT +  +I++ +W K+  L+P RD  L +E S+Q  NE LR +F S AN +GPW+  K + +  +S   N  T+E Q S L+Q E  I +Y+     +++  Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM EFR  FNHFDK+    L P+EFKACL+SLG +++ ++ G+AEF +IM+ VDP+ SG+VTF AFID+M++ETT+ DT +Q++ SFKVL  D+++ITAEELRRELP ++AEYCIA MAPY  P+   GALDYK F+++LYG SDL
Sbjct:  517 LEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANMVGPWIQTKMEEIGRISIEMN-GTLEDQLSHLKQYERSIVDYKPSLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYKSFSTALYGESDL 912          

HSP 3 Score: 65.4698 bits (158), Expect = 0.000e+0
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LS+++A+++K EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT  ++
Sbjct:  445 ATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDNLGSLTHSRR 514          
BLAST of Alpha actinin vs. Ensembl Mouse
Match: Actn3 (actinin alpha 3 [Source:MGI Symbol;Acc:MGI:99678])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 263/414 (63.53%), Postives = 332/414 (80.19%), Query Frame = 2
Query: 1589 EDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            E +++ ++   ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LP+PDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAFE+AEKYLDIP+ML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+ G  S++ MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLS+RPAFMP EG L+SDI N W+ LE+ EK YE+WL+SE++R+++L HL + F+ +   HEAW++GK EML    Y+ + L
Sbjct:   27 EQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRLSHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLHEAWTRGKEEMLNQHDYESASL 440          

HSP 2 Score: 362.073 bits (928), Expect = 0.000e+0
Identity = 178/402 (44.28%), Postives = 272/402 (67.66%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGG--NGALDYKLFASSLYGHSDL 4221
            ++++  +E + +LLE IDQ+QL++A++ APF NW++ A EDLQD  ++H ++E + L+    +FK ++  A  E   +  I  +I++      L   S NPY  L+ + ++ +W+ +  L+P RD+ LQ+EL++Q  NE+LR +F + AN +GPW+  K + V  L++G    ++E Q + L Q E +I  Y+     ++   Q LQ++++F+  +  +SME +RV WEQL +S+ R+  E+ENQ+LTRD+KG+SQ Q++EFR  FNHFD+ +   +EP +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D++YIT EELRRELP+E+AEYCI  MAPY   G  +GALDY  F+S+LYG SDL
Sbjct:  504 QKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDGAIEDLQDVWLVHSVEETQSLLTAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRPKSGNPYITLSSQDINNKWDTVRKLVPSRDQTLQEELARQQVNERLRRQFAAQANAIGPWIQGKVEEVGRLAAG-LAGSLEEQMAGLRQQEQNIINYKSNIDRLEGDHQLLQESLVFDNKHTVYSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMMEPDDFRACLISMGYDL----GEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVASFKILAGDKNYITPEELRRELPAEQAEYCIRRMAPYKGSGAPSGALDYVAFSSALYGESDL 900          

HSP 3 Score: 72.0182 bits (175), Expect = 0.000e+0
Identity = 31/70 (44.29%), Postives = 49/70 (70.00%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA++++ EAFESD  AH  RV+ I  +A EL  L+YH+  S+NSR   I ++W+ +  LT+K++
Sbjct:  438 ASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYHEAASVNSRCQAICDQWDNLGTLTQKRR 507          
BLAST of Alpha actinin vs. Ensembl Mouse
Match: Actn1 (actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:2137706])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 258/403 (64.02%), Postives = 326/403 (80.89%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AE++LDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    +++ MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W  LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  ML+   Y+ + L
Sbjct:   25 LDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATL 427          

HSP 2 Score: 367.851 bits (943), Expect = 0.000e+0
Identity = 181/403 (44.91%), Postives = 277/403 (68.73%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E   +LLE IDQ+ L+YAK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++ +A  E   +  I +++ +     H+     NPYT +  + ++ +W+ +  L+P RD+ L +E ++Q  NE+LR++FG+ AN +GPW+  K + +  +S  +   T+E Q S L Q E  I  Y+    +++   Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM+EFR  FNHFD++ + TL P+EFKACL+SLG ++  + +GEAEF +IM+ VDP+R GVVTF AFID+M++ET + DT +Q++ SFK+L  D++YIT +ELRRELP ++AEYCIA MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  491 QKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISI-EMHGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL 892          

HSP 3 Score: 73.9442 bits (180), Expect = 0.000e+0
Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LSE++A++KK EAFESD  AH  RV++I  IA EL  L+Y+D  S+N+R   I ++W+ +  LT+K++
Sbjct:  425 ATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRR 494          
BLAST of Alpha actinin vs. Ensembl Mouse
Match: Actn1 (actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:2137706])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 258/403 (64.02%), Postives = 326/403 (80.89%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AE++LDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    +++ MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W  LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  ML+   Y+ + L
Sbjct:   25 LDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATL 427          

HSP 2 Score: 362.844 bits (930), Expect = 0.000e+0
Identity = 178/402 (44.28%), Postives = 273/402 (67.91%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E   +LLE IDQ+ L+YAK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++ +A  E   +  I +++ +     H+     NPYT +  + ++ +W+ +  L+P RD+ L +E ++Q  NE+LR++FG+ AN +GPW+  K + +  +S  +   T+E Q S L Q E  I  Y+    +++   Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM+EFR  FNHFD+ KT  ++  +F+ACL+S+G N+    GEAEF +IM+ VDP+R GVVTF AFID+M++ET + DT +Q++ SFK+L  D++YIT +ELRRELP ++AEYCIA MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  491 QKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISI-EMHGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNM----GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL 887          

HSP 3 Score: 73.9442 bits (180), Expect = 0.000e+0
Identity = 33/70 (47.14%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LSE++A++KK EAFESD  AH  RV++I  IA EL  L+Y+D  S+N+R   I ++W+ +  LT+K++
Sbjct:  425 ATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRR 494          
BLAST of Alpha actinin vs. UniProt/SwissProt
Match: sp|P30669|GNAS_SCHMA (Guanine nucleotide-binding protein G(s) subunit alpha OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 282/379 (74.41%), Postives = 314/379 (82.85%), Query Frame = -3
Query:  303 MALSCAAFKTETEEQKNRKESNXXXXXXXXXXXRSFKSTHRLLLLGAGESGKSTIVKQMRILHIDGFSNEEKKQKAEDIRKNLRDAILTITSAMSNINPPTKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGVLETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYLRYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTCAVDTENIRRVFNDCKDIIQRMHLRQYELL 1439
            M + C      +E+ K R ++NK+IEK IEKEK++FKSTHRLLLLGAGESGKSTIVKQMRILHIDGFS  EKK+K + IRKNLRDAI +I  AM ++ PP KL   EN+K  DY+  TASKPDF YP EF+ YCA LW D G+ ET+ERSNEYQLIDCAKYFLD+AL +G  NY P+EQDILRCRVLTSGIFETKF+VDKVNFHMFDVGGQR+ERRKWIQCFNDVTAIIFV ACSSYNMVLRED SQNR++ESLELL SIWNNRWLRNISVILFLNKQD+L EKVLAGKSKIE YFP Y  Y  PAD       E +E  RA++FFRDEFLK+T+  N GRHYCY H TCAVDTENIRRVFNDC+DIIQRMHLRQYELL
Sbjct:    1 MVIGCCTLNNISEDAKTRSDANKQIEKLIEKEKKNFKSTHRLLLLGAGESGKSTIVKQMRILHIDGFSEREKKEKIDAIRKNLRDAICSIAGAMGSLKPPVKLELSENRKLRDYILETASKPDFDYPPEFFTYCAKLWKDGGIQETFERSNEYQLIDCAKYFLDKALEVGAPNYIPSEQDILRCRVLTSGIFETKFSVDKVNFHMFDVGGQREERRKWIQCFNDVTAIIFVAACSSYNMVLREDPSQNRVKESLELLASIWNNRWLRNISVILFLNKQDLLTEKVLAGKSKIEVYFPHYATYQAPADTLAEYRHENSEVVRARFFFRDEFLKVTSNNNGGRHYCYPHLTCAVDTENIRRVFNDCRDIIQRMHLRQYELL 379          
BLAST of Alpha actinin vs. UniProt/SwissProt
Match: sp|O43707|ACTN4_HUMAN (Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 262/399 (65.66%), Postives = 325/399 (81.45%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE LPKP++GKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRPELI+Y  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+++   +++ EMQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W+ LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  MLK   Y+ + L
Sbjct:   48 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATL 446          

HSP 2 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 190/397 (47.86%), Postives = 274/397 (69.02%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   + LE IDQ+ L+YAK+ APF NW+E A EDLQD  I+H I+E++ LI   ++FK ++ +A  E   +  I  + ++ A  NH+     NPYT +  +I++ +W K+  L+P RD  L +E S+Q  NE LR +F S AN +GPW+  K + +  +S   N  T+E Q S L+Q E  I +Y+     +++  Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM EFR  FNHFDK+    L P+EFKACL+SLG +++ ++ GEAEF +IM+ VDP+ SG+VTF AFID+M++ETT+ DT +Q++ SFKVL  D+++ITAEELRRELP ++AEYCIA MAPY  P+   GALDYK F+++LYG SDL
Sbjct:  516 LEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMN-GTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          

HSP 3 Score: 66.2402 bits (160), Expect = 0.000e+0
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LS+++A+++K EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT  ++
Sbjct:  444 ATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRR 513          
BLAST of Alpha actinin vs. UniProt/SwissProt
Match: sp|P57780|ACTN4_MOUSE (Alpha-actinin-4 OS=Mus musculus OX=10090 GN=Actn4 PE=1 SV=1)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 261/399 (65.41%), Postives = 325/399 (81.45%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE LPKP++GKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRPELI+Y  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L+++   +++ EMQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W+ LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  MLK   Y+ + L
Sbjct:   49 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKQRDYETATL 447          

HSP 2 Score: 379.022 bits (972), Expect = 0.000e+0
Identity = 189/397 (47.61%), Postives = 274/397 (69.02%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   + LE IDQ+ L+YAK+ APF NW+E A EDLQD  I+H I+E++ LI   ++FK ++ +A  E   +  I  + ++ A  NH+     NPYT +  +I++ +W K+  L+P RD  L +E S+Q  NE LR +F S AN +GPW+  K + +  +S   N  T+E Q S L+Q E  I +Y+     +++  Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM EFR  FNHFDK+    L P+EFKACL+SLG +++ ++ G+AEF +IM+ VDP+ SG+VTF AFID+M++ETT+ DT +Q++ SFKVL  D+++ITAEELRRELP ++AEYCIA MAPY  P+   GALDYK F+++LYG SDL
Sbjct:  517 LEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANMVGPWIQTKMEEIGRISIEMN-GTLEDQLSHLKQYERSIVDYKPSLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYKSFSTALYGESDL 912          

HSP 3 Score: 65.4698 bits (158), Expect = 0.000e+0
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LS+++A+++K EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT  ++
Sbjct:  445 ATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDNLGSLTHSRR 514          
BLAST of Alpha actinin vs. UniProt/SwissProt
Match: sp|Q5RCS6|ACTN4_PONAB (Alpha-actinin-4 OS=Pongo abelii OX=9601 GN=ACTN4 PE=2 SV=1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 261/399 (65.41%), Postives = 325/399 (81.45%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE LPKP++GKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRPELI+Y  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVSS+YHAF+GA KAETA+NRIC+V+ VN+ENE L+  Y+KLASDL+ WI+  + +L+++   +++ EMQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W+ LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  MLK   Y+ + L
Sbjct:   48 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICRVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATL 446          

HSP 2 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 190/397 (47.86%), Postives = 274/397 (69.02%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   + LE IDQ+ L+YAK+ APF NW+E A EDLQD  I+H I+E++ LI   ++FK ++ +A  E   +  I  + ++ A  NH+     NPYT +  +I++ +W K+  L+P RD  L +E S+Q  NE LR +F S AN +GPW+  K + +  +S   N  T+E Q S L+Q E  I +Y+     +++  Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM EFR  FNHFDK+    L P+EFKACL+SLG +++ ++ GEAEF +IM+ VDP+ SG+VTF AFID+M++ETT+ DT +Q++ SFKVL  D+++ITAEELRRELP ++AEYCIA MAPY  P+   GALDYK F+++LYG SDL
Sbjct:  516 LEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMN-GTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          

HSP 3 Score: 66.2402 bits (160), Expect = 0.000e+0
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LS+++A+++K EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT  ++
Sbjct:  444 ATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRR 513          
BLAST of Alpha actinin vs. UniProt/SwissProt
Match: sp|A5D7D1|ACTN4_BOVIN (Alpha-actinin-4 OS=Bos taurus OX=9913 GN=ACTN4 PE=2 SV=1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 261/399 (65.41%), Postives = 325/399 (81.45%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE LPKP++GKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRPELI+Y  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  + +L+++   +++ EMQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W+ LE+ EK YEEWL++E++R+E+LDHL + FR +   HEAW+ GK  MLK   Y+ + L
Sbjct:   48 WEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATL 446          

HSP 2 Score: 377.096 bits (967), Expect = 0.000e+0
Identity = 189/397 (47.61%), Postives = 274/397 (69.02%), Query Frame = 1
Query: 3040 IEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +E   + LE IDQ+ L+YAK+ APF NW+E A EDLQD  I+H I+E++ LI   ++FK ++ +A  E   +  I  + ++ A  NH+     NPYT +  +I++ +W K+  L+P RD  L +E S+Q  NE LR +F S AN +GPW+  K + +  +S   N  T+E Q S L+Q E  I +Y+     +++  Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ QM EFR  FNHFDK+    L P+EFKACL+SLG +++ ++ G+AEF +IM+ VDP+ SG+VTF AFID+M++ETT+ DT +Q++ SFKVL  D+++ITAEELRRELP ++AEYCIA MAPY  P+   GALDYK F+++LYG SDL
Sbjct:  516 LEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANIVGPWIQTKMEEIGRISIEMN-GTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          

HSP 3 Score: 66.2402 bits (160), Expect = 0.000e+0
Identity = 29/70 (41.43%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A LS+++A+++K EAFESD  AH  RV++I  IA EL  L+Y+D  ++N+R   I ++W+ +  LT  ++
Sbjct:  444 ATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRR 513          
BLAST of Alpha actinin vs. TrEMBL
Match: R7VCM4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_101963 PE=4 SV=1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 274/403 (67.99%), Postives = 334/403 (82.88%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  TAI  I EDFR+GL LM LLEVISGE LPKPD+G+MR HKIANVNK LQFI+ KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++M+AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRPELIDY  LSK+NP  NLN AF++AEKYLDIPRML+ EDMVNS+KPDE SVMAYVSSYYHAF+GA +AETA+NRICKV+ +N+ENE L+  Y+++ASDL+ WI+    +L+N+    ++   Q   + FR+YRR  KPP+LEEK KLE+ +NTLQTRLRLSNRPA++P EG ++SDI N WK LER EK +E+WL+SE++R+E+LDHL + F+ +C+ HE WS GK EML++  +KK  L
Sbjct:   21 LDPAWEKQQKKTFTAWCNSHLRKAGTAIENIDEDFRNGLKLMLLLEVISGEQLPKPDRGRMRFHKIANVNKALQFIESKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPELIDYNKLSKDNPLENLNLAFDVAEKYLDIPRMLDAEDMVNSVKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKINQENERLMEEYERMASDLLEWIRRTTPWLENRTTDNTLPGTQRKLEEFREYRRAHKPPKLEEKAKLETTFNTLQTRLRLSNRPAYIPTEGKMVSDIANAWKGLERAEKGFEDWLLSELQRLERLDHLAQKFKHKCDIHEEWSTGKDEMLQAQDFKKCHL 423          

HSP 2 Score: 350.132 bits (897), Expect = 0.000e+0
Identity = 171/401 (42.64%), Postives = 274/401 (68.33%), Query Frame = 1
Query: 3028 KKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGN--GALDYKLFASSLYGHSDL 4221
            +K  +E    +LE IDQ+ L++AK+ APF NW++ AKEDL D  I+H  +E++ LI+   +FK+++  A  E+N +  +  ++++ +    +   ++NPY  +  + ++ +W ++  L+P RD+ LQ E+ +Q  NE+LR +F   AN +G W++    +V   S G    ++E   ++L  +E D++ YR    ++++ ++E+Q+ MIFE  +  ++METLRV WEQL +S+ R+  E+ENQILTRDSKGI+  QM+EFR+ F HFDK+K+R LE KEFK+CL+SLG N+++++ GEA+F +IM+ VDP+  G V+F AF+D+M +E T+ DT EQ++QSF++L  D  +ITA+ LRRELP ++AEYCI  MAP+   G   GALDY  F+++LYG S++
Sbjct:  489 RKNALEEAEHILERIDQLHLEFAKRAAPFNNWMDGAKEDLVDMFIVHTTEEIQGLIDAHEQFKQTLGEADKEYNSIISLVQEVQRISQQYGIMGGNENPYISITAQDIANKWAEVRQLVPQRDQTLQAEMIRQQNNERLRRQFAQKANVVGQWIERHLDMV--ASVGVQKGSLEDHLAKLHGVEGDVNAYRPNIADLERINEEVQEAMIFENSHTPYTMETLRVGWEQLLTSVARNINEVENQILTRDSKGITNEQMEEFRKSFFHFDKSKSRRLEAKEFKSCLISLGYNIRDDRQGEADFQRIMSIVDPNNMGHVSFDAFLDFMTREATDNDTAEQVMQSFRILAADAPFITADILRRELPPDQAEYCIKRMAPFHGQGAPPGALDYTSFSTALYGESNV 887          

HSP 3 Score: 75.0998 bits (183), Expect = 0.000e+0
Identity = 34/73 (46.58%), Postives = 52/73 (71.23%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKS 3035
            KK +L++L+A+ +K EAFESD  AH  RV++I  IA EL  L YHD+ S+NSR   I ++W+++  LT+ +K+
Sbjct:  419 KKCHLNDLKAMKRKHEAFESDLAAHQDRVEQIAAIAQELNTLGYHDVVSVNSRCQRICDQWDLLGNLTQGRKN 491          
BLAST of Alpha actinin vs. TrEMBL
Match: V3ZQ63 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_189716 PE=4 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 278/403 (68.98%), Postives = 332/403 (82.38%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  T+I  I EDFR GL LM LLEVISGE LPKPD+GKMR HKIANVNK L +I  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++++AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRP+LIDY  LSKENP  NLNTAF+IAEKYLDIPRML+ EDMVNS KPDE SVMAYVSSYYHAF+GA +AETA+NRICKV+ +N+ENE L+  Y+KLASDL+ WIK    +L+N+    ++   Q+  + FR YRR  KPP+LE+K KLE+++NTLQTRLRLSNRPA++P EG L+SDI + WK LE  EK +EEWL+SE++R+E+LDHL + FR +CE HE W+ GK EML+S  +KK +L
Sbjct:   13 LDPAWEKQQKKTFTAWCNSHLRKAGTSIENIEEDFRHGLKLMLLLEVISGEQLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDITVEELTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYHKLSKENPLENLNTAFDIAEKYLDIPRMLDPEDMVNSAKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKINQENERLMEEYEKLASDLLAWIKKTKPWLENRVTDNTLPGTQHKLEEFRDYRRKHKPPKLEDKAKLENNFNTLQTRLRLSNRPAYIPTEGKLVSDIADAWKGLESAEKGFEEWLLSELQRLERLDHLAQKFRHKCEIHEEWAVGKEEMLESRDFKKCRL 415          

HSP 2 Score: 363.614 bits (932), Expect = 0.000e+0
Identity = 182/403 (45.16%), Postives = 279/403 (69.23%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYP--EGGNGALDYKLFASSLYGHSDL 4221
            +R++  +E   ++LE ID + L++AK+ APF NW++ AKEDL D  I+H  +EV+ LI   + FK ++  A  E+  +  +   +++ A   ++T   DNPYT L+ + ++ +W ++  L+P RD+ LQ+E+ +Q +NE LR +F + AN +G W++++   V  +      S +E   ++++ +E +   +R    E+++ +QE+Q++MIFE    +++METLRV WEQL ++L R+  E+ENQILTRDSKGIS  QM+EF+  F+HFDKNKT  LEPKEFKACLVSLG N++++K GEA+F +IMA VDP+R+G +TF AFID+M +ET + DT EQ++ SFK+L  D+ +ITA+ LR+ELP ++AEYCI  MAPY   +   GALDY  F+++LYG SDL
Sbjct:  479 QRRREGLEEAEKILERIDHLHLEFAKRAAPFNNWMDGAKEDLLDMFIVHTTEEVQGLISAHDTFKSTLGEADKEYTTIITLVQDVQRLAQQYNMTP-PDNPYTTLHAQDIANKWREVQELVPKRDQTLQQEMMRQQKNETLRRQFANKANSVGEWIEKRLDFVAAIGVHMKGS-LEDHLNEIQHVEKECHGFRPHMEELERINQEVQESMIFENRYTQYTMETLRVGWEQLLTALARNINELENQILTRDSKGISAQQMNEFKLSFSHFDKNKTSRLEPKEFKACLVSLGYNIRDDKQGEADFQRIMAIVDPNRTGYITFEAFIDFMTRETADTDTAEQVMHSFKILAGDKPFITAQILRQELPPDQAEYCIQRMAPYSGRDAVPGALDYMSFSTALYGESDL 879          

HSP 3 Score: 69.3218 bits (168), Expect = 0.000e+0
Identity = 32/72 (44.44%), Postives = 49/72 (68.06%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            KK  L+EL+A+ KK EAFESD  AH  RV++I  IA EL  L+YHD+  +N+R   I ++W+ +   T++++
Sbjct:  411 KKCRLNELKAMKKKHEAFESDLAAHQDRVEQIAAIAQELNALDYHDVNRVNTRCQTICDQWDRLGQSTQRRR 482          
BLAST of Alpha actinin vs. TrEMBL
Match: A0A2T7NYF0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13876 PE=4 SV=1)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 273/403 (67.74%), Postives = 330/403 (81.89%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPD+GKMR HKIANVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++++AKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAFCALIHRHRP+LIDY  LS++NP  NLNTAF+IAEK+LDIPRML+ EDMVNS KPDE SVMAYVSSYYHAF+GA +AETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+    +L+N+    ++   +   D FR YRR  KPP+LE+K +LE+ +NTLQTRLRLSNRPA++P EG ++SDI N WK LE  EK +EEWL+SE++R+E+LDHL + FR +CE HE WS GK EML+S  +K+ +L
Sbjct:   26 LDPAWEKQQKKTFTAWCNSHLRKAGTGIENIEEDFRNGLKLMLLLEVISGEQLPKPDRGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDITVEELTAKEGLLLWCQRKTAPYKNVNVQNFHLSWKDGLAFCALIHRHRPDLIDYYKLSRDNPLENLNTAFDIAEKHLDIPRMLDPEDMVNSAKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRKTRPWLENRTTDNTLPGTRRKLDEFRDYRRKHKPPKLEDKARLENSFNTLQTRLRLSNRPAYLPTEGKMVSDIANAWKGLEHAEKGFEEWLLSELQRLERLDHLAQKFRHKCEIHEEWSTGKEEMLQSGDFKRCRL 428          

HSP 2 Score: 361.303 bits (926), Expect = 0.000e+0
Identity = 180/402 (44.78%), Postives = 278/402 (69.15%), Query Frame = 1
Query: 3025 RKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYP--EGGNGALDYKLFASSLYGHSDL 4221
            +++  +E   R+LE IDQ+ L++AK+ APF NW++ AKEDL D  I+H  +EV+ L++  ++FK ++  A  E++ +  +  ++ +      LT   +NPYT L+ + ++ +W ++  L+P RD+ LQ+E+ +Q  NE+LR +F + AN +G W++ +   V  +       ++E Q  +L+  +  +  Y+    E+++ +QE+Q+ MIFE    +++METLRV WEQL +++ R+  E+ENQILTRDSKGIS+ QM+EFR  FNHFDKN+TR LEPKEFKACL+SLG  +++++ GEA+F +IM+ VDP+ SG VTF AF+D+M +ET + DT EQ++QSFK+L  D+ YITA+ LR+ELP ++AEYCI  MAPY   +   GALDY  F+++LYG SDL
Sbjct:  493 KRREGLEEAERVLERIDQLHLEFAKRAAPFNNWMDGAKEDLLDMFIVHTTEEVQGLVDAHDQFKATLGEADKEYSTIVSLAQEVVRLGQQFGLTP-PENPYTTLHAQDITNKWAEVRDLVPRRDQTLQQEMMRQQNNERLRRQFAAKANVVGQWIEAQLDAVASIGV-QMRGSLEDQLKKLQAFDKAVVAYKPNMDELERFNQEVQEAMIFENRYTQYTMETLRVGWEQLLTAVARNINEVENQILTRDSKGISEDQMNEFRMSFNHFDKNRTRRLEPKEFKACLISLGYKIRDDRQGEADFQRIMSIVDPNGSGYVTFDAFLDFMTRETADTDTAEQVMQSFKILAGDKPYITAQILRQELPPDQAEYCIQRMAPYTGRDAVPGALDYMSFSTALYGESDL 892          

HSP 3 Score: 70.8626 bits (172), Expect = 0.000e+0
Identity = 33/72 (45.83%), Postives = 50/72 (69.44%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            K+  L+EL+A+ KK EAFESD  AH  RV++I  IA EL  L+YHD+ ++N+R   I ++W+ +  LT K++
Sbjct:  424 KRCRLNELKAMKKKHEAFESDLAAHQDRVEQIAAIAQELNALDYHDVATVNARCQRICDQWDRLGQLTVKRR 495          
BLAST of Alpha actinin vs. TrEMBL
Match: A0A2S2P9G4 (Alpha-actinin, sarcomeric (Fragment) OS=Schizaphis graminum OX=13262 GN=Actn_1 PE=4 SV=1)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 267/399 (66.92%), Postives = 332/399 (83.21%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQK TFTAWCNSHLRK  TAI  I EDFR+GL LM LLEVISGE+LPKPD+GKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++M+AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRP+LIDY  LSK+NP  NLNTAF++AEKYLDIPRML+ EDM N+  PDE ++M YVSSYYH F+GA KAETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  L +LQ++    S++ +Q   + +R YRR  KPPR+E+K KLE+++NTLQT+LRLSNRPA+MP EG ++SDI N WK LE++EK +E+WL+SEM R+E+L+HL + F+ + +THE W++GK EML+S  +++ +L
Sbjct:   34 WEKQQKKTFTAWCNSHLRKAGTAIENIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYHKLSKDNPLQNLNTAFDVAEKYLDIPRMLDPEDMTNTAMPDERAIMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTLPWLQSRQADNSLSGVQKRLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLEQSEKSFEDWLLSEMMRLERLEHLAQKFKAKADTHEDWTRGKEEMLQSSDFRQCKL 432          

HSP 2 Score: 192.971 bits (489), Expect = 0.000e+0
Identity = 98/259 (37.84%), Postives = 161/259 (62.16%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQM 3798
            ++++ D++   ++LE+ID + L++AK+ APF NW++  +EDL D  I+H ++E++ LI+   +FK ++ +A  E+N +  +   +        +     NPYT L    LS +W+++  L+P RD  LQ EL +Q  NE LR +F   +N++GPW++ +   V  +  G   S +E Q  QL+Q E ++  Y+    E++K  Q +Q+ MIFE    +++METLRV WEQL +S+ R+  E+ENQILTRDSKGI+Q Q+
Sbjct:  496 QKRRTDLDDAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTVEEIQGLIDAHGQFKATLSDADKEYNSIIGLVKDVESTVQKYQIPGGLQNPYTTLTSSDLSKKWSEVKHLVPQRDTTLQAELRKQQNNEMLRRQFAEKSNQVGPWIERQMDAVTAIGMGLQGS-LEDQLHQLKQYEQNVFAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNVNEVENQILTRDSKGITQEQL 753          

HSP 3 Score: 70.8626 bits (172), Expect = 0.000e+0
Identity = 33/73 (45.21%), Postives = 50/73 (68.49%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKS 3035
            ++  L++L+A+ KK EAFESD  AH  RV++I  IA EL  L YHD TS+N R   I ++W+ +  LT+K+++
Sbjct:  428 RQCKLNDLKALKKKHEAFESDLAAHQDRVEQIAAIAHELNTLEYHDSTSVNIRCQRICDQWDRLGSLTQKRRT 500          
BLAST of Alpha actinin vs. TrEMBL
Match: A0A2S2P092 (Alpha-actinin, sarcomeric OS=Schizaphis graminum OX=13262 GN=Actn_0 PE=4 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 267/403 (66.25%), Postives = 334/403 (82.88%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            ++  WEKQQK TFTAWCNSHLRK  TAI  I EDFR+GL LM LLEVISGE+LPKPD+GKMR HKIANVNK L FI  KGVKLV + AEEIVDGN+KMTLGMIWTIILRFAIQDI +++M+AKEGLLLWCQRKT+PY+NV V NFH+SFKDGLAFCALIHRHRP+LIDY  LSK+NP  NLNTAF++AEKYLDIPRML+ EDM N+  PDE ++M YVSSYYH F+GA KAETA+NRICKV+ VN+ENE L+  Y++LASDL+ WI+  L +LQ++    S++ +Q   + +R YRR  KPPR+E+K KLE+++NTLQT+LRLSNRPA+MP EG ++SDI N WK LE++EK +E+WL+SEM R+E+L+HL + F+ + +THE W++GK EML+S  +++ +L
Sbjct:   30 LDPAWEKQQKKTFTAWCNSHLRKAGTAIENIEEDFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVKLVSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYHKLSKDNPLQNLNTAFDVAEKYLDIPRMLDPEDMTNTAMPDERAIMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTLPWLQSRQADNSLSGVQKRLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDIANAWKGLEQSEKSFEDWLLSEMMRLERLEHLAQKFKAKADTHEDWTRGKEEMLQSSDFRQCKL 432          

HSP 2 Score: 360.147 bits (923), Expect = 0.000e+0
Identity = 177/404 (43.81%), Postives = 272/404 (67.33%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGN---GALDYKLFASSLYGHSDL 4221
            ++++ D++   ++LE+ID + L++AK+ APF NW++  +EDL D  I+H ++E++ LI+   +FK ++ +A  E+N +  +   +        +     NPYT L    LS +W+++  L+P RD  LQ EL +Q  NE LR +F   +N++GPW++ +   V  +  G   S +E Q  QL+Q E ++  Y+    E++K  Q +Q+ MIFE    +++METLRV WEQL +S+ R+  E+ENQILTRDSKGI+Q Q++EFR  FNHFDKN+T  L P+EFK+CLVS+G ++ K+ +GE +F +I+A VDP+ +G V F AF+D+M +E+T+ DT EQ++ SF++L  D+ YI ++ELRRELP ++AEYCI  MAPY +G N   GALDY  F+++LYG SDL
Sbjct:  496 QKRRTDLDDAEKILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTVEEIQGLIDAHGQFKATLSDADKEYNSIIGLVKDVESTVQKYQIPGGLQNPYTTLTSSDLSKKWSEVKHLVPQRDTTLQAELRKQQNNEMLRRQFAEKSNQVGPWIERQMDAVTAIGMGLQGS-LEDQLHQLKQYEQNVFAYKPHIEELEKIHQAVQEGMIFENRYTQYTMETLRVGWEQLLTSINRNVNEVENQILTRDSKGITQEQLNEFRASFNHFDKNRTGRLAPEEFKSCLVSIGYSIGKDRQGEIDFQRILAVVDPNSTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAGDKPYILSDELRRELPPDQAEYCIQRMAPY-KGVNAVPGALDYMSFSTALYGESDL 897          

HSP 3 Score: 70.8626 bits (172), Expect = 0.000e+0
Identity = 33/73 (45.21%), Postives = 50/73 (68.49%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKS 3035
            ++  L++L+A+ KK EAFESD  AH  RV++I  IA EL  L YHD TS+N R   I ++W+ +  LT+K+++
Sbjct:  428 RQCKLNDLKALKKKHEAFESDLAAHQDRVEQIAAIAHELNTLEYHDSTSVNIRCQRICDQWDRLGSLTQKRRT 500          
BLAST of Alpha actinin vs. Ensembl Cavefish
Match: actn3a (actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-9])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 259/400 (64.75%), Postives = 326/400 (81.50%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAFE+AEK+LDIP+ML+ +D+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+L+HL + F+ +C  HE+W+ GK ++L    Y+ + L+
Sbjct:   39 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFICSKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPKMLDADDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVAEQTMPAMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLEHLAEKFKQKCTLHESWTAGKEQLLSLKDYESASLM 438          

HSP 2 Score: 347.436 bits (890), Expect = 0.000e+0
Identity = 174/403 (43.18%), Postives = 269/403 (66.75%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGNG---ALDYKLFASSLYGHSDL 4221
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E      I ++I + A    +    +NPYT+++ + +S +W  +  L+P+RD+ LQ+E+++Q  NE+LR +F + AN +GPW+  K + ++H+S  D   ++E Q   L+Q E +I  Y+    +++   Q  Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VD + +GVVTF AFID+M +ET E DT EQ++ SFK+L  D+ YIT EELRRELP E+AEYCI+ M  +  G N    ALDY  F+S+LYG SDL
Sbjct:  501 QKRRDSLERVEKLWETIDQLFLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATMGIQNEILKIAQTYGIKLTGENPYTVISPQDISNKWEAVKQLVPMRDQMLQEEVARQQSNERLRRQFAAQANIIGPWIQTKMEEISHVSI-DIAGSLEEQMGNLKQYEQNIINYKSNIDKLEGDHQLSQEGLIFDNKHTNYTMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDANNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKTYITVEELRRELPPEQAEYCISRMTRFV-GVNAPADALDYISFSSALYGESDL 897          

HSP 3 Score: 77.0258 bits (188), Expect = 0.000e+0
Identity = 35/70 (50.00%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+YHD  +IN+R   I +EW+ +  LT+K++
Sbjct:  435 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAATINARCQGICDEWDNLGTLTQKRR 504          
BLAST of Alpha actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 260/417 (62.35%), Postives = 329/417 (78.90%), Query Frame = 2
Query: 1580 DCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            D  + +D+ ++   ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    ++  MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI+N W  LE  EK YEEWL++E++R+E+LDHL + FR +   HEAW++GK  ML    Y+   L
Sbjct:   20 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFITSKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTL 436          

HSP 2 Score: 355.91 bits (912), Expect = 0.000e+0
Identity = 174/391 (44.50%), Postives = 265/391 (67.77%), Query Frame = 1
Query: 3055 RLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +LLE IDQ+ L++AK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++  A  E   +  I ++I +     H+     NPYT +N   ++ +W+K+  L+P RD+ L +E ++Q  NE+LR +F + AN +GPW+  K + +  +S  +   T+E Q + L Q E  I  Y+    +++   Q++Q+ +IF+  +  ++ME +RV WEQL +++ R+  EIENQILTRD+KGISQ Q+ EFR  FNHFD+ +T  ++ ++F+ CL+S+G N+    GEAEF +IM+ VDP+R GVVTF AFID+M++ET + DT +Q++ SFKVL  D++YI A+ELRRELP ++A+YCI+ MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  511 KLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISI-ELHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRKRTGLMDGEDFRTCLISMGYNM----GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 896          

HSP 3 Score: 71.633 bits (174), Expect = 0.000e+0
Identity = 32/67 (47.76%), Postives = 47/67 (70.15%), Query Frame = 3
Query: 2829 LSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKK 3029
            LSE++A++KK EAFESD  AH  RV++I  IA EL  L Y+D  S+N+R   I ++W+ +  LT+K+
Sbjct:  436 LSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKR 502          
BLAST of Alpha actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 260/417 (62.35%), Postives = 329/417 (78.90%), Query Frame = 2
Query: 1580 DCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            D  + +D+ ++   ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    ++  MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI+N W  LE  EK YEEWL++E++R+E+LDHL + FR +   HEAW++GK  ML    Y+   L
Sbjct:   20 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFITSKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTL 436          

HSP 2 Score: 360.533 bits (924), Expect = 0.000e+0
Identity = 178/392 (45.41%), Postives = 268/392 (68.37%), Query Frame = 1
Query: 3055 RLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +LLE IDQ+ L++AK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++  A  E   +  I ++I +     H+     NPYT +N   ++ +W+K+  L+P RD+ L +E ++Q  NE+LR +F + AN +GPW+  K + +  +S  +   T+E Q + L Q E  I  Y+    +++   Q++Q+ +IF+  +  ++ME +RV WEQL +++ R+  EIENQILTRD+KGISQ Q+ EFR  FNHFD++ + TL  +EFKACL+SLG ++  + +GEAEF +IM+ VDP+R GVVTF AFID+M++ET + DT +Q++ SFKVL  D++YI A+ELRRELP ++A+YCI+ MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  511 KLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISI-ELHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 901          

HSP 3 Score: 71.633 bits (174), Expect = 0.000e+0
Identity = 32/67 (47.76%), Postives = 47/67 (70.15%), Query Frame = 3
Query: 2829 LSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKK 3029
            LSE++A++KK EAFESD  AH  RV++I  IA EL  L Y+D  S+N+R   I ++W+ +  LT+K+
Sbjct:  436 LSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKR 502          
BLAST of Alpha actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 260/417 (62.35%), Postives = 329/417 (78.90%), Query Frame = 2
Query: 1580 DCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            D  + +D+ ++   ++  WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    ++  MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI+N W  LE  EK YEEWL++E++R+E+LDHL + FR +   HEAW++GK  ML    Y+   L
Sbjct:   20 DYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFITSKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTL 436          

HSP 2 Score: 351.673 bits (901), Expect = 0.000e+0
Identity = 178/414 (43.00%), Postives = 267/414 (64.49%), Query Frame = 1
Query: 3055 RLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-----------------------GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +LLE IDQ+ L++AK+ APF NW+E A EDLQD+ I+H I+E++ L     +FK ++  A  E   +  I ++I +     H+     NPYT +N   ++ +W+K+  L+P RD+ L +E ++Q  NE+LR +F + AN +GPW+  K + +  +S  +   T+E Q + L Q E  I  Y+    +++   Q++Q+ +IF+  +  ++ME +RV WEQL +++ R+  EIENQILTRD+KGISQ Q+ EFR  FNHFD++ + TL  +EFKACL+SLG ++  +                        GEAEF +IM+ VDP+R GVVTF AFID+M++ET + DT +Q++ SFKVL  D++YI A+ELRRELP ++A+YCI+ MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  511 KLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISI-ELHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQKRTGLMDGEDFRTCLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 923          

HSP 3 Score: 71.633 bits (174), Expect = 0.000e+0
Identity = 32/67 (47.76%), Postives = 47/67 (70.15%), Query Frame = 3
Query: 2829 LSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKK 3029
            LSE++A++KK EAFESD  AH  RV++I  IA EL  L Y+D  S+N+R   I ++W+ +  LT+K+
Sbjct:  436 LSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKR 502          
BLAST of Alpha actinin vs. Ensembl Cavefish
Match: actn2b (alpha-actinin-2 [Source:NCBI gene;Acc:103024106])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 256/400 (64.00%), Postives = 326/400 (81.50%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPD+GKMR HKIANVNK L+FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLAFCALIHRHRP+LIDY  L+K++   NLN AFEIAEK+LDIP+ML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y++LAS+L+ WI+    +L+N+   +++ +MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LR+SNRPAFMP EG ++SDI + W+ LE+ EK YEEWL++E++R+++LDHL + FR +  +HE W+ GK E+L    Y+ + L+
Sbjct:   38 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALEFITSKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHVSWKDGLAFCALIHRHRPDLIDYAKLNKDDALGNLNLAFEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLGVNQENEKLMEEYERLASELLEWIRRTTPWLENRMSEKTMTQMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIASAWQGLEQAEKGYEEWLLTEIRRLQRLDHLAEKFRQKATSHETWATGKEEILTQKDYESASLM 437          

HSP 2 Score: 330.872 bits (847), Expect = 0.000e+0
Identity = 167/402 (41.54%), Postives = 260/402 (64.68%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E   +LLE ++Q+ L+YAK+ APF +W++ A EDLQD  I+H I+EV+ L+    +FK ++  A  E   +  I  ++++      +     NPY+ ++ E +  +W+K+  L+P RD  LQ+EL+QQ  NE+LR +F + AN +GPW+  + + +   S  +   T+E Q +QL+Q E  I  Y+    +++   Q +Q+++IF+  +  ++ME +RV WE L +++ R+  +IE QILTRD+KGIS  QM EFR  FNHFD+ K   +E  +F+ACL+S+G +L    GE EF +IM  VDP+  GVVTF +FID+M +ET + DT EQ++ SF++L  D+ YI  +ELRRELP ++AEYCI+ M PY  P    GALDY  F+++LYG SDL
Sbjct:  500 QKRREALERTEKLLETVEQLFLEYAKRSAPFNSWLDGAMEDLQDMFIVHTIEEVQSLMAAHEQFKATLPEADAERQAILGIQQEVQKIFHSYGIRGDLTNPYSTISPETILSKWDKVKKLVPQRDGALQEELAQQHGNERLRRQFAAQANLIGPWIQTRMEEIGRCSL-EIGGTLEDQMTQLKQYEHVIVSYKPNIDKLEGDHQLIQESLIFDNKHTNYTMEHIRVGWELLLTTIARTINDIETQILTRDAKGISPEQMKEFRSSFNHFDRKKNGAMETDDFRACLISMGYDL----GEVEFARIMMLVDPNACGVVTFQSFIDFMTRETADTDTAEQVVASFRILAADKPYILIDELRRELPRDQAEYCISRMPPYAGPGAMPGALDYTAFSTALYGESDL 896          

HSP 3 Score: 72.4034 bits (176), Expect = 0.000e+0
Identity = 33/70 (47.14%), Postives = 49/70 (70.00%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+++K EAFESD  AH  RV++I  IA EL  L+YHD+ S+N R   I + W+ +  LT+K++
Sbjct:  434 ASLMEVRAMLRKHEAFESDLSAHQDRVEQIAAIAQELNELDYHDVASVNQRCQSICDVWDHLGTLTQKRR 503          
BLAST of Alpha actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 249/393 (63.36%), Postives = 309/393 (78.63%), Query Frame = 2
Query: 1655 TFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV V NFH+S+KDGLAF ALIHRHRP+LIDY+ L K++P  NLN AFE+AEKYLDIP+ML+ ED+V + +PDE ++M YVS YYHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+ +ASDL++WI+ +  +L+N+    ++  MQ   + FR YRR  KPP+ +EK +LE  +NTLQT+LRL NRPAFMP EG ++SDI N W  LE+ EK YEEWL++E++R+E+LDHL + FR + + HEAW+ GK  ML+   Y    L 
Sbjct:    1 TFTAWCNSHLRKAGTGIENIDEDFRNGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNQENEKLMEDYEHMASDLLDWIR-RTPWLENRVPENTMQAMQGKLEGFRDYRRVHKPPKAQEKCQLEISFNTLQTKLRLMNRPAFMPSEGKMVSDIANGWSMLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHEAWTAGKEAMLEKRDYDSVSLT 392          

HSP 2 Score: 357.066 bits (915), Expect = 0.000e+0
Identity = 175/403 (43.42%), Postives = 276/403 (68.49%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +R+K  +E   ++LE IDQ+ L++AK+ APF  W++ A EDLQD  I+H IDE++ LI    +FK ++  A+ E + +  + ++I++ A   ++     NPY+ +    +S +W +++  +P+RD+ L+  L++Q  NE LR +F + AN +GPW+  K + + H+S  +   T+E Q +QL + E +I  Y+    +++   Q +Q+ +IF+  +  ++ME +RV WEQL +++ R+  E+E QILTRD+KGISQ QM EFR  FNHFDK+ +  L  +EFKACL+SLG ++  +++GEAEF +IM  VDP+ +G+VTF +FID+M +ETT+ DT +Q++ SFK+L  D+++ITA+ELRRELP ++AEYCIA MAPY  P+   GALDY  F+++LYG SDL
Sbjct:  455 QRRKDTLERTEKVLETIDQLYLEFAKRAAPFNTWMDGAVEDLQDMFIVHTIDEIQGLISAHEQFKDTLPEAEKEKSAILGVHNEIQKVAQTYNVKLAGPNPYSAITPHDISSKWERMTQQVPLRDDSLRDLLARQQANETLRRQFAASANIVGPWIQTKMEEIGHISI-EMHGTLEDQLNQLRRYEQNIINYKPNIDKLESEYQLVQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVETQILTRDAKGISQEQMHEFRASFNHFDKDHSGKLGAEEFKACLISLGYDVGNDQQGEAEFARIMTVVDPNNTGLVTFQSFIDFMTRETTDTDTADQVIASFKILAGDKNFITADELRRELPPDQAEYCIARMAPYRGPDAVPGALDYMSFSTALYGESDL 856          

HSP 3 Score: 73.9442 bits (180), Expect = 0.000e+0
Identity = 33/69 (47.83%), Postives = 50/69 (72.46%), Query Frame = 3
Query: 2826 NLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            +L+EL+A+++K EAFESD  AH  RV++I  IA EL  L+YHD+ S+N+R   I  EW+ +  LT+++K
Sbjct:  390 SLTELKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRK 458          
BLAST of Alpha actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 518.079 bits (1333), Expect = 2.555e-170
Identity = 245/393 (62.34%), Postives = 300/393 (76.34%), Query Frame = 2
Query: 1655 TFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVIS E LPKP+KGKMRVHKI NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI I++ SAKEGLLLWCQRKT+PY+NV V NFH S+KDGLAF ALIHRHRP+LIDY  L K++P  NLN AFE+AEKYLDIP+ML+ ED+VN+ +PDE ++M YVS YYHAF+GA KAETA+NRICKV+ VN E   L     +    L+ WI   +  L+++N   ++  MQ   ++FR YRR  KPP+  +K +LE ++NTLQT+LRL NRPAFMP EG L+SDI N W  LE+ EK YEEWL++E++R+E+LDHL + FR + + H++W++GK +ML+   Y+   L 
Sbjct:    5 TFTAWCNSHLRKAGTQIDSIDEDFRDGLKLMLLLEVISSERLPKPEKGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISIENTSAKEGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNHERVDLSCACVRARLQLLEWINRTIPVLEDRNTQNNMPAMQGKLEDFRDYRRVHKPPKAGDKCQLEINFNTLQTKLRLMNRPAFMPSEGKLVSDIGNAWSHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHKSWTEGKQQMLQQKDYESVSLA 397          

HSP 2 Score: 72.4034 bits (176), Expect = 2.555e-170
Identity = 33/69 (47.83%), Postives = 49/69 (71.01%), Query Frame = 3
Query: 2826 NLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            +L+EL+A++KK EAFESD  AH  RV++I  IA EL  LNYHD+ S+N++   I +EW+ +   T+ +K
Sbjct:  395 SLAELKALLKKHEAFESDLAAHQDRVEQIAAIAQELNDLNYHDVASVNTKCKEICDEWDDLGEWTQTRK 463          

HSP 3 Score: 50.8322 bits (120), Expect = 2.555e-170
Identity = 21/41 (51.22%), Postives = 30/41 (73.17%), Query Frame = 1
Query: 3055 RLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYID 3177
            ++LE ID + L++AK+ APF  W++ A EDLQD  I+H ID
Sbjct:  471 KVLETIDHLYLEFAKRAAPFNTWMDGAAEDLQDMFIVHTID 511          
BLAST of Alpha actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004049.1 (pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1 gene:ENSPMAG00000003699.1 transcript:ENSPMAT00000004049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 354.369 bits (908), Expect = 3.281e-106
Identity = 179/386 (46.37%), Postives = 247/386 (63.99%), Query Frame = 2
Query: 1637 EKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDD------MSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAW 2776
            E+ QK TFT W NSHL +V+  I  +  D RDG  L+KLLEV+SGE LPKP KGKMR+H + NV K LQF++E+ V L  + + +IVDGN ++TLG+IWTIILRF IQDI ++        SAK+ LLLWCQ KT+ Y NVRV+NF  S++DGLAF ALIH+HRP+LID+ +L   +P  N+ TAF +AE+ L + ++L+ ED+     PDE SV+ YV +YYH F+          RI KV+    E + +I  YD LASDL++WI+  +  L N+    S+  +Q     F  YR  +KP +  EKG LE    T+Q+R+R +N+  F+P EG LIS+IN  W+ LE+ E + E  L  E+ R E+L+ L + F  +    E+W
Sbjct:    5 EEVQKKTFTKWVNSHLSRVSCRIGDLYADLRDGRMLIKLLEVLSGERLPKPTKGKMRIHCLENVEKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDSREVKSAKDALLLWCQMKTAGYPNVRVHNFTTSWRDGLAFNALIHKHRPDLIDFDALDPADPYGNMQTAFNVAEQKLGLTQLLDAEDIAVE-HPDEKSVITYVVTYYHYFSKMKALAVEGKRIGKVLESAMETDQMIEKYDSLASDLLDWIEQTIAILNNRTFANSLTGVQQQLQAFSSYRTVEKPAKFTEKGNLEVLLFTIQSRMRANNQKVFLPGEGKLISEINKAWERLEKAEHERELALREELIRQEKLEQLARRFDRKAAMRESW 389          

HSP 2 Score: 50.8322 bits (120), Expect = 3.281e-106
Identity = 28/91 (30.77%), Postives = 48/91 (52.75%), Query Frame = 3
Query: 2793 KC*NLTVTKKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKSRH*SNPSFIR 3065
            +C  L     ++L+ + A  KK EA E+D  A+  RV  +  +A ELQ  NYHD+  + +R D +   W  ++ L   +++R  +N +  R
Sbjct:  394 QCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQR 484          
BLAST of Alpha actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 338.191 bits (866), Expect = 5.930e-101
Identity = 169/399 (42.36%), Postives = 253/399 (63.41%), Query Frame = 2
Query: 1637 EKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDD------MSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSY 2815
            E  QK TFT W NSHL +V+  I+ +  D RDG  L+KLLEV+SGE LPKP +GKMR+H + NV+K LQF++E+ V L  + + +IVDGN ++ LG+IWTIILRF IQDI ++        SAK+ LLLWCQ KT+ Y+NV ++NF  S++DGLAF A++H+HRP+LI++  L K N  HNL  AF IAE+ L + ++L+ ED ++  +PDE S++ YV +YYH F+          RI KV+    E + +I+ Y+ LAS+L+ WI+  +  L N+    S+  +Q     F  YR  +KP +  EKG LE    T+Q+++R +N+  + P+EG L+++IN  W+ LE+ E + E  L +E+ R E+L+ L + F  +    E W      ++  D++
Sbjct:   56 EAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGEKLPKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPED-ISVDQPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLESAIETDQMIDKYETLASELLEWIEQTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVNEINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSENQRLVTQDNF 453          

HSP 2 Score: 49.6766 bits (117), Expect = 5.930e-101
Identity = 27/80 (33.75%), Postives = 45/80 (56.25%), Query Frame = 3
Query: 2826 NLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKSRH*SNPSFIR 3065
            +L  + A  KK EA E+D  A+  RVQ + D+A EL+  +YH++  + SR D +   WE ++ L   ++ R  +N +  R
Sbjct:  456 DLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQR 535          
BLAST of Alpha actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001834.1 (pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1 gene:ENSPMAG00000001663.1 transcript:ENSPMAT00000001834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 287.345 bits (734), Expect = 2.587e-84
Identity = 142/351 (40.46%), Postives = 217/351 (61.82%), Query Frame = 2
Query: 1781 PKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKI------DDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSY 2815
            PKP +GKMR+H + NV+K LQF++E+ V L  + + +IVDGN ++ LG+IWTIILRF IQDI +      +  SAK+ LLLWCQ KT+ Y NV V+NF  S++DGLAF A+IH+HRP+L+D++ L K N  HNL  AF  AE++L + ++L+ E  V+  +PDE S++ YV S+YH F+          RI KV+    E + ++  Y+ LAS+L+ WI   +  L +++   S+  +Q     F  YR  +KPP+  EKG LE    T+Q+++R +N+  + P+EG L+++IN  W+ LE+ E   E  L  E+ R E+L+ L + F  +    E W      ++  D++
Sbjct:    1 PKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVQTEDSKETRSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAVIHKHRPDLVDFEKLKKSNAQHNLQHAFNAAEQHLGVTKLLDPEADVSVDQPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDSAIEADRMVERYESLASELLEWIGRTITALNSRDFPNSLVGVQQQLHAFSSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVAEINRAWERLEKAEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVMQDNF 351          

HSP 2 Score: 45.0542 bits (105), Expect = 2.587e-84
Identity = 22/72 (30.56%), Postives = 40/72 (55.56%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKSR 3038
            A+L+ + A  KK EA E+D  A+  RV+ +  +A EL+   YH++  +  R D +   W  ++ L   +++R
Sbjct:  353 ADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTR 424          
BLAST of Alpha actinin vs. Ensembl Yeast
Match: GPA2 (Nucleotide binding alpha subunit of the heterotrimeric G protein; interacts with the receptor Gpr1p, has signaling role in response to nutrients; required for the recruitment of Ras-GTP at the plasma membrane and in the nucleus [Source:SGD;Acc:S000000822])

HSP 1 Score: 207.994 bits (528), Expect = 1.261e-58
Identity = 125/346 (36.13%), Postives = 187/346 (54.05%), Query Frame = -3
Query:  303 RLLLLGAGESGKSTIVKQMRILHIDGFSNEEKKQKAEDIRKNL----RDAILTITSAMSNINPPTKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGV--LETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDK-VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYLRYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTCAVDTENIRRVFNDCKDIIQRMHLRQYELL 1319
            ++LLLGAGESGKST+++Q++ILH +GFS +E K+    I +NL    R+ I   T    N+ P  +L   +  + + Y     +    ++P +     + LWA      L     ++++ L+D   YF++    +   NY PT+QDILR R +TSGIF+T   +   +  H++DVGGQR ER+KWI CF++VT +IF  + S Y+  L ED +QNR +ESL L  +I N+RW    SV+LFLNK D+  EK+   K  +E+YFPDY                 ++  +A  +    F+++    N      Y H T A DT NIR VF   K+ I    L+   +L
Sbjct:  125 KVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNVNLEPECELTQQDLSRTMSY--EMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASKFYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKL--SKVPMENYFPDY--------------TGGSDINKAAKYILWRFVQL----NRANLSIYPHVTQATDTSNIRLVFAAIKETILENTLKDSGVL 448          
BLAST of Alpha actinin vs. Ensembl Yeast
Match: GPA1 (Subunit of the G protein involved in pheromone response; GTP-binding alpha subunit of the heterotrimeric G protein; negatively regulates the mating pathway by sequestering G(beta)gamma and by triggering an adaptive response; activates Vps34p at the endosome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001047])

HSP 1 Score: 161.384 bits (407), Expect = 1.400e-42
Identity = 91/244 (37.30%), Postives = 135/244 (55.33%), Query Frame = -3
Query:  303 LWA-DKGVLETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYLRYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTCAVDTENIRRVFNDCKDIIQRMHLRQYELL 1031
            LW  DKG+ + + RSNE+QL   A Y+ D        NY  T++DIL+ R+ T+GI ET+F +    F + D GGQR ER+KWI CF  +TA++FV A S Y+ +L ED   NR+ ES+ L  ++ N++W ++   ILFLNK D+ +EKV +    I  YFPDY              + +AE    KY     F KI  + N      Y   TCA DT+ ++ V +   D+I + +L++  ++
Sbjct:  248 LWNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRIKTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVKS--MPIRKYFPDY-----------QGRVGDAE-AGLKY-----FEKIFLSLNKTNKPIYVKRTCATDTQTMKFVLSAVTDLIIQQNLKKIGII 472          

HSP 2 Score: 53.5286 bits (127), Expect = 1.556e-7
Identity = 25/43 (58.14%), Postives = 36/43 (83.72%), Query Frame = -3
Query: 1203 KSTHRLLLLGAGESGKSTIVKQMRILHIDGFSNEEKKQKAEDI 1331
            K+  +LLLLGAGESGKST++KQ+++LH  GFS++E+ Q A+ I
Sbjct:   39 KNEIKLLLLGAGESGKSTVLKQLKLLHQGGFSHQERLQYAQVI 81          
BLAST of Alpha actinin vs. Ensembl Yeast
Match: CMD1 (Calmodulin; Ca2+ binding protein that regulates Ca2+ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca2+ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin; binds to the Hog1p MAPK in response to hyperosmotic stress; potentiates membrane tubulation and constriction mediated by the Rvs161p-Rvs167p complex; human CALM1 or CALM2 functionally complement repression induced inviability [Source:SGD;Acc:S000000313])

HSP 1 Score: 56.225 bits (134), Expect = 1.458e-9
Identity = 41/150 (27.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query: 3772 SKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRD-YITAEELRRELPS-----EEAEYCIANMAPYPEGGNGALDYKLFASSL 4203
            S  +++ Q+ EF+  F  FDK+   ++   E    + SLG +      EAE   +M E+D   +  + F  F+  M+++    D+ +++L++FKV  ++ D  I+A EL+  L S      +AE  + +M      G+G ++ + FA+ L
Sbjct:    2 SSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLS----PSEAEVNDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDAE--VDDMLREVSDGSGEINIQQFAALL 145          
BLAST of Alpha actinin vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 50.8322 bits (120), Expect = 1.954e-7
Identity = 31/99 (31.31%), Postives = 51/99 (51.52%), Query Frame = -3
Query:  600 LRCRVLTSGIFETKFTVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDV 896
            ++    T G      T   V F+M+DVGGQ+  R  W   F   TA+IFV           + +++NR+ E+ E L SI   + + N+ ++++ NKQD+
Sbjct:   42 IKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVI----------DSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDL 130          
BLAST of Alpha actinin vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 52.373 bits (124), Expect = 4.218e-7
Identity = 48/202 (23.76%), Postives = 88/202 (43.56%), Query Frame = 2
Query: 1640 KQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESL------PKPDKGK--MRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKE----GLLLWCQRK-TSPYRNVRVNNFH-MSFKDGLAFCALIHRHRPELIDYKSLSKENPAH----NLNTAFEIAEK 2191
            +++   FT W NS    V+  +  + +D +DGL L++  E +   ++       +P  G    R   + N N  +   + KG  LV +   +IVDGN  +TLG++W ++ R     +K    S ++     +L W Q + T   +N  + +F   +  +      +++   P  +DY  ++  N       N   A  IA K
Sbjct:  411 EREARVFTLWLNS--LDVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNISITMKTLSSSGRDMSDSQILKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIARK 610          
BLAST of Alpha actinin vs. Ensembl Nematostella
Match: EDO49193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA6])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 262/346 (75.72%), Postives = 292/346 (84.39%), Query Frame = -3
Query:  303 SFKSTHRLLLLGAGESGKSTIVKQMRILH-IDGFSNEEKKQKAEDIRKNLRDAILTITSAMSNINPPTKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGVLETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYLRYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTCAVDTENIRRVFNDCKDIIQRMHLRQYELL 1337
            ++++THRLLLLGAGESGKSTIVKQMRILH + GF+  EK+QK EDI+KN+RDAILTIT AMS + PP KL NP NQ  LDY+   A+ PDF YP EFYE+  +LW D GVLE YERSNEYQLIDCA+YFLD+   + QQ+Y PTEQD+LRCRVLTSGI ET+F VD+V FHMFDVGGQRDERRKWIQCFNDVTAIIFV ACSSYN+VLREDASQNRL+ESLEL KSIWNNRWLR ISVILFLNKQD+LK+KV AGKSKIEDYFPD+ RY  P D       EEA  TRAKYF RDEFL+I+T   DG+HYCY HFTCAVDTENIRRVFNDC+DIIQRMHLRQYELL
Sbjct:   36 AYRATHRLLLLGAGESGKSTIVKQMRILHDVHGFTELEKRQKIEDIKKNIRDAILTITGAMSTLTPPVKLANPNNQFRLDYVHEVATAPDFDYPPEFYEHTKILWQDAGVLECYERSNEYQLIDCAQYFLDRVDTIQQQDYLPTEQDLLRCRVLTSGIIETRFEVDRVKFHMFDVGGQRDERRKWIQCFNDVTAIIFVVACSSYNLVLREDASQNRLKESLELFKSIWNNRWLRTISVILFLNKQDLLKDKVRAGKSKIEDYFPDFARYRTPPDATAEPGDEEA-VTRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL 380          
BLAST of Alpha actinin vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 245/404 (60.64%), Postives = 319/404 (78.96%), Query Frame = 2
Query: 1622 IEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            ++  WE+QQK TFTAWCNSHLRK    I  I ED RDG+ L++LLE+ISGE LP P++GK+R H+IANVNK L F+  KGVKLV V AEEIVDGN+KMTLGMIWTIILRFAIQDI I+D  AK+GLLLWCQRKT+PY+NV V NF  SFKDGLAFCALIHRHRP+LIDY SL KE+P +NLN AF++AE+YLDIPRML+ EDMV + +PDE +VM YVSSYYHAF  + +A+TA+ RI KV+ +NR+NE ++  Y++LASDL++WI   + +L +++   ++ +MQ   D  R YR+ +KPP++EEKG+LE+++NTLQT+LRLSNRPA++P EG +I+DIN+ W  LE  EKD+E+WL+ EM+R+E+LDHL + FR +C  HE+W+ GK  +L  D Y  + L 
Sbjct:   21 LDPAWERQQKKTFTAWCNSHLRKTGKQIGEIEEDLRDGVLLLQLLEIISGERLPHPERGKLRFHRIANVNKALDFVAGKGVKLVSVGAEEIVDGNLKMTLGMIWTIILRFAIQDIAIEDSFAKDGLLLWCQRKTAPYKNVSVKNFTTSFKDGLAFCALIHRHRPDLIDYDSLRKEDPLYNLNKAFDVAEQYLDIPRMLDPEDMVETERPDERAVMTYVSSYYHAFTSSQQADTAAKRIGKVLNINRDNERMMEDYERLASDLLDWINKTMPWLTSRDTDGTLKDMQRKLDELRNYRKGEKPPKVEEKGQLETNFNTLQTKLRLSNRPAYLPSEGKMINDINDAWGGLEMAEKDFEDWLLMEMRRMERLDHLAEKFRHKCNIHESWTNGKDAVLSKDDYSDATLA 424          

HSP 2 Score: 345.125 bits (884), Expect = 0.000e+0
Identity = 185/423 (43.74%), Postives = 273/423 (64.54%), Query Frame = 1
Query: 3046 VIHRL---------LEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVE---------------WNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWL---DEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKE-EKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGN---GALDYKLFASSLYGHSDL 4221
             +HRL         L+ +DQ++L++AKK APF NW+E A+EDL D   +H ++E++ L++    FK++M  A+ E+N +  I  +I   +         +NPYT L++E   +                WN++  L+P RD  L+ E S+Q RNE+LR +F + AN +GPW+    EK + +     G    ++E     L+ LE  I+ Y+    E++  +QE+QQ +IFE P+ +++ME +RV WEQL +++ R+  E+ENQILTRDSKGI++ QM EFR  FN FDK++T  LEP EFK CLVSLG N+KE +KG+ EF +++  VDP+ +G VTF AF+D+M +ET + DT EQ+++SF++L  D+ +ITAEELRRELP ++AEYCIA MAPY EG +   GALDY  F+++LYG SDL
Sbjct:  486 TMHRLQKLEDAQQRLQSLDQLRLEFAKKAAPFNNWLESAREDLMDMFSVHTVEEIQELLDAHEAFKENMPAAQAEYNSIMDIAVQIESLSG-------QENPYTSLSKEASPITDMLFTFVFVCDINEGWNQVVDLVPKRDILLRDERSKQDRNERLRVEFANKANVVGPWIQQQGEKLRTIGFHMEG----SLEKNLQVLQDLETFITSYKPNIEELEVINQEVQQALIFENPHTKYTMEAMRVGWEQLLTAIARNINEVENQILTRDSKGITEEQMKEFRASFNFFDKDQTGKLEPNEFKQCLVSLGYNIKEGDKGDREFERLLGIVDPNGTGKVTFQAFVDFMTRETADSDTAEQVMESFRILAGDKPFITAEELRRELPPDQAEYCIARMAPY-EGKDAVPGALDYMSFSTALYGESDL 896          

HSP 3 Score: 58.151 bits (139), Expect = 0.000e+0
Identity = 29/66 (43.94%), Postives = 41/66 (62.12%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLT 3020
            A L+++ A+MKK EAFESD  AH  RV +I  IA EL  L Y  +  +N+R   I ++W+ +  LT
Sbjct:  421 ATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELT 486          
BLAST of Alpha actinin vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 340.887 bits (873), Expect = 2.723e-101
Identity = 178/398 (44.72%), Postives = 251/398 (63.07%), Query Frame = 2
Query: 1637 EKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDD-----MSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSY 2815
            E+ QK TFT W NSHL++V   ++ +  D +DG  L+ LLEV+SGE LPKP KG+MR+H + NV K L F++++ V L  V A +IVDGN K+TLG+IWTIILRF IQDI I+       SAK+ LLLWCQ KT  Y +V + NF  S++DGLAF A+IHRHRP+LI+++ L+K +   NL  AFE+AE  L I  +L+ ED VN   PDE S++ YV++YYH FA     E + +RI KVI   +ENE LI  Y+KLASDL+ WI+ K+  L  +    ++  +Q     F +YR  +KPPR  EKG LE     L +++R +++  ++P EG  + DIN  W+ LE++E + E  L  E+ R E+L+ L   F  +    E W      ++  D++
Sbjct:   23 ERVQKKTFTKWINSHLQRVGARVNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRMRIHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITIEGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAED-VNVDFPDEKSILTYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYEKLASDLLEWIEIKIIQLGEREFANTLLGVQQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMIDINRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNF 419          

HSP 2 Score: 48.9062 bits (115), Expect = 2.723e-101
Identity = 27/71 (38.03%), Postives = 40/71 (56.34%), Query Frame = 3
Query: 2826 NLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKKSR 3038
            +L+ + A  KK EA E+D +A+  RV  I  +A EL R NYHD   I      I   WE++ VL ++++ R
Sbjct:  422 DLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVR 492          
BLAST of Alpha actinin vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 307.375 bits (786), Expect = 7.550e-89
Identity = 165/391 (42.20%), Postives = 239/391 (61.13%), Query Frame = 2
Query: 1646 QKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKI-DDMS-----AKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEML 2800
            QK TFT W NS L K    ++ + ED  DG  L+ LLE+ISGE +    +GK RVH I NVNK L+F+Q K VKL  + AE++VDGN ++ LG+IW IILRF I DI   DDMS     AKE LLLWCQR T  Y  V + NF  S+++GLAF AL+H+HRP+LIDY +L       NLN AF +A + L I R+L+ ED V+  +PD+ SVM YV++YY  FA     ET   RI K+I V  E E +  +Y+ + SDL++WI SK+  L  +   +++  +Q     F+ +R  +KPP+  E+  +E+    LQT+ + +N+  F P EG L+ DIN  W+ +E  E +  + L +E+ R + L+ + + F+ + +  E+W    V+++
Sbjct:   25 QKKTFTKWVNSFLDKSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFLQ-KSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAED-VDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITEL-ARPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQVMESAEHERAQALRNELIRQQMLEKMAEKFQRKADLRESWLDDMVQVI 412          
BLAST of Alpha actinin vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 292.352 bits (747), Expect = 1.683e-88
Identity = 158/345 (45.80%), Postives = 217/345 (62.90%), Query Frame = 2
Query: 1646 QKSTFTAWCNSHLRKVNTAISV--IGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKI-DDMS-----AKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWK 2656
            QK TFT W NS L KV + + V  + ED  DG  L+ LLE+ISGE +    +GK RVH I NVNK L+F+Q K VKL  + AE++VDGN ++ LG+IW IILRF I DI   DDMS     AKE LLLWCQR T  Y +V + NF  S+++GLAF AL+H+HRP+LIDY +L       NLN AF +AE+ L I R+L+ ED V+  +PD+ SVM YV++YY  FA     ET   RI K+I V  E E +  +Y+ + SDL++WI SK+  L  +   +++  +Q     F+ +R  +KPP+  E+  +E+    LQT+ + +N+  F P EG L+ DIN  W+
Sbjct:   25 QKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFLQ-KSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAED-VDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELA-RPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQ 366          
BLAST of Alpha actinin vs. Ensembl Medaka
Match: actn3b (actinin alpha 3 [Source:NCBI gene;Acc:101158802])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 264/400 (66.00%), Postives = 326/400 (81.50%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAFE+AEK+LDIPRML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+LDHL + F+ +C  HEAW+ GK ++L    Y+ + L+
Sbjct:   40 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFICSKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPRMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFKQKCAMHEAWTSGKEDLLSQKDYESASLM 439          

HSP 2 Score: 278.87 bits (712), Expect = 0.000e+0
Identity = 140/338 (41.42%), Postives = 225/338 (66.57%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQ 4035
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E      I ++I + A    +     NPYT L+ + +S +W+ +  L+P+RD+ LQ+E+++Q  NE+LR +F + AN +GPW+  K + ++H+S  D   ++E Q + L+Q E +I  Y+    +++   Q  Q+++IF+  +  +SME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ
Sbjct:  502 QKRRDALERVEKLWETIDQLYLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATLGIHNEILKIAQTYGIKLSGINPYTNLSPQDISNKWDTVKHLVPLRDQMLQEEVARQQANERLRRQFAAQANIIGPWIQTKMEEISHVSV-DIAGSLEEQMNSLKQYEQNIINYKSNIDKLEGDHQLSQESLIFDNKHTNYSMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQ 834          

HSP 3 Score: 76.2554 bits (186), Expect = 0.000e+0
Identity = 34/70 (48.57%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+YHD  S+N+R   I ++W+ +  LT+K++
Sbjct:  436 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNARCQGICDQWDNLGTLTQKRR 505          
BLAST of Alpha actinin vs. Ensembl Medaka
Match: actn3b (actinin alpha 3 [Source:NCBI gene;Acc:101158802])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 264/400 (66.00%), Postives = 326/400 (81.50%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAFE+AEK+LDIPRML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+LDHL + F+ +C  HEAW+ GK ++L    Y+ + L+
Sbjct:   40 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFICSKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPRMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFKQKCAMHEAWTSGKEDLLSQKDYESASLM 439          

HSP 2 Score: 357.066 bits (915), Expect = 0.000e+0
Identity = 177/402 (44.03%), Postives = 273/402 (67.91%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E      I ++I + A    +     NPYT L+ + +S +W+ +  L+P+RD+ LQ+E+++Q  NE+LR +F + AN +GPW+  K + ++H+S  D   ++E Q + L+Q E +I  Y+    +++   Q  Q+++IF+  +  +SME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D++YIT +ELRRELP E+AEYCI+ M  Y  P+   GALDY  F+S+LYG SDL
Sbjct:  502 QKRRDALERVEKLWETIDQLYLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATLGIHNEILKIAQTYGIKLSGINPYTNLSPQDISNKWDTVKHLVPLRDQMLQEEVARQQANERLRRQFAAQANIIGPWIQTKMEEISHVSV-DIAGSLEEQMNSLKQYEQNIINYKSNIDKLEGDHQLSQESLIFDNKHTNYSMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKNYITVDELRRELPPEQAEYCISRMTRYVGPDAPPGALDYISFSSALYGESDL 898          

HSP 3 Score: 76.2554 bits (186), Expect = 0.000e+0
Identity = 34/70 (48.57%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+YHD  S+N+R   I ++W+ +  LT+K++
Sbjct:  436 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNARCQGICDQWDNLGTLTQKRR 505          
BLAST of Alpha actinin vs. Ensembl Medaka
Match: actn3b (actinin alpha 3 [Source:NCBI gene;Acc:101158802])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 264/400 (66.00%), Postives = 326/400 (81.50%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV 2833
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFR+GL LM LLEVISGE LPKPDKGKMR HKIANVNK L FI  KGVKLV + AEEIVDGNVKMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PYRNV V NFH+S+KDGLA CALIHRHRP+LIDY  L K++P  NLNTAFE+AEK+LDIPRML+ ED+VN+ KPDE ++M YVS +YHAFAGA +AETA+NRICKV+ VN+ENE L+  Y+KLAS+L+ WI+  + +L+N+   +++  MQ   ++FR YRR  KPPR++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDI N WK LE+ EK YEEWL++E++R+E+LDHL + F+ +C  HEAW+ GK ++L    Y+ + L+
Sbjct:   40 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFICSKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPRMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFKQKCAMHEAWTSGKEDLLSQKDYESASLM 439          

HSP 2 Score: 357.066 bits (915), Expect = 0.000e+0
Identity = 177/402 (44.03%), Postives = 273/402 (67.91%), Query Frame = 1
Query: 3022 KRKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            ++++  +E + +L E IDQ+ L++AK+ APF NW++ A EDLQD  I+H I+E++ LI   ++FK ++  A  E      I ++I + A    +     NPYT L+ + +S +W+ +  L+P+RD+ LQ+E+++Q  NE+LR +F + AN +GPW+  K + ++H+S  D   ++E Q + L+Q E +I  Y+    +++   Q  Q+++IF+  +  +SME +RV WEQL +++ R+  E+ENQILTRD+KGISQ Q++EFR  FNHFD+ +   ++P +F+ACL+S+G +L    GE EF +IM  VDP+ +GVVTF AFID+M +ET E DT EQ++ SFK+L  D++YIT +ELRRELP E+AEYCI+ M  Y  P+   GALDY  F+S+LYG SDL
Sbjct:  502 QKRRDALERVEKLWETIDQLYLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATLGIHNEILKIAQTYGIKLSGINPYTNLSPQDISNKWDTVKHLVPLRDQMLQEEVARQQANERLRRQFAAQANIIGPWIQTKMEEISHVSV-DIAGSLEEQMNSLKQYEQNIINYKSNIDKLEGDHQLSQESLIFDNKHTNYSMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKNYITVDELRRELPPEQAEYCISRMTRYVGPDAPPGALDYISFSSALYGESDL 898          

HSP 3 Score: 76.2554 bits (186), Expect = 0.000e+0
Identity = 34/70 (48.57%), Postives = 50/70 (71.43%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            A+L E+RA+M+K EAFESD  AH  RV++I  IA EL  L+YHD  S+N+R   I ++W+ +  LT+K++
Sbjct:  436 ASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNARCQGICDQWDNLGTLTQKRR 505          
BLAST of Alpha actinin vs. Ensembl Medaka
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:101169077])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 260/399 (65.16%), Postives = 323/399 (80.95%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    ++  MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W  LE  EK YEEWL++E++R+E+LDHL + FR +   HEAW++GK EML+   Y+ + L
Sbjct:   27 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRMPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEEMLQRRDYETATL 425          

HSP 2 Score: 363.229 bits (931), Expect = 0.000e+0
Identity = 179/392 (45.66%), Postives = 268/392 (68.37%), Query Frame = 1
Query: 3055 RLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNL-KEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +LLE IDQ+ L++AK+ APF NW+E A EDLQDS I+H I+E++ L     +FK ++  A  E   +  I ++I +     H+     NPYT +N + ++ +W+K+  L+P+RD+ L +E ++Q  NE+LR +F + AN +GPW+  K + +  +S  +   T+E Q + L Q E  I  Y+    +++   Q +Q  +IF+  +  ++ME +RV WEQL +++ R+  EIENQILTRD+KGISQ Q++EFR  FNHFD++ + TL  +EFKACL+SLG ++  + +GE EF +IM+ VDP+R GVVTF  FID+M++ET + DT +Q++ SFK+L  D++YI A+ELRRELP ++AEYCIA MAPY  P+G  GALDY  F+++LYG SDL
Sbjct:  500 KLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDSFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGSNPYTTINPQEVNAKWDKVRQLVPLRDQSLIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISI-EMHGTLEDQLTHLRQYEKSIINYKPKIDQLEGDHQLIQAALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQGENEFSRIMSVVDPNRMGVVTFQGFIDFMSRETADTDTADQVMASFKILAGDKNYILADELRRELPPDQAEYCIARMAPYSGPDGVPGALDYMSFSTALYGESDL 890          

HSP 3 Score: 71.633 bits (174), Expect = 0.000e+0
Identity = 32/69 (46.38%), Postives = 49/69 (71.01%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKK 3029
            A LSE++A++KK EAFESD  AH  RV++I  IA EL  L+Y+D  S+N+R   I ++W+ +  L++K+
Sbjct:  423 ATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRICDQWDALGALSQKR 491          
BLAST of Alpha actinin vs. Ensembl Medaka
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:101169077])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 260/399 (65.16%), Postives = 323/399 (80.95%), Query Frame = 2
Query: 1634 WEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQL 2830
            WEKQQ+ TFTAWCNSHLRK  T I  I EDFRDGL LM LLEVISGE L KP++GKMRVHKI+NVNK L FI  KGVKLV + AEEIVDGN KMTLGMIWTIILRFAIQDI +++ SAKEGLLLWCQRKT+PY+NV + NFH+S+KDGL FCALIHRHRPELIDY  L K++P  NLNTAF++AEKYLDIP+ML+ ED+V + +PDE ++M YVSS+YHAF+GA KAETA+NRICKV+ VN+ENE L+  Y+KLASDL+ WI+  + +L+N+    ++  MQ   ++FR YRR  KPP+++EK +LE ++NTLQT+LRLSNRPAFMP EG ++SDINN W  LE  EK YEEWL++E++R+E+LDHL + FR +   HEAW++GK EML+   Y+ + L
Sbjct:   27 WEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALNFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRMPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEEMLQRRDYETATL 425          

HSP 2 Score: 354.755 bits (909), Expect = 0.000e+0
Identity = 179/414 (43.24%), Postives = 267/414 (64.49%), Query Frame = 1
Query: 3055 RLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK-----------------------GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +LLE IDQ+ L++AK+ APF NW+E A EDLQDS I+H I+E++ L     +FK ++  A  E   +  I ++I +     H+     NPYT +N + ++ +W+K+  L+P+RD+ L +E ++Q  NE+LR +F + AN +GPW+  K + +  +S  +   T+E Q + L Q E  I  Y+    +++   Q +Q  +IF+  +  ++ME +RV WEQL +++ R+  EIENQILTRD+KGISQ Q++EFR  FNHFD++ + TL  +EFKACL+SLG ++  +                        GE EF +IM+ VDP+R GVVTF  FID+M++ET + DT +Q++ SFK+L  D++YI A+ELRRELP ++AEYCIA MAPY  P+G  GALDY  F+++LYG SDL
Sbjct:  500 KLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDSFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGSNPYTTINPQEVNAKWDKVRQLVPLRDQSLIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISI-EMHGTLEDQLTHLRQYEKSIINYKPKIDQLEGDHQLIQAALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQKRTGIMDAEDFKTCLISMGYNLGENEFSRIMSVVDPNRMGVVTFQGFIDFMSRETADTDTADQVMASFKILAGDKNYILADELRRELPPDQAEYCIARMAPYSGPDGVPGALDYMSFSTALYGESDL 912          

HSP 3 Score: 72.0182 bits (175), Expect = 0.000e+0
Identity = 32/69 (46.38%), Postives = 49/69 (71.01%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKK 3029
            A LSE++A++KK EAFESD  AH  RV++I  IA EL  L+Y+D  S+N+R   I ++W+ +  L++K+
Sbjct:  423 ATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRICDQWDALGALSQKR 491          
BLAST of Alpha actinin vs. Planmine SMEST
Match: SMESG000047739.1 (SMESG000047739.1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 435/471 (92.36%), Postives = 443/471 (94.06%), Query Frame = 2
Query: 1550 MSIVDFEGFVDCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV*TSSDNEKTRGFRIRFCGS*FKSSKNQRYCS*TSEI-KLS*HD 2959
            MSIVDFEGFVD AEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKK+ L    +  +K   F   F      SS+ QR     +E+ +L+ HD
Sbjct:    1 MSIVDFEGFVDRAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKANLSELRAIMKKQEAFESDFVAH---SSRVQRIRDIAAELQRLNYHD 468          

HSP 2 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 380/399 (95.24%), Postives = 382/399 (95.74%), Query Frame = 1
Query: 3025 RKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGNGALDYKLFASSLYGHSDL 4221
            +KKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQI NEQLREKFGSLANKLGPWLDEKQQLVNHL                +QLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGNGALDYKLFASSLYGHSDL
Sbjct:  492 KKKVDIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQISNEQLREKFGSLANKLGPWLDEKQQLVNHL----------------KQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPYPEGGNGALDYKLFASSLYGHSDL 874          

HSP 3 Score: 147.902 bits (372), Expect = 9.531e-36
Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 3
Query: 2817 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 3032
            KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK
Sbjct:  423 KKANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVLTEKKK 494          
BLAST of Alpha actinin vs. Planmine SMEST
Match: SMESG000062022.1 (SMESG000062022.1)

HSP 1 Score: 765.763 bits (1976), Expect = 0.000e+0
Identity = 379/379 (100.00%), Postives = 379/379 (100.00%), Query Frame = -3
Query:  303 MALSCAAFKTETEEQKNRKESNXXXXXXXXXXXRSFKSTHRLLLLGAGESGKSTIVKQMRILHIDGFSNEEKKQKAEDIRKNLRDAILTITSAMSNINPPTKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGVLETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYLRYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTCAVDTENIRRVFNDCKDIIQRMHLRQYELL 1439
            MALSCAAFKTETEEQKNRKESNKRIEKCIEKEKRSFKSTHRLLLLGAGESGKSTIVKQMRILHIDGFSNEEKKQKAEDIRKNLRDAILTITSAMSNINPPTKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGVLETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYLRYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTCAVDTENIRRVFNDCKDIIQRMHLRQYELL
Sbjct:    1 MALSCAAFKTETEEQKNRKESNKRIEKCIEKEKRSFKSTHRLLLLGAGESGKSTIVKQMRILHIDGFSNEEKKQKAEDIRKNLRDAILTITSAMSNINPPTKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGVLETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYLRYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTCAVDTENIRRVFNDCKDIIQRMHLRQYELL 379          
BLAST of Alpha actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 296/445 (66.52%), Postives = 359/445 (80.67%), Query Frame = 2
Query: 1553 SIVDFEGFVDCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV*TSSDNEKTRGFRIRFCG 2887
            SI ++ G+VD    D   E+ + I+ LWEKQQK+TFTAWCNSHLRKVN  I VI +DFRDGL LM+LLEVISGE LPK DKGKMRVHKIANVNKCL FI +KGVKL  V +EEIVDGNVKMTLGMIWTIILRFAIQDIK++D+SAKEGLLLWCQRKT+PY+NV+V+NFH SFKDGLAFCALIHRHRP+LIDY +L K+N   NLN AF++AEK+LDIPRML+ EDM+   KPDELSVMAYVSSYYHAF+GA KAETASNRICKV+ VN+ENE L+N Y+ L+++L+ WI+  +   Q+++   SV  M N  DNFRKYR  +KPP+ EEKG+LE+ YNTLQTRLRLSNRP F+P E   I DIN+ WKDLE +EKD+EEWLMSE++R+EQLD+LV+ F +RC THE+WS GK+EML+S+ Y  + L    +  ++ + F   F G
Sbjct:    3 SISNYSGYVDP---DYLEEQHDVIDLLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYVGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSG 444          

HSP 2 Score: 438.343 bits (1126), Expect = 2.695e-137
Identity = 217/403 (53.85%), Postives = 306/403 (75.93%), Query Frame = 1
Query: 3037 DIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKE------EKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +I+ I +LLE ID + LD+AKK+   +NWIEQAKEDLQDS ++HYIDEVK L+++  +FK+S+++A  E++ L  I  KI+  A +++L +  +NPYT++  + L  EW +L++L+P R + L++EL++Q ++E LR K+ +LANK+GPWLD +Q+ +N LS+    +++E QKS+L +LE ++ ++R  A E+D+CSQEL + +IFE  + ++SME +RVSWEQL SS+R+++ EI+NQILTRDSKG+S  QM+EFRRCFNHFDK+ T+ LEP EFKACLVSLG NLKE      +KGEA+F +IM +VDP+  G VTF AFID+M  ET ++D+ +Q+L+SFKVL  D+DYIT EELRRELP E+AEYCIANM PY  P G     DY+ F++SLYG SDL
Sbjct:  494 NIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 896          

HSP 3 Score: 72.7886 bits (177), Expect = 2.695e-137
Identity = 36/65 (55.38%), Postives = 45/65 (69.23%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVL 3017
            ANL ELRA+ K+ +AFESDF  H  RV RI  IA EL++L YHDM SI++RL+ I   W+ M  L
Sbjct:  423 ANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKL 487          
BLAST of Alpha actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 296/445 (66.52%), Postives = 359/445 (80.67%), Query Frame = 2
Query: 1553 SIVDFEGFVDCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV*TSSDNEKTRGFRIRFCG 2887
            SI ++ G+VD    D   E+ + I+ LWEKQQK+TFTAWCNSHLRKVN  I VI +DFRDGL LM+LLEVISGE LPK DKGKMRVHKIANVNKCL FI +KGVKL  V +EEIVDGNVKMTLGMIWTIILRFAIQDIK++D+SAKEGLLLWCQRKT+PY+NV+V+NFH SFKDGLAFCALIHRHRP+LIDY +L K+N   NLN AF++AEK+LDIPRML+ EDM+   KPDELSVMAYVSSYYHAF+GA KAETASNRICKV+ VN+ENE L+N Y+ L+++L+ WI+  +   Q+++   SV  M N  DNFRKYR  +KPP+ EEKG+LE+ YNTLQTRLRLSNRP F+P E   I DIN+ WKDLE +EKD+EEWLMSE++R+EQLD+LV+ F +RC THE+WS GK+EML+S+ Y  + L    +  ++ + F   F G
Sbjct:    3 SISNYSGYVDP---DYLEEQHDVIDLLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYVGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSG 444          

HSP 2 Score: 444.891 bits (1143), Expect = 2.576e-139
Identity = 217/397 (54.66%), Postives = 306/397 (77.08%), Query Frame = 1
Query: 3037 DIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +I+ I +LLE ID + LD+AKK+   +NWIEQAKEDLQDS ++HYIDEVK L+++  +FK+S+++A  E++ L  I  KI+  A +++L +  +NPYT++  + L  EW +L++L+P R + L++EL++Q ++E LR K+ +LANK+GPWLD +Q+ +N LS+    +++E QKS+L +LE ++ ++R  A E+D+CSQEL + +IFE  + ++SME +RVSWEQL SS+R+++ EI+NQILTRDSKG+S  QM+EFRRCFNHFDK+ T+ LEP EFKACLVSLG NLKE+KGEA+F +IM +VDP+  G VTF AFID+M  ET ++D+ +Q+L+SFKVL  D+DYIT EELRRELP E+AEYCIANM PY  P G     DY+ F++SLYG SDL
Sbjct:  494 NIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 890          

HSP 3 Score: 72.4034 bits (176), Expect = 2.576e-139
Identity = 36/65 (55.38%), Postives = 45/65 (69.23%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVL 3017
            ANL ELRA+ K+ +AFESDF  H  RV RI  IA EL++L YHDM SI++RL+ I   W+ M  L
Sbjct:  423 ANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKL 487          
BLAST of Alpha actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 296/445 (66.52%), Postives = 359/445 (80.67%), Query Frame = 2
Query: 1553 SIVDFEGFVDCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNTAISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFIQEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGLLLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKENPAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFAGAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNKNGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNRPAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFRIRCETHEAWSKGKVEMLKSDSYKKSQLV*TSSDNEKTRGFRIRFCG 2887
            SI ++ G+VD    D   E+ + I+ LWEKQQK+TFTAWCNSHLRKVN  I VI +DFRDGL LM+LLEVISGE LPK DKGKMRVHKIANVNKCL FI +KGVKL  V +EEIVDGNVKMTLGMIWTIILRFAIQDIK++D+SAKEGLLLWCQRKT+PY+NV+V+NFH SFKDGLAFCALIHRHRP+LIDY +L K+N   NLN AF++AEK+LDIPRML+ EDM+   KPDELSVMAYVSSYYHAF+GA KAETASNRICKV+ VN+ENE L+N Y+ L+++L+ WI+  +   Q+++   SV  M N  DNFRKYR  +KPP+ EEKG+LE+ YNTLQTRLRLSNRP F+P E   I DIN+ WKDLE +EKD+EEWLMSE++R+EQLD+LV+ F +RC THE+WS GK+EML+S+ Y  + L    +  ++ + F   F G
Sbjct:    3 SISNYSGYVDP---DYLEEQHDVIDLLWEKQQKTTFTAWCNSHLRKVNQNIEVIEQDFRDGLKLMQLLEVISGERLPKADKGKMRVHKIANVNKCLNFIAQKGVKLAYVGSEEIVDGNVKMTLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSG 444          

HSP 2 Score: 434.491 bits (1116), Expect = 3.323e-136
Identity = 217/413 (52.54%), Postives = 306/413 (74.09%), Query Frame = 1
Query: 3037 DIEVIHRLLEEIDQMQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSMENAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSALLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSGDNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRFSMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHFDKNKTRTLEPKEFKACLVSLGCNLKEEK----------------GEAEFLKIMAEVDPSRSGVVTFGAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEYCIANMAPY--PEGGNGALDYKLFASSLYGHSDL 4221
            +I+ I +LLE ID + LD+AKK+   +NWIEQAKEDLQDS ++HYIDEVK L+++  +FK+S+++A  E++ L  I  KI+  A +++L +  +NPYT++  + L  EW +L++L+P R + L++EL++Q ++E LR K+ +LANK+GPWLD +Q+ +N LS+    +++E QKS+L +LE ++ ++R  A E+D+CSQEL + +IFE  + ++SME +RVSWEQL SS+R+++ EI+NQILTRDSKG+S  QM+EFRRCFNHFDK+ T+ LEP EFKACLVSLG NLKE+K                GEA+F +IM +VDP+  G VTF AFID+M  ET ++D+ +Q+L+SFKVL  D+DYIT EELRRELP E+AEYCIANM PY  P G     DY+ F++SLYG SDL
Sbjct:  494 NIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQASLEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 906          

HSP 3 Score: 72.7886 bits (177), Expect = 3.323e-136
Identity = 36/65 (55.38%), Postives = 45/65 (69.23%), Query Frame = 3
Query: 2823 ANLSELRAIMKKQEAFESDFVAHSSRVQRIRDIAAELQRLNYHDMTSINSRLDPINNEWEMMRVL 3017
            ANL ELRA+ K+ +AFESDF  H  RV RI  IA EL++L YHDM SI++RL+ I   W+ M  L
Sbjct:  423 ANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKL 487          
The following BLAST results are available for this feature:
BLAST of Alpha actinin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTN40.000e+065.66actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166][more]
ACTN40.000e+065.66actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166][more]
ACTN30.000e+065.26actinin alpha 3 (gene/pseudogene) [Source:HGNC Sym... [more]
ACTN10.000e+064.52actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163][more]
ACTN10.000e+064.52actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163][more]
back to top
BLAST of Alpha actinin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atn-10.000e+060.91AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+056.31AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+062.15AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+056.81AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
gsa-14.088e-15862.86G protein, Subunit Alpha [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of Alpha actinin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actn0.000e+064.27gene:FBgn0000667 transcript:FBtr0333801[more]
Actn0.000e+064.27gene:FBgn0000667 transcript:FBtr0070343[more]
Actn0.000e+064.27gene:FBgn0000667 transcript:FBtr0303048[more]
Actn0.000e+064.52gene:FBgn0000667 transcript:FBtr0310657[more]
Actn0.000e+064.52gene:FBgn0000667 transcript:FBtr0070344[more]
back to top
BLAST of Alpha actinin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn3b0.000e+065.75actinin alpha 3b [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
actn3b0.000e+065.75actinin alpha 3b [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
actn3a0.000e+062.95actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
actn3a0.000e+062.95actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
actn3a0.000e+062.95actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
back to top
BLAST of Alpha actinin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gss0.000e+065.00glutathione synthetase [Source:Xenbase;Acc:XB-GENE... [more]
gss0.000e+065.00glutathione synthetase [Source:Xenbase;Acc:XB-GENE... [more]
actn10.000e+064.41actinin alpha 1 [Source:NCBI gene;Acc:780123][more]
gss0.000e+065.00glutathione synthetase [Source:Xenbase;Acc:XB-GENE... [more]
actn10.000e+064.41actinin alpha 1 [Source:NCBI gene;Acc:780123][more]
back to top
BLAST of Alpha actinin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actn40.000e+065.41actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773... [more]
Actn40.000e+065.41actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773... [more]
Actn30.000e+063.53actinin alpha 3 [Source:MGI Symbol;Acc:MGI:99678][more]
Actn10.000e+064.02actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:213770... [more]
Actn10.000e+064.02actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:213770... [more]
back to top
BLAST of Alpha actinin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30669|GNAS_SCHMA0.000e+074.41Guanine nucleotide-binding protein G(s) subunit al... [more]
sp|O43707|ACTN4_HUMAN0.000e+065.66Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 P... [more]
sp|P57780|ACTN4_MOUSE0.000e+065.41Alpha-actinin-4 OS=Mus musculus OX=10090 GN=Actn4 ... [more]
sp|Q5RCS6|ACTN4_PONAB0.000e+065.41Alpha-actinin-4 OS=Pongo abelii OX=9601 GN=ACTN4 P... [more]
sp|A5D7D1|ACTN4_BOVIN0.000e+065.41Alpha-actinin-4 OS=Bos taurus OX=9913 GN=ACTN4 PE=... [more]
back to top
BLAST of Alpha actinin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VCM40.000e+067.99Uncharacterized protein OS=Capitella teleta OX=283... [more]
V3ZQ630.000e+068.98Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7NYF00.000e+067.74Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2S2P9G40.000e+066.92Alpha-actinin, sarcomeric (Fragment) OS=Schizaphis... [more]
A0A2S2P0920.000e+066.25Alpha-actinin, sarcomeric OS=Schizaphis graminum O... [more]
back to top
BLAST of Alpha actinin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn3a0.000e+064.75actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
actn10.000e+062.35actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn10.000e+062.35actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn10.000e+062.35actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn2b0.000e+064.00alpha-actinin-2 [Source:NCBI gene;Acc:103024106][more]
back to top
BLAST of Alpha actinin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009295.10.000e+063.36pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
ENSPMAT00000000684.12.555e-17062.34pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000004049.13.281e-10646.37pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1... [more]
ENSPMAT00000008111.15.930e-10142.36pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
ENSPMAT00000001834.12.587e-8440.46pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1... [more]
back to top
BLAST of Alpha actinin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GPA21.261e-5836.13Nucleotide binding alpha subunit of the heterotrim... [more]
GPA11.400e-4237.30Subunit of the G protein involved in pheromone res... [more]
CMD11.458e-927.33Calmodulin; Ca2+ binding protein that regulates Ca... [more]
ARF31.954e-731.31Glucose-repressible ADP-ribosylation factor; GTPas... [more]
SAC64.218e-723.76Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of Alpha actinin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491930.000e+075.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ALPHA-ACTININ0.000e+060.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424312.723e-10144.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495767.550e-8942.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291011.683e-8845.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha actinin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn3b0.000e+066.00actinin alpha 3 [Source:NCBI gene;Acc:101158802][more]
actn3b0.000e+066.00actinin alpha 3 [Source:NCBI gene;Acc:101158802][more]
actn3b0.000e+066.00actinin alpha 3 [Source:NCBI gene;Acc:101158802][more]
actn10.000e+065.16actinin alpha 1 [Source:NCBI gene;Acc:101169077][more]
actn10.000e+065.16actinin alpha 1 [Source:NCBI gene;Acc:101169077][more]
back to top
BLAST of Alpha actinin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047739.19.531e-3692.36SMESG000047739.1[more]
SMESG000062022.10.000e+0100.00SMESG000062022.1[more]
SMESG000026000.12.695e-13766.52SMESG000026000.1[more]
SMESG000026000.12.576e-13966.52SMESG000026000.1[more]
SMESG000026000.13.323e-13666.52SMESG000026000.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017811 ID=SMED30017811|Name=Alpha actinin|organism=Schmidtea mediterranea sexual|type=transcript|length=4405bp
ATCTCGAGAATTAGTTTTTATTATTATTATTCTTTAAGATCAATAAATCA
CAGTACTTGGGTTTTGTTTACACTACCATTCATAATCATAGCATAACCAA
TTGTCAGATCTGTTTTTTTTCATTAAATTGAATATTACTAACGACACCGT
TGAGAGTATCAGAGATAATAATATAATAGGTAAATATTTATTTTTAAAAT
CTAAAAAGCTCTGATATTGAACGCAGACATTAGGTAATAATTAATATATC
AGTAATGAGAGTCCAGATTTCGATAGAATCATAATTTTGAATATTAATTC
TAAAGAAGCTCATACTGGCGTAGATGCATACGTTGAATGATATCCTTACA
ATCATTGAATACCCGACGAATATTTTCTGTATCAACAGCACATGTGAAAT
GGGAGTAGCAATAATGACGTCCATCATTGCCAGTCGTGGTAATTTTTAGA
AATTCGTCTCTAAAAAAATATTTTGCCCGAGTAAATTCTGCTTCTTCTAT
GTGATTGTGACACTGAACATCAGCTGGCAAGGTATACCGCAAATAGTCAG
GGAAATAGTCTTCAATCTTTGATTTTCCAGCTAATACTTTTTCTTTCAAC
ACGTCTTGCTTGTTTAGAAATAATATCACCGATATATTCCTCAGCCATCT
ATTGTTCCAAATACTTTTTAAAAGTTCGAGGGATTCTCGAAGACGATTTT
GACTGGCATCTTCACGAAGTACCATGTTGTATGAAGAACATGCAGTAACA
AAAATAATTGCAGTGACGTCATTAAAGCATTGTATCCATTTACGACGTTC
ATCTCTCTGGCCACCGACATCAAACATGTGAAAATTAACTTTATCAACTG
TGAATTTTGTCTCGAAAATTCCAGACGTCAAAACTCGACACCGAAGAATA
TCCTGCTCTGTGGGTGTGTAGTTTTGCTGTCCTAATATCAAAGCCTGGTC
TAGAAAGTATTTTGCACAATCAATTAGTTGATATTCGTTTGAACGTTCAT
ATGTTTCAAGCACCCCTTTATCAGCCCACAATACTGCACAATATTCATAG
AATTCACTCGGATATCTAAAATCTGGTTTTGATGCTGTATGCTGCATATA
ATCTAAAAATTTTTGATTTTCCGGGTTACCTAATTTTGTAGGAGGATTGA
TATTGCTCATGGCACTGGTGATTGTCAATATGGCATCTCTTAAATTTTTT
CGAATATCTTCAGCTTTTTGTTTCTTCTCTTCGTTGGAAAATCCATCTAT
ATGCAAAATTCTCATTTGTTTAACAATAGTTGACTTTCCTGATTCTCCAG
CACCTAATAGCAACAACCTATGAGTAGATTTGAAAGATCGTTTTTCTTTT
TCAATACATTTTTCTATCCGCTTATTGGATTCTTTGCGATTTTTTTGTTC
TTCTGTTTCAGTTTTAAAAGCAGCACAACTTAATGCCATCTTAGAAAACG
TTGAATAATTAGCAAGTATATATTTAATAATACATTAAATTTTAAAGTTA
GACAACTAATGTAATCTCCATTATATCAACAAAATATTTTTTTTTTAAAA
TGTCTATCGTTGATTTCGAAGGTTTTGTTGACTGCGCAGAAGATGATGAT
AATGTTGAAAAAACCGAAGCTATTGAACAATTATGGGAGAAACAGCAAAA
AAGTACTTTTACTGCTTGGTGCAATTCCCATTTACGCAAAGTCAACACTG
CTATATCTGTTATTGGTGAGGACTTCAGAGATGGATTAAATCTTATGAAA
TTACTAGAAGTAATTAGTGGCGAGTCACTTCCAAAGCCAGACAAAGGAAA
AATGAGAGTTCACAAAATAGCCAATGTTAATAAATGCTTACAGTTTATTC
AAGAAAAAGGTGTCAAATTGGTTTTAGTAGCCGCAGAAGAAATCGTTGAT
GGAAATGTTAAAATGACTCTTGGAATGATTTGGACAATTATTTTACGATT
CGCCATTCAAGACATTAAAATTGACGATATGAGTGCTAAAGAAGGTCTTC
TTTTATGGTGCCAACGAAAAACTAGTCCTTATAGAAATGTCCGAGTGAAT
AACTTTCACATGAGTTTCAAAGATGGTCTCGCTTTTTGCGCACTGATTCA
CCGCCATAGACCTGAATTGATTGATTACAAAAGTTTAAGCAAGGAAAATC
CAGCTCATAATCTCAATACAGCCTTTGAAATAGCTGAAAAATATCTTGAC
ATTCCCCGAATGCTCAATGTAGAAGACATGGTCAATTCTATAAAGCCTGA
TGAATTATCTGTAATGGCCTATGTATCATCCTATTACCATGCGTTTGCTG
GAGCACATAAAGCGGAAACTGCATCTAATAGAATTTGTAAAGTCATTACT
GTCAACCGAGAAAACGAGTCTCTGATTAATACATATGACAAATTGGCATC
GGATTTAGTCAACTGGATAAAATCTAAACTGAAATATTTGCAAAACAAAA
ACGGATGTGAATCAGTAAATGAAATGCAAAATATGTGCGATAACTTTCGT
AAATATCGCCGAGATGACAAACCGCCAAGATTAGAAGAAAAGGGAAAATT
AGAGAGCGATTACAATACCTTGCAAACTCGACTACGACTAAGTAATCGGC
CCGCTTTTATGCCAAAAGAGGGAGCTTTAATTTCGGATATCAATAACCAC
TGGAAAGATTTGGAAAGAAATGAAAAAGATTACGAGGAATGGCTCATGTC
AGAAATGAAACGAATAGAGCAATTGGATCATTTAGTGAAAAACTTCCGAA
TACGATGTGAAACACACGAGGCTTGGTCGAAAGGTAAAGTTGAAATGCTA
AAATCTGACAGTTACAAAAAAAGCCAACTTGTCTGAACTTCGAGCGATAA
TGAAAAAACAAGAGGCTTTCGAATCAGATTTTGTGGCTCATAGTTCAAGA
GTTCAAAGAATCAGAGATATTGCAGCTGAACTTCAGAGATTAAATTATCA
TGACATGACAAGCATTAATAGTCGACTTGATCCAATCAACAATGAATGGG
AAATGATGCGAGTGCTAACCGAAAAGAAAAAAAGTCGACATTGAAGTAAT
CCATCGTTTATTAGAAGAAATAGATCAAATGCAACTTGATTACGCTAAAA
AAATTGCTCCATTTTTTAATTGGATCGAACAAGCCAAAGAAGATCTGCAG
GACTCCCATATCCTTCATTATATTGATGAAGTTAAAATTCTTATTGAGAA
ACAAAACGAATTCAAGAAATCTATGGAAAACGCCAAATTAGAATTTAATG
TGCTGCACCAGATTGATTCAAAAATAAGGCAGAAAGCCATGGACAACCAT
CTTACTCAGATTAGTGATAATCCTTATACTCTTCTCAATCAGGAGATCTT
GTCTGTTGAATGGAATAAACTATCTGCTCTTCTCCCAATACGGGATGAAT
TTTTACAAAAAGAATTGAGTCAACAAATTAGGAATGAACAACTACGAGAG
AAATTTGGATCTCTTGCCAATAAACTCGGTCCTTGGTTAGATGAGAAGCA
GCAACTGGTCAACCATCTTAGTTCTGGGGACAATACTTCTACTATGGAGT
CTCAAAAATCTCAATTAGAACAACTTGAAGCGGATATAAGTGAATATCGA
AAACTAGCAATGGAAGTTGATAAGTGCAGTCAAGAATTACAACAAAATAT
GATTTTTGAAACTCCAAATTGTCGATTTTCAATGGAAACATTGCGTGTAT
CATGGGAACAGTTACAGTCATCTTTAAGACGTTCAAAATGTGAAATCGAA
AATCAAATCCTTACCAGGGATTCTAAAGGGATTAGTCAGACTCAAATGGA
TGAATTCAGGCGTTGTTTTAATCATTTCGATAAAAATAAAACTCGTACTC
TTGAACCGAAAGAATTCAAAGCTTGTTTAGTATCGTTGGGCTGTAATCTT
AAAGAGGAAAAGGGTGAAGCTGAGTTCCTTAAAATTATGGCAGAAGTTGA
TCCTAGTCGGTCTGGTGTGGTAACTTTCGGTGCTTTCATTGATTACATGG
CAAAAGAAACAACTGAACAAGATACTTTAGAACAAATTCTTCAATCTTTC
AAAGTGTTATGTCAAGATAGAGATTATATAACTGCCGAGGAATTGAGAAG
AGAATTACCGAGTGAAGAAGCTGAATATTGCATTGCTAATATGGCTCCAT
ATCCTGAAGGTGGAAATGGAGCTTTGGATTACAAATTATTTGCATCCTCT
CTATACGGACATTCCGATTTGTAAACAATATCTGACCTTTGAAAACTACA
TTTTGTTATTAATTGGAATTTTCATTGATTTTTATTATTGTTTTCTAATT
CTGTTTGGAGATTTTTAATCCAATATTTGTATTTCATATTTTATATAAAT
TGGTTTTGCAAATTTATTCGATTTTCTAAAAAATATATGATAGCTTCATT
AAAAA
back to top

protein sequence of SMED30017811-orf-1

>SMED30017811-orf-1 ID=SMED30017811-orf-1|Name=SMED30017811-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=382bp
MQLDYAKKIAPFFNWIEQAKEDLQDSHILHYIDEVKILIEKQNEFKKSME
NAKLEFNVLHQIDSKIRQKAMDNHLTQISDNPYTLLNQEILSVEWNKLSA
LLPIRDEFLQKELSQQIRNEQLREKFGSLANKLGPWLDEKQQLVNHLSSG
DNTSTMESQKSQLEQLEADISEYRKLAMEVDKCSQELQQNMIFETPNCRF
SMETLRVSWEQLQSSLRRSKCEIENQILTRDSKGISQTQMDEFRRCFNHF
DKNKTRTLEPKEFKACLVSLGCNLKEEKGEAEFLKIMAEVDPSRSGVVTF
GAFIDYMAKETTEQDTLEQILQSFKVLCQDRDYITAEELRRELPSEEAEY
CIANMAPYPEGGNGALDYKLFASSLYGHSDL*
back to top

protein sequence of SMED30017811-orf-2

>SMED30017811-orf-2 ID=SMED30017811-orf-2|Name=SMED30017811-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=380bp
MALSCAAFKTETEEQKNRKESNKRIEKCIEKEKRSFKSTHRLLLLGAGES
GKSTIVKQMRILHIDGFSNEEKKQKAEDIRKNLRDAILTITSAMSNINPP
TKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGVLETYERS
NEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDK
VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRL
RESLELLKSIWNNRWLRNISVILFLNKQDVLKEKVLAGKSKIEDYFPDYL
RYTLPADVQCHNHIEEAEFTRAKYFFRDEFLKITTTGNDGRHYCYSHFTC
AVDTENIRRVFNDCKDIIQRMHLRQYELL*
back to top

protein sequence of SMED30017811-orf-3

>SMED30017811-orf-3 ID=SMED30017811-orf-3|Name=SMED30017811-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=429bp
MSIVDFEGFVDCAEDDDNVEKTEAIEQLWEKQQKSTFTAWCNSHLRKVNT
AISVIGEDFRDGLNLMKLLEVISGESLPKPDKGKMRVHKIANVNKCLQFI
QEKGVKLVLVAAEEIVDGNVKMTLGMIWTIILRFAIQDIKIDDMSAKEGL
LLWCQRKTSPYRNVRVNNFHMSFKDGLAFCALIHRHRPELIDYKSLSKEN
PAHNLNTAFEIAEKYLDIPRMLNVEDMVNSIKPDELSVMAYVSSYYHAFA
GAHKAETASNRICKVITVNRENESLINTYDKLASDLVNWIKSKLKYLQNK
NGCESVNEMQNMCDNFRKYRRDDKPPRLEEKGKLESDYNTLQTRLRLSNR
PAFMPKEGALISDINNHWKDLERNEKDYEEWLMSEMKRIEQLDHLVKNFR
IRCETHEAWSKGKVEMLKSDSYKKSQLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0051764actin crosslink formation
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0001666response to hypoxia
GO:0006810transport
GO:0070830bicellular tight junction assembly
GO:1900025negative regulation of substrate adhesion-dependent cell spreading
GO:1901224positive regulation of NIK/NF-kappaB signaling
GO:1902396protein localization to bicellular tight junction
GO:1903506regulation of nucleic acid-templated transcription
GO:0015031protein transport
GO:0030050vesicle transport along actin filament
GO:0030335positive regulation of cell migration
GO:0035357peroxisome proliferator activated receptor signaling pathway
GO:0042981regulation of apoptotic process
GO:0048384retinoic acid receptor signaling pathway
GO:0048549positive regulation of pinocytosis
GO:0051017actin filament bundle assembly
GO:0051271negative regulation of cellular component movement
GO:0051272positive regulation of cellular component movement
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR002048EF_hand_dom
IPR018159Spectrin/alpha-actinin
IPR011992EF-hand-dom_pair
IPR014837EF-hand_Ca_insen
IPR018247EF_Hand_1_Ca_BS
IPR001715CH-domain
IPR002017Spectrin_repeat
IPR001589Actinin_actin-bd_CS
IPR001019Gprotein_alpha_su
IPR000367Gprotein_alpha_S
IPR011025GproteinA_insert
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003924GTPase activity
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0004871signal transducer activity
GO:0019001guanyl nucleotide binding
GO:0005525GTP binding
GO:0005509calcium ion binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001882nucleoside binding
GO:0003723RNA binding
GO:0003779actin binding
GO:0030374ligand-dependent nuclear receptor transcription coactivator activity
GO:0031490chromatin DNA binding
GO:0032403protein complex binding
GO:0035257nuclear hormone receptor binding
GO:0042803protein homodimerization activity
GO:0042974retinoic acid receptor binding
GO:0044325ion channel binding
GO:0046872metal ion binding
GO:0047485protein N-terminus binding
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0001725stress fiber
GO:0005615extracellular space
GO:0005622intracellular
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005903brush border
GO:0005911cell-cell junction
GO:0005925focal adhesion
GO:0015629actin cytoskeleton
GO:0016604nuclear body
GO:0030018Z disc
GO:0030054cell junction
GO:0030529intracellular ribonucleoprotein complex
GO:0030863cortical cytoskeleton
GO:0031143pseudopodium
GO:0043005neuron projection
GO:0043234protein complex
GO:0048471perinuclear region of cytoplasm
GO:0070062extracellular exosome