CRAL-TRIO domain-containing protein

Overview
NameCRAL-TRIO domain-containing protein
Smed IDSMED30017805
Length (bp)2050
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017805

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30017805h1SMcG0022481 Contig54399newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017805h1SMcG0022481 Contig54399uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
muscle cellSMED30017805h1SMcG0022481 dd_Smed_v4_12402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017805h1SMcG0022482 Contig54399newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017805h1SMcG0022482 Contig54399uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
muscle cellSMED30017805h1SMcG0022482 dd_Smed_v4_12402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017805h1SMcG0022481 Contig54399newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30017805h1SMcG0022481 Contig54399uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30017805h1SMcG0022482 Contig54399newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30017805h1SMcG0022482 Contig54399uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: TTPAL (alpha tocopherol transfer protein like [Source:HGNC Symbol;Acc:HGNC:16114])

HSP 1 Score: 108.227 bits (269), Expect = 5.432e-25
Identity = 75/248 (30.24%), Postives = 122/248 (49.19%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLE 959
            A ++L E P      +++ R  V K  P+L    D  FLL+FLR  KFD+ +  + L N+ + R   R  P+ F+  N+    +   L S     L   D  G  ++ ++P+ W     P+ + +   ++ L+ L+  EETQ++G+ +L D K VS         P I K+    +QD +PIR+K     NEP IF  +F I   F+ +K+  R     +D+N     +P  +++LP EY G  G L+
Sbjct:   43 AREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCR---RSWPEVFN--NLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGELD 282          

HSP 2 Score: 100.523 bits (249), Expect = 2.625e-22
Identity = 64/210 (30.48%), Postives = 107/210 (50.95%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLN 1824
            FLL+FLR  KFD+D+A + L N+ + R S        K   ++D +   FL+   H     +  G  +  IR + W P   P+ + I  I++ L+ +I  EE+Q++GI +L D   +S      +  P + K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +K+  R F   +D+      +P    ILP EY G  G L+
Sbjct:   80 FLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPH----TDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGELD 282          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: TTPAL (alpha tocopherol transfer protein like [Source:HGNC Symbol;Acc:HGNC:16114])

HSP 1 Score: 108.227 bits (269), Expect = 5.432e-25
Identity = 75/248 (30.24%), Postives = 122/248 (49.19%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLE 959
            A ++L E P      +++ R  V K  P+L    D  FLL+FLR  KFD+ +  + L N+ + R   R  P+ F+  N+    +   L S     L   D  G  ++ ++P+ W     P+ + +   ++ L+ L+  EETQ++G+ +L D K VS         P I K+    +QD +PIR+K     NEP IF  +F I   F+ +K+  R     +D+N     +P  +++LP EY G  G L+
Sbjct:   43 AREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCR---RSWPEVFN--NLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGELD 282          

HSP 2 Score: 100.523 bits (249), Expect = 2.625e-22
Identity = 64/210 (30.48%), Postives = 107/210 (50.95%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLN 1824
            FLL+FLR  KFD+D+A + L N+ + R S        K   ++D +   FL+   H     +  G  +  IR + W P   P+ + I  I++ L+ +I  EE+Q++GI +L D   +S      +  P + K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +K+  R F   +D+      +P    ILP EY G  G L+
Sbjct:   80 FLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPH----TDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGELD 282          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: CLVS1 (clavesin 1 [Source:HGNC Symbol;Acc:HGNC:23139])

HSP 1 Score: 95.5153 bits (236), Expect = 1.189e-20
Identity = 71/244 (29.10%), Postives = 110/244 (45.08%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDP-IVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF      + L  +   R     + D F  F  DDP I    +D    +   R+  G  ILL+    WD  +      L    + L++L+ + E QI+G  L+ID  + S K    +  P ILK     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +      LP+E+   GGTL
Sbjct:   41 ELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQL---NLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLT-PSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEF---GGTL 275          

HSP 2 Score: 68.5514 bits (166), Expect = 9.153e-12
Identity = 55/204 (26.96%), Postives = 95/204 (46.57%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF    A R L  +   R       + FK       + +  +     +   ++  G  I L+ +  WD  +     ++  I + L+++I   E QI+G  ++ID ++ S K   S   P +LK   + +Q+S+P R  G  F N+P     +Y LI  F+ DK ++R F   N++    + I    + LP+E+ G
Sbjct:   75 FILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPG--IKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQ-ASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEFGG 273          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: CLVS1 (clavesin 1 [Source:HGNC Symbol;Acc:HGNC:23139])

HSP 1 Score: 95.5153 bits (236), Expect = 1.189e-20
Identity = 71/244 (29.10%), Postives = 110/244 (45.08%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDP-IVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF      + L  +   R     + D F  F  DDP I    +D    +   R+  G  ILL+    WD  +      L    + L++L+ + E QI+G  L+ID  + S K    +  P ILK     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +      LP+E+   GGTL
Sbjct:   41 ELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQL---NLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLT-PSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEF---GGTL 275          

HSP 2 Score: 68.5514 bits (166), Expect = 9.153e-12
Identity = 55/204 (26.96%), Postives = 95/204 (46.57%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF    A R L  +   R       + FK       + +  +     +   ++  G  I L+ +  WD  +     ++  I + L+++I   E QI+G  ++ID ++ S K   S   P +LK   + +Q+S+P R  G  F N+P     +Y LI  F+ DK ++R F   N++    + I    + LP+E+ G
Sbjct:   75 FILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPG--IKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQ-ASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEFGG 273          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Match: CLVS2 (clavesin 2 [Source:HGNC Symbol;Acc:HGNC:23046])

HSP 1 Score: 88.9669 bits (219), Expect = 1.444e-18
Identity = 62/239 (25.94%), Postives = 107/239 (44.77%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNG 941
            +L ENP  ++  I+  R  V + P +    TD  F+L+FLR  KF H +  + L  +   R     + D F  F   DP +   L       L   D  G  IL++    WD  +  +   L    + L+ ++ + E Q++G  L+ID  + + K    +  P +L+     +QDS+P R     F N+P     ++ +   F+ +K R R     N++N   + +     +LP+E+ G
Sbjct:   19 ELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQ---NLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIH--PEILPSEFGG 251          

HSP 2 Score: 68.9366 bits (167), Expect = 7.016e-12
Identity = 56/205 (27.32%), Postives = 99/205 (48.29%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF H +A R L  +   R       + FK     D  ++  L       L   D  G  I ++ +  WD  +  +V ++  I + L+ +I   E Q++G  ++ID ++ + K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ +K ++R F   N++    + I    +ILP+E+ G
Sbjct:   53 FILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMFKSFKAT---DPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQ-ASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIH--PEILPSEFGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG33966 (gene:FBgn0053966 transcript:FBtr0100007)

HSP 1 Score: 126.716 bits (317), Expect = 6.605e-32
Identity = 82/287 (28.57%), Postives = 149/287 (51.92%), Query Frame = 3
Query:  198 ISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVD-DPIVDMY-LDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQI-HGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKR 1049
            +S   ++ AI++L E P++++  I + R W+K  PHL   TD +FL+ FLR  KF  ++T+ ++D F T+R+     P+F+   NVD D  ++++ L + V LP   ND G  + L++   +D  K  + +      +   I+L E++  I +GL  ++DL +V+      M+ P   K+  +  +++ P+R +   F N P  FD +F +    M+ K +GR +   +     + ++P  K  LP EY GE G++    ++W+ R   Y    +  K    +E+ R
Sbjct:    7 LSPELQKTAIENLNEVPNKLDDDIAALRDWIKQQPHLKARTDDQFLVNFLRGCKFSLERTKSKIDRFYTLRTK---YPEFYLGHNVDVDKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKYTLQEVNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMS-PSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIP--KQYLPVEYGGENGSIPELLQQWEQRILAYRNYWEEEKNYGTDESLR 287          

HSP 2 Score: 81.2629 bits (199), Expect = 2.107e-16
Identity = 71/271 (26.20%), Postives = 125/271 (46.13%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTF-LSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAE--PKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKF 1998
            FL+ FLR  KF  ++ + ++D F T R+               D+ ++ F L + + +P   ND G  + L+R   +DP K  + +  V    GL   I ++E  +  +  LI + D+S  +   + +  P   K+     +E+ PLR +G  F N P  FD I+ +I   M+ K + R +   +  +    +IP  ++ LP EY G+ GS+ E  ++W+ +  +Y       +    DES R       +    D+++  FG  GSF + 
Sbjct:   51 FLVNFLRGCKFSLERTKSKIDRFYTLRTKYPEFYLGHNVDV--DKALEIFRLGTIVILPRPLNDNGPRLALLRMACYDPSKYTLQE--VNRAAGLMQQIMLDEDDVAIVNGLISILDLSNVTTGHFLQMSPSFAKKMTVFQEEALPLRPQGIHFINTPNGFDTIFNMIKPMMSKKQQGRLYVHGSKWEALYNQIP--KQYLPVEYGGENGSIPELLQQWEQRILAYRNYWEEEKNYGTDESLR-------VGQPVDFES-LFGLQGSFRQL 307          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG31636 (gene:FBgn0051636 transcript:FBtr0079324)

HSP 1 Score: 105.916 bits (263), Expect = 1.104e-24
Identity = 68/266 (25.56%), Postives = 134/266 (50.38%), Query Frame = 3
Query:  213 KQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFH--YFNVDDPIVDMY-LDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEE-TQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTY 998
            ++  I +L E P+++   IE+ R WV   PHL   TD +FLL FLR +KF  ++ +++ D F T++   R  P+ F+      D  ++D+  +   +Q+P+  +D G  + +++   +D+ K      + +  M  +I++ E++   + G   ++D+  V+   + A+ +P++L +++    ++ P R K   F N P  F+  F     F   K++ R   + +D    +E V   +  LP EY G GG L+  +   + +  +Y
Sbjct:   12 QEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQ---RSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFAL-QPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRIS-VSSDPAAIYELVR--RKYLPQEYGGTGGNLQDISHTMEAKLSSY 270          

HSP 2 Score: 80.1073 bits (196), Expect = 4.636e-16
Identity = 72/274 (26.28%), Postives = 120/274 (43.80%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFM-GLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNY--LTDHSDYQNK-TFGTSGSFTKFE 2001
             FLL FLR  KF  ++A+ + D F T + S        +       +    +   + IP+  +D G  + +IR+  +D  K     +I +  M G  ++   + + + G   ++D+  ++   L +  +P+LL ++     E+ P R KG  F N P  F+  +  +  F   K+K R   V +D     E +    K LP EY G GG+L + +   + K  SY     P+      ES+   AN       DH    ++ +FG  GSF K E
Sbjct:   50 QFLLAFLRGTKFSLERAKEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFAL-QPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSR-ISVSSDPAAIYELV--RRKYLPQEYGGTGGNLQDISHTMEAKLSSY----GPY----FRESQNFGANDKLREFGDHKRGNHRSSFGAVGSFRKLE 311          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG31636 (gene:FBgn0051636 transcript:FBtr0343865)

HSP 1 Score: 105.916 bits (263), Expect = 1.104e-24
Identity = 68/266 (25.56%), Postives = 134/266 (50.38%), Query Frame = 3
Query:  213 KQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFH--YFNVDDPIVDMY-LDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEE-TQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTY 998
            ++  I +L E P+++   IE+ R WV   PHL   TD +FLL FLR +KF  ++ +++ D F T++   R  P+ F+      D  ++D+  +   +Q+P+  +D G  + +++   +D+ K      + +  M  +I++ E++   + G   ++D+  V+   + A+ +P++L +++    ++ P R K   F N P  F+  F     F   K++ R   + +D    +E V   +  LP EY G GG L+  +   + +  +Y
Sbjct:   12 QEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKEKFDRFYTLQ---RSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFAL-QPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSRIS-VSSDPAAIYELVR--RKYLPQEYGGTGGNLQDISHTMEAKLSSY 270          

HSP 2 Score: 80.1073 bits (196), Expect = 4.636e-16
Identity = 72/274 (26.28%), Postives = 120/274 (43.80%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFM-GLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNY--LTDHSDYQNK-TFGTSGSFTKFE 2001
             FLL FLR  KF  ++A+ + D F T + S        +       +    +   + IP+  +D G  + +IR+  +D  K     +I +  M G  ++   + + + G   ++D+  ++   L +  +P+LL ++     E+ P R KG  F N P  F+  +  +  F   K+K R   V +D     E +    K LP EY G GG+L + +   + K  SY     P+      ES+   AN       DH    ++ +FG  GSF K E
Sbjct:   50 QFLLAFLRGTKFSLERAKEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSKHKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFAL-QPQLLSKFSTYADEAMPTRQKGIHFINVPAAFETGFNSLRSFFPAKIKSR-ISVSSDPAAIYELV--RRKYLPQEYGGTGGNLQDISHTMEAKLSSY----GPY----FRESQNFGANDKLREFGDHKRGNHRSSFGAVGSFRKLE 311          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG33965 (gene:FBgn0053965 transcript:FBtr0100006)

HSP 1 Score: 105.531 bits (262), Expect = 1.714e-24
Identity = 69/270 (25.56%), Postives = 139/270 (51.48%), Query Frame = 3
Query:  213 KQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVD-------MYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFM-GLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTY 998
            ++ AI++L E PS+V + I + + W++  PHL    + +FLL FLR SKF  +K ++++D F ++++     P+ F+    D  +VD       + L   +++PL   D G  + +++   +D  K      + +  M G  ++L ++   + G   ++D+  V+  ++ A+ +P++L +++    ++ P R K   F N P  F+  F+    +   K++ R   + +D    FE+VP  K  LP EY G  GT++   ++ + +  +Y
Sbjct:   17 QKVAIEELNEVPSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAKQKIDRFYSLQAV---IPEVFN----DQRLVDNAQVLEIIRLGVILRIPLDEEDTGPAVTIIRAGSYDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFAL-QPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERVS-VSSDPEAIFERVP--KHYLPEEYGGSKGTMKDITDQMEAKLCSY 275          

HSP 2 Score: 78.9518 bits (193), Expect = 1.321e-15
Identity = 66/271 (24.35%), Postives = 126/271 (46.49%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLI-VLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFE-CISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKF 1998
             FLL FLR +KF  +KA++++D F + ++         +       +    L   + IPL + D G  + +IR+  +D  K     +I V    G  +++  + + + G   ++D++ ++  +L +  +P+LL ++     E+ P R KG  F N P  F+  ++ +  +   K+KER   V +D +   E++P  +  LP EY G  G++ +  ++ + K  SY      FE C       + +  ++ L     +    FG  GSF + 
Sbjct:   55 QFLLSFLRGSKFSLEKAKQKIDRFYSLQAVIPEVFNDQRLVDNAQVLEIIRLGVILRIPLDEEDTGPAVTIIRAGSYDINKFKFQDIIRVGSMFGEIMMLEDDNASVSGYLEIMDMSGVTGANLFAL-QPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETGFKSLLGWFPGKIKERV-SVSSDPEAIFERVP--KHYLPEEYGGSKGTMKDITDQMEAKLCSYRSY---FEDCQHFGAHDKLREEASVLNPDESH----FGVDGSFRQL 314          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Match: CG12926 (gene:FBgn0033437 transcript:FBtr0088502)

HSP 1 Score: 105.145 bits (261), Expect = 1.737e-24
Identity = 74/262 (28.24%), Postives = 131/262 (50.00%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSK--VQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEE-TQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTY 998
            A D+LGE P +++  IE+ R W+   PHL    D++FL+ FLR  K+  +KT+ +LDNF  +R +    P+ +    V +  + + LD+   ++LP      G  I + +   +DS+K  + + + +  M  +I + E++   I G   +ID+K V    +    +  ++K+  +    +YP R K   F N P   +    I    M++K+R R H I + ++  ++ VP  K  LP EY G  GT++     W+ +   Y
Sbjct:   20 AHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGA---VPELYKNRIVGEKQLSI-LDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQF-DAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFH-IHSKLDSLYKYVP--KECLPAEYGGSNGTIQDVVSTWRTKLLAY 273          

HSP 2 Score: 69.3218 bits (168), Expect = 2.148e-12
Identity = 64/272 (23.53%), Postives = 120/272 (44.12%), Query Frame = 1
Query: 1189 GNFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEE-SQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFE 2001
              FL+ FLR  K+  +K + +LDNF   R +     +     + +  ++ T    ++  PL Q D G  I + R   +D +K  + +++ +  M  +I I  ++ + I G   +ID+  +    L  + +  L+K+   +  ++YP R KG  F N P   +    +    M++K+++R F + + +    + +P  ++ LP EY G  G++ +    W+ K  +Y     PF     +E      N              FG  GSF K +
Sbjct:   54 AQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPL-QAD-GPRIHISRYGQYDSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQF-DAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKR-FHIHSKLDSLYKYVP--KECLPAEYGGSNGTIQDVVSTWRTKLLAY----KPF----FEEEASYGTNEKLRRGQPVSAESLFGIEGSFRKLD 311          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:ZFIN;Acc:ZDB-GENE-030131-296])

HSP 1 Score: 103.99 bits (258), Expect = 1.061e-23
Identity = 83/283 (29.33%), Postives = 131/283 (46.29%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYK-------NGDPLKGISVEEA 1043
            A ++L E P      +++ R  + K  P+L    D  FLL+FLR  KFD+ +  + L N+    +S R  P+ F   ++    V   LD      L R D  G  IL ++P  W     P    +   ++ L+ L+  EETQ++G+ +L+D   V   S  +   P + K+    +QD +PIR+K     NEP IF  +F I   F+ +KM  R     +D+      +P  ++VLP EY G  G L+  A  W        +         DPL+G+ + +A
Sbjct:   42 AREELQEKPEWRLRDVQALRDMILKDHPNLRTRLDDAFLLRFLRARKFDYDRALQLLLNY---HASRRAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGVG-LSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLASLHRVIP--QSVLPQEYGGVSGRLDMSA--WSRTLLEAEEEFVVEFCQPDPLEGVIMPDA 314          

HSP 2 Score: 96.6709 bits (239), Expect = 2.848e-21
Identity = 67/214 (31.31%), Postives = 109/214 (50.93%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            FLL+FLR  KFD+D+A + L N+  +R +     +  K   ++  +   FL+      L + D  G  I  +R   W P   P V  I  I++ L+ +I  EE+Q++G+ +L+D   +   S  S   P L K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +KM ER     +D+      IP  + +LP EY G  G L+  A
Sbjct:   79 FLLRFLRARKFDYDRALQLLLNYHASRRAWPEVFQDLKPSTVKHVLDLGFLTV-----LPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGVG-LSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLASLHRVIP--QSVLPQEYGGVSGRLDMSA 284          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:ZFIN;Acc:ZDB-GENE-030131-296])

HSP 1 Score: 101.293 bits (251), Expect = 2.393e-23
Identity = 78/260 (30.00%), Postives = 121/260 (46.54%), Query Frame = 3
Query:  288 VKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYK-------NGDPLKGISVEEA 1043
            +K  P+L    D  FLL+FLR  KFD+ +  + L N+    +S R  P+ F   ++    V   LD      L R D  G  IL ++P  W     P    +   ++ L+ L+  EETQ++G+ +L+D   V   S  +   P + K+    +QD +PIR+K     NEP IF  +F I   F+ +KM  R     +D+      +P  ++VLP EY G  G L+  A  W        +         DPL+G+ + +A
Sbjct:    3 LKDHPNLRTRLDDAFLLRFLRARKFDYDRALQLLLNY---HASRRAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGVG-LSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLASLHRVIP--QSVLPQEYGGVSGRLDMSA--WSRTLLEAEEEFVVEFCQPDPLEGVIMPDA 252          

HSP 2 Score: 97.0561 bits (240), Expect = 8.926e-22
Identity = 67/214 (31.31%), Postives = 109/214 (50.93%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            FLL+FLR  KFD+D+A + L N+  +R +     +  K   ++  +   FL+      L + D  G  I  +R   W P   P V  I  I++ L+ +I  EE+Q++G+ +L+D   +   S  S   P L K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +KM ER     +D+      IP  + +LP EY G  G L+  A
Sbjct:   17 FLLRFLRARKFDYDRALQLLLNYHASRRAWPEVFQDLKPSTVKHVLDLGFLTV-----LPRPDPQGRYILCLRPGKWKPNDYPFVDNIRAIYLTLEKLIQPEETQVNGVVILVDYAGVG-LSQASNPGPLLAKKVVGILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLASLHRVIP--QSVLPQEYGGVSGRLDMSA 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:566769])

HSP 1 Score: 87.4261 bits (215), Expect = 3.392e-18
Identity = 61/239 (25.52%), Postives = 106/239 (44.35%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNG 941
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF+H +  + L  +   R     + D F      DP +   L       L   D  G  IL++    WD  +      L    + L+ ++ + E Q++G  L+ID  + + K    +  P +L+     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +  +  +LP+E  G
Sbjct:   19 ELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQ---NLDMFKNLKATDPGIKQALKDGFPGVLSNLDRYGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI--LPEILPSELGG 251          

HSP 2 Score: 70.8626 bits (172), Expect = 9.000e-13
Identity = 57/205 (27.80%), Postives = 98/205 (47.80%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF+H +A R L  +   R       +  K     D  ++  L       L   D  G  I ++ +  WD  +   V ++  I + L+ +I   E Q++G  ++ID ++ + K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ DK ++R F   N++    + I  L +ILP+E  G
Sbjct:   53 FILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKAT---DPGIKQALKDGFPGVLSNLDRYGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQ-ASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI--LPEILPSELGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: rlbp1b (retinaldehyde binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1870])

HSP 1 Score: 77.411 bits (189), Expect = 5.803e-15
Identity = 61/264 (23.11%), Postives = 122/264 (46.21%), Query Frame = 3
Query:  192 NRISERSKQFAIDDLGENPSQVNAHIESFRRWVKS-------MPHLICPTDSE----FLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLG-RNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEG 947
             ++ + + Q A D+L E   +  + ++  R  +K        +   +  T  E     L++F+R  K+D  +  + +  +   R   R  P+ F   N+    V   +++     L  R+  G ++LL   E WD E+I  ++ L  + + L+ LL  EETQI+G  ++ + K  + +    +   ++ K  +M +QDS+P R K   F ++P  F   + +    M  K+  R     +D+   F++      +LP++++G+G
Sbjct:   38 TKVPDHTMQKAKDELNETDEKRTSAVKELRGIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDVNRAYELMKGYVRFR---RDYPELFE--NLTPEAVRSTIEAGYPGILSSRDKYGRVVLLFNIENWDYEEITFDEILRAYCVILEKLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDM-LQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDA--EILPSDFDGKG 293          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Match: rlbp1b (retinaldehyde binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1870])

HSP 1 Score: 77.411 bits (189), Expect = 5.803e-15
Identity = 61/264 (23.11%), Postives = 122/264 (46.21%), Query Frame = 3
Query:  192 NRISERSKQFAIDDLGENPSQVNAHIESFRRWVKS-------MPHLICPTDSE----FLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLG-RNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEG 947
             ++ + + Q A D+L E   +  + ++  R  +K        +   +  T  E     L++F+R  K+D  +  + +  +   R   R  P+ F   N+    V   +++     L  R+  G ++LL   E WD E+I  ++ L  + + L+ LL  EETQI+G  ++ + K  + +    +   ++ K  +M +QDS+P R K   F ++P  F   + +    M  K+  R     +D+   F++      +LP++++G+G
Sbjct:   38 TKVPDHTMQKAKDELNETDEKRTSAVKELRGIIKEKAETGDELAKGVQDTFGEKPDGVLVRFIRARKYDVNRAYELMKGYVRFR---RDYPELFE--NLTPEAVRSTIEAGYPGILSSRDKYGRVVLLFNIENWDYEEITFDEILRAYCVILEKLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDM-LQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDA--EILPSDFDGKG 293          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:NCBI gene;Acc:548930])

HSP 1 Score: 110.538 bits (275), Expect = 7.777e-26
Identity = 77/251 (30.68%), Postives = 120/251 (47.81%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCA 968
            A ++L E P      +++ R  V K  PHL    D  FLL+FLR  KFD+ +  + L N+ + R   +  P+ F   ++    V   LDS     L   D  G  I+ ++P  W     P+ + +   ++ L+ L+  EETQ++G+ +L D   V          P I K+    +QD +PIR+K     NEP IF  +F I   F+ +K+  R     +D+N     +P  K++LP EY G  G L+  A
Sbjct:   40 AREELQEKPEWRLRDVQALRDMVWKDYPHLKTRVDDSFLLRFLRARKFDYDRALQLLVNYYSCR---KAWPEVFT--DLRPSAVKPVLDSGFLTVLPHTDTEGRRIVCIRPGCWIPRDYPITENIRAIYLSLEKLVESEETQVNGIVILADYNGVGLTHASHFG-PFIAKKVIGILQDGFPIRIKAVNVINEPRIFKGIFAILKPFLKEKIVKRFFLHGSDLNSLHANIP--KSILPEEYGGTAGKLDTTA 282          

HSP 2 Score: 101.293 bits (251), Expect = 1.278e-22
Identity = 62/214 (28.97%), Postives = 109/214 (50.93%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            +FLL+FLR  KFD+D+A + L N+ + R +        +   ++  +   FL+   H     +  G  I  IR   W P   P+ + I  I++ L+ ++  EE+Q++GI +L D N +       +  P + K+   ++Q+ +P+R+K     NEP +F  I+ ++  F+ +K+ +R F   +D+      IP  + ILP EY G  G L+  A
Sbjct:   76 SFLLRFLRARKFDYDRALQLLVNYYSCRKAWPEVFTDLRPSAVKPVLDSGFLTVLPHT----DTEGRRIVCIRPGCWIPRDYPITENIRAIYLSLEKLVESEETQVNGIVILADYNGVGLTHASHFG-PFIAKKVIGILQDGFPIRIKAVNVINEPRIFKGIFAILKPFLKEKIVKRFFLHGSDLNSLHANIP--KSILPEEYGGTAGKLDTTA 282          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: clvs1 (clavesin 1 [Source:NCBI gene;Acc:100037913])

HSP 1 Score: 95.5153 bits (236), Expect = 8.317e-21
Identity = 70/244 (28.69%), Postives = 112/244 (45.90%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDP-IVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF+  +  + L  +   R     + D F     DDP I    +D    +   R+  G  ILL+    WD  +      L    + L++L+ ++E QI+G  L+ID  + S K    +  P IL+     +QDS+P R     F N+P     ++ I   F+ DK R R     N++N   + +      LP+E+   GGTL
Sbjct:   38 ELNENPDTLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFNQMEAFRLLAQYFQYRQL---NLDMFKNLKADDPGIKRALMDGFPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQASKLT-PSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PDCLPSEF---GGTL 272          

HSP 2 Score: 69.3218 bits (168), Expect = 4.424e-12
Identity = 57/205 (27.80%), Postives = 97/205 (47.32%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF+  +A R L  +   R       +  K     D  ++  L       L   D  G  I L+ +  WD  +   V ++  I + L+++I  +E QI+G  ++ID ++ S K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ DK ++R F   N++    + I      LP+E+ G
Sbjct:   72 FILRFLRARKFNQMEAFRLLAQYFQYRQLNLDMFKNLKAD---DPGIKRALMDGFPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQ-ASKLTPSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PDCLPSEFGG 270          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: clvs1 (clavesin 1 [Source:NCBI gene;Acc:100037913])

HSP 1 Score: 95.1301 bits (235), Expect = 1.106e-20
Identity = 70/244 (28.69%), Postives = 112/244 (45.90%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDP-IVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF+  +  + L  +   R     + D F     DDP I    +D    +   R+  G  ILL+    WD  +      L    + L++L+ ++E QI+G  L+ID  + S K    +  P IL+     +QDS+P R     F N+P     ++ I   F+ DK R R     N++N   + +      LP+E+   GGTL
Sbjct:   19 ELNENPDTLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFNQMEAFRLLAQYFQYRQL---NLDMFKNLKADDPGIKRALMDGFPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQASKLT-PSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PDCLPSEF---GGTL 253          

HSP 2 Score: 69.3218 bits (168), Expect = 4.617e-12
Identity = 57/205 (27.80%), Postives = 97/205 (47.32%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF+  +A R L  +   R       +  K     D  ++  L       L   D  G  I L+ +  WD  +   V ++  I + L+++I  +E QI+G  ++ID ++ S K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ DK ++R F   N++    + I      LP+E+ G
Sbjct:   53 FILRFLRARKFNQMEAFRLLAQYFQYRQLNLDMFKNLKAD---DPGIKRALMDGFPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQ-ASKLTPSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PDCLPSEFGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: thg1l (tRNA-histidine guanylyltransferase 1-like [Source:Xenbase;Acc:XB-GENE-966760])

HSP 1 Score: 88.5817 bits (218), Expect = 1.620e-18
Identity = 62/239 (25.94%), Postives = 108/239 (45.19%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNG 941
            +L ENP  ++  I+  R  V + P +    TD  F+L+FLR  KF+H +  + L  +   R     + D F  F   DP +   L       L   D  G  IL++    WD  +  +   L    + L+ ++ + E Q++G  L+ID  + + K    +  P +L+     +QDS+P R     F N+P     ++ +   F+ +K R R     N++N   + +     +LP+E+ G
Sbjct:   19 ELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQ---NLDMFKNFKATDPGIKQGLKDGFPGVLSNLDHFGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIH--PEILPSEFGG 251          

HSP 2 Score: 69.3218 bits (168), Expect = 4.585e-12
Identity = 54/215 (25.12%), Postives = 99/215 (46.05%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-----------GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF+H +A R L  +   R                  + + F ++   I  G  D            G  I ++ +  WD  +  +V ++  I + L+ +I   E Q++G  ++ID ++ + K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ +K ++R F   N++    + I    +ILP+E+ G
Sbjct:   53 FILRFLRARKFNHFEAFRLLAQYFEYRQQNL-------------DMFKNFKATDPGIKQGLKDGFPGVLSNLDHFGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQ-ASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIH--PEILPSEFGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Match: ggh (gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase) [Source:NCBI gene;Acc:594986])

HSP 1 Score: 85.1149 bits (209), Expect = 1.266e-17
Identity = 58/222 (26.13%), Postives = 106/222 (47.75%), Query Frame = 3
Query:  327 EFLLKFLRVSKFDHKKTQKRLDNFCTVRS-SPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKND----INKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKW 977
            +FLL+FLR   F  +   K L N+   R+  P  + D         PI+D++      +   R+D+G  +L+ + E WD +     +   +  +  ++++ E ETQ +G+  + DL+   R +      P + K+    + DS+P++++     NEP+ F  VF I   F+ DK++ R H   ++    +N+ F       ++LP EY G G  +    E+W
Sbjct:   50 DFLLRFLRARDFCIELAFKLLKNYHKWRAECPEITADL-----RPSPILDLFRAGYHAVLRSRDDSGSKVLIYRIEYWDPKLFTAYEVFRVSLITSELIVQEAETQRNGIKAIFDLQGW-RLAHAFQITPTMAKRIAAVMADSFPLKVRGVHLINEPLFFHPVFAIIKPFLPDKIKQRVHMHGSNYIPTLNQHFS-----TSILPPEYGGTGPAMSELCEEW 260          

HSP 2 Score: 83.1889 bits (204), Expect = 5.622e-17
Identity = 58/228 (25.44%), Postives = 108/228 (47.37%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEK-----ILPTEYNGQGGSLNECAEKWKNKFES 1860
            +FLL+FLR   F  + A + L N+   R+         +       ++  F +    +   ++D+G  + + R   WDP+     ++  +  +  ++I+   E+Q +GI+ + DL    R +      P + K+   V+ +S+PL+V+G    NEP+ F  ++ +I  F+ DK+K+R     ++       IP L +     ILP EY G G +++E  E+W     S
Sbjct:   50 DFLLRFLRARDFCIELAFKLLKNYHKWRAECPEITADLRP----SPILDLFRAGYHAVLRSRDDSGSKVLIYRIEYWDPKLFTAYEVFRVSLITSELIVQEAETQRNGIKAIFDLQGW-RLAHAFQITPTMAKRIAAVMADSFPLKVRGVHLINEPLFFHPVFAIIKPFLPDKIKQRVHMHGSNY------IPTLNQHFSTSILPPEYGGTGPAMSELCEEWTAHIMS 266          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Ttpal (tocopherol (alpha) transfer protein-like [Source:MGI Symbol;Acc:MGI:1923330])

HSP 1 Score: 108.227 bits (269), Expect = 4.204e-25
Identity = 76/248 (30.65%), Postives = 120/248 (48.39%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLE 959
            A ++L E P      +++ R  V K  P+L    D  FLL+FLR  KFD+ +  + L N+   R   R  P+ F   N+    +   L+S     L   D  G  +L ++P+ W     P+ + +   ++ L+ L+  EETQ++G+ +L D K VS         P I K+    +QD +PIR+K     NEP IF  +F I   F+ +K+  R     +D+N     +P  + +LP EY G  G L+
Sbjct:   44 AREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCR---RSWPEVFS--NLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGELD 283          

HSP 2 Score: 98.5969 bits (244), Expect = 7.336e-22
Identity = 62/213 (29.11%), Postives = 107/213 (50.23%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            FLL+FLR  KFD+D+A + L N+   R S        +   ++D +   FL+   H     +  G  +  IR + W P   P+ + I  +++ L+ +I  EE+Q++GI +L D   +S      +  P + K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +K+  R F   +D+      +P    ILP EY G  G L+  +
Sbjct:   81 FLLRFLRARKFDYDRALQLLVNYHGCRRSWPEVFSNLRPSALKDVLNSGFLTVLPHT----DPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGELDTAS 286          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Ttpal (tocopherol (alpha) transfer protein-like [Source:MGI Symbol;Acc:MGI:1923330])

HSP 1 Score: 108.227 bits (269), Expect = 4.204e-25
Identity = 76/248 (30.65%), Postives = 120/248 (48.39%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLE 959
            A ++L E P      +++ R  V K  P+L    D  FLL+FLR  KFD+ +  + L N+   R   R  P+ F   N+    +   L+S     L   D  G  +L ++P+ W     P+ + +   ++ L+ L+  EETQ++G+ +L D K VS         P I K+    +QD +PIR+K     NEP IF  +F I   F+ +K+  R     +D+N     +P  + +LP EY G  G L+
Sbjct:   44 AREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCR---RSWPEVFS--NLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGELD 283          

HSP 2 Score: 98.5969 bits (244), Expect = 7.336e-22
Identity = 62/213 (29.11%), Postives = 107/213 (50.23%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            FLL+FLR  KFD+D+A + L N+   R S        +   ++D +   FL+   H     +  G  +  IR + W P   P+ + I  +++ L+ +I  EE+Q++GI +L D   +S      +  P + K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +K+  R F   +D+      +P    ILP EY G  G L+  +
Sbjct:   81 FLLRFLRARKFDYDRALQLLVNYHGCRRSWPEVFSNLRPSALKDVLNSGFLTVLPHT----DPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGELDTAS 286          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Clvs1 (clavesin 1 [Source:MGI Symbol;Acc:MGI:1921688])

HSP 1 Score: 95.1301 bits (235), Expect = 1.108e-20
Identity = 71/244 (29.10%), Postives = 111/244 (45.49%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDP-IVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF      + L  +   R   + + D F  F  DDP I    +D    +   R+  G  ILL+    WD  +      L    + L++L+ + E QI+G  L+ID  + S K    +  P ILK     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +      LP+E+   GGTL
Sbjct:   41 ELNENPDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYR---QLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLT-PSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEF---GGTL 275          

HSP 2 Score: 68.9366 bits (167), Expect = 6.228e-12
Identity = 55/204 (26.96%), Postives = 95/204 (46.57%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF    A R L  +   R       + FK       + +  +     +   ++  G  I L+ +  WD  +     ++  I + L+++I   E QI+G  ++ID ++ S K   S   P +LK   + +Q+S+P R  G  F N+P     +Y LI  F+ DK ++R F   N++    + I    + LP+E+ G
Sbjct:   75 FILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPG--IKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQ-ASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEFGG 273          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Clvs1 (clavesin 1 [Source:MGI Symbol;Acc:MGI:1921688])

HSP 1 Score: 95.1301 bits (235), Expect = 1.108e-20
Identity = 71/244 (29.10%), Postives = 111/244 (45.49%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDP-IVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF      + L  +   R   + + D F  F  DDP I    +D    +   R+  G  ILL+    WD  +      L    + L++L+ + E QI+G  L+ID  + S K    +  P ILK     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +      LP+E+   GGTL
Sbjct:   41 ELNENPDILHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYR---QLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLT-PSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEF---GGTL 275          

HSP 2 Score: 68.9366 bits (167), Expect = 6.228e-12
Identity = 55/204 (26.96%), Postives = 95/204 (46.57%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF    A R L  +   R       + FK       + +  +     +   ++  G  I L+ +  WD  +     ++  I + L+++I   E QI+G  ++ID ++ S K   S   P +LK   + +Q+S+P R  G  F N+P     +Y LI  F+ DK ++R F   N++    + I    + LP+E+ G
Sbjct:   75 FILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPG--IKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQ-ASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEFGG 273          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Match: Clvs2 (clavesin 2 [Source:MGI Symbol;Acc:MGI:2443223])

HSP 1 Score: 88.5817 bits (218), Expect = 1.250e-18
Identity = 62/239 (25.94%), Postives = 107/239 (44.77%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNG 941
            +L ENP  ++  I+  R  V + P +    TD  F+L+FLR  KF H +  + L  +   R     + D F  F   DP +   L       L   D  G  IL++    WD  +  +   L    + L+ ++ + E Q++G  L+ID  + + K    +  P +L+     +QDS+P R     F N+P     ++ +   F+ +K R R     N++N   + +     +LP+E+ G
Sbjct:   19 ELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLLAQYFEYRQQ---NLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PNMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIH--PEILPSEFGG 251          

HSP 2 Score: 68.5514 bits (166), Expect = 5.275e-12
Identity = 56/205 (27.32%), Postives = 99/205 (48.29%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF H +A R L  +   R       + FK     D  ++  L       L   D  G  I ++ +  WD  +  +V ++  I + L+ +I   E Q++G  ++ID ++ + K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ +K ++R F   N++    + I    +ILP+E+ G
Sbjct:   53 FILRFLRARKFHHFEAFRLLAQYFEYRQQNLDMFKSFKAT---DPGIKQALKDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQ-ASKLTPNMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIH--PEILPSEFGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BTX7|TTPAL_HUMAN (Alpha-tocopherol transfer protein-like OS=Homo sapiens OX=9606 GN=TTPAL PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 2.609e-24
Identity = 75/248 (30.24%), Postives = 122/248 (49.19%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLE 959
            A ++L E P      +++ R  V K  P+L    D  FLL+FLR  KFD+ +  + L N+ + R   R  P+ F+  N+    +   L S     L   D  G  ++ ++P+ W     P+ + +   ++ L+ L+  EETQ++G+ +L D K VS         P I K+    +QD +PIR+K     NEP IF  +F I   F+ +K+  R     +D+N     +P  +++LP EY G  G L+
Sbjct:   43 AREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCR---RSWPEVFN--NLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGELD 282          

HSP 2 Score: 100.523 bits (249), Expect = 1.261e-21
Identity = 64/210 (30.48%), Postives = 107/210 (50.95%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLN 1824
            FLL+FLR  KFD+D+A + L N+ + R S        K   ++D +   FL+   H     +  G  +  IR + W P   P+ + I  I++ L+ +I  EE+Q++GI +L D   +S      +  P + K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +K+  R F   +D+      +P    ILP EY G  G L+
Sbjct:   80 FLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPH----TDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGELD 282          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D3D0|TTPAL_MOUSE (Alpha-tocopherol transfer protein-like OS=Mus musculus OX=10090 GN=Ttpal PE=1 SV=3)

HSP 1 Score: 108.227 bits (269), Expect = 2.941e-24
Identity = 76/248 (30.65%), Postives = 120/248 (48.39%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLE 959
            A ++L E P      +++ R  V K  P+L    D  FLL+FLR  KFD+ +  + L N+   R   R  P+ F   N+    +   L+S     L   D  G  +L ++P+ W     P+ + +   ++ L+ L+  EETQ++G+ +L D K VS         P I K+    +QD +PIR+K     NEP IF  +F I   F+ +K+  R     +D+N     +P  + +LP EY G  G L+
Sbjct:   44 AREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCR---RSWPEVFS--NLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGELD 283          

HSP 2 Score: 98.5969 bits (244), Expect = 5.132e-21
Identity = 62/213 (29.11%), Postives = 107/213 (50.23%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            FLL+FLR  KFD+D+A + L N+   R S        +   ++D +   FL+   H     +  G  +  IR + W P   P+ + I  +++ L+ +I  EE+Q++GI +L D   +S      +  P + K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +K+  R F   +D+      +P    ILP EY G  G L+  +
Sbjct:   81 FLLRFLRARKFDYDRALQLLVNYHGCRRSWPEVFSNLRPSALKDVLNSGFLTVLPHT----DPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RNILPKEYGGTAGELDTAS 286          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RFR0|TTPAL_PONAB (Alpha-tocopherol transfer protein-like OS=Pongo abelii OX=9601 GN=TTPAL PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.148e-24
Identity = 75/248 (30.24%), Postives = 122/248 (49.19%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLE 959
            A ++L E P      +++ R  V K  P+L    D  FLL+FLR  KFD+ +  + L N+ + R   R  P+ F+  N+    +   L S     L   D  G  ++ ++P+ W     P+ + +   ++ L+ L+  EETQ++G+ +L D K VS         P I K+    +QD +PIR+K     NEP IF  +F I   F+ +K+  R     +D+N     +P  +++LP EY G  G L+
Sbjct:   43 AREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCR---RSWPEVFN--NLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGELD 282          

HSP 2 Score: 100.523 bits (249), Expect = 1.237e-21
Identity = 64/210 (30.48%), Postives = 107/210 (50.95%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLN 1824
            FLL+FLR  KFD+D+A + L N+ + R S        K   ++D +   FL+   H     +  G  +  IR + W P   P+ + I  I++ L+ +I  EE+Q++GI +L D   +S      +  P + K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +K+  R F   +D+      +P    ILP EY G  G L+
Sbjct:   80 FLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPH----TDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFG-PFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLP--RSILPKEYGGTAGELD 282          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5M7E1|CLVS1_XENLA (Clavesin-1 OS=Xenopus laevis OX=8355 GN=clvs1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 4.597e-20
Identity = 70/244 (28.69%), Postives = 112/244 (45.90%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDP-IVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF+  +  + L  +   R     + D F     DDP I    +D    +   R+  G  ILL+    WD  +      L    + L++L+ ++E QI+G  L+ID  + S K    +  P IL+     +QDS+P R     F N+P     ++ I   F+ DK R R     N++N   + +      LP+E+   GGTL
Sbjct:   19 ELNENPDTLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFNQMEAFRLLAQYFQYRQL---NLDMFKNLKADDPGIKRALMDGFPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQASKLT-PSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PDCLPSEF---GGTL 253          

HSP 2 Score: 69.3218 bits (168), Expect = 2.402e-11
Identity = 57/205 (27.80%), Postives = 97/205 (47.32%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF+  +A R L  +   R       +  K     D  ++  L       L   D  G  I L+ +  WD  +   V ++  I + L+++I  +E QI+G  ++ID ++ S K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ DK ++R F   N++    + I      LP+E+ G
Sbjct:   53 FILRFLRARKFNQMEAFRLLAQYFQYRQLNLDMFKNLKAD---DPGIKRALMDGFPGVLENRDHYGRKILLLFAANWDQSRNSFVDILRAILLSLEVLIEDQELQINGFILIIDWSNFSFKQ-ASKLTPSILRLAIEGLQDSFPARFGGVHFVNQPWYIHALYTIIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PDCLPSEFGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IUQ0|CLVS1_HUMAN (Clavesin-1 OS=Homo sapiens OX=9606 GN=CLVS1 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.708e-20
Identity = 71/244 (29.10%), Postives = 110/244 (45.08%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDP-IVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF      + L  +   R     + D F  F  DDP I    +D    +   R+  G  ILL+    WD  +      L    + L++L+ + E QI+G  L+ID  + S K    +  P ILK     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +      LP+E+   GGTL
Sbjct:   41 ELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQL---NLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLT-PSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEF---GGTL 275          

HSP 2 Score: 68.5514 bits (166), Expect = 4.396e-11
Identity = 55/204 (26.96%), Postives = 95/204 (46.57%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF    A R L  +   R       + FK       + +  +     +   ++  G  I L+ +  WD  +     ++  I + L+++I   E QI+G  ++ID ++ S K   S   P +LK   + +Q+S+P R  G  F N+P     +Y LI  F+ DK ++R F   N++    + I    + LP+E+ G
Sbjct:   75 FILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPG--IKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQ-ASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIH--PEFLPSEFGG 273          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A158QTG8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3014 PE=4 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.615e-89
Identity = 104/301 (34.55%), Postives = 170/301 (56.48%), Query Frame = 3
Query:  192 NRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRS-SPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDY 1091
             ++  +  + A  +LGE P  V AH+E+FRRW+ SMPHL CP D +FL+ FLR  K+ H K Q RLDNFCT+ +    G   +    +++   +  YLD  + LP+G  + G+M++ ++P  W+ ++    +     +  + ++  +  T I G  ++I+L +V+   I  + +P +++   +  Q+S P R+K+  F NE  I      I+ F+M DK++ R   I +DI++AFE  PG+K +LP EY G+G +L    +  +  F  +Y  GDP   I V+E+KRP    +YL  YKDY
Sbjct:    5 QKLPSKYARIAKSELGEEPKNVPAHLEAFRRWLSSMPHLTCPDDDQFLIMFLRHCKYSHAKAQARLDNFCTLSTMKCIGEEIWATPVDLESKELRRYLDKGIHLPIGYTEDGKMVICLRPGEWNPDEFAFPRLFYYAYKVMFMVAFDPRTIIGGSVIIINLANVTPNQI--LKDPNVIRALVLFSQESIPGRVKRVFFYNESKIIGSALSIFLFYMKDKVKKRLQHIGSDISQAFEVEPGLKAILPPEYGGDGKSLAELIKDNRRHFYEFYGQGDPTSQIKVDESKRPVSARAYLREYKDY 303          

HSP 2 Score: 154.451 bits (389), Expect = 1.615e-89
Identity = 83/265 (31.32%), Postives = 145/265 (54.72%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCT-ARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSG 1983
            +FLL FLR +K+ H KA+ R+DNFCT + +   G         +E + ++ +L   +H+PLG  + G+++F IR   W+P++I   +L   ++  + ++     + I G   +++ +D++ K +    +P  ++   +  QE+ P R+K  ++YNE  L D    +   +M +KMK R  +V  D+ KA E  PG++ ++P +  G+G  L E  ++ K  F  +Y  G+P   I VDE+KRP +   YL ++ DY     GTSG
Sbjct:  343 DFLLMFLRHSKYVHAKAQARIDNFCTLSTTKIIGDTVLSTPVDLESKDLKKYLDWGVHLPLGYAEDGKLVFYIRLGAWNPDEISFSQLFYYVYKVVFMVTIDPRTLIGGTIFILNFSDMTTKQI--MRDPNTIRTVVRFNQEAMPARIKRFVYYNEGKLLDTTIAIFKFYMKEKMKNRIIQVGTDMNKAFEAEPGIKALMPPDVGGEGRPLEEVIKENKKNFYEFYGKGDPTSKIKVDETKRPVSARAYLHEYKDYDPNVMGTSG 605          

HSP 3 Score: 212.231 bits (539), Expect = 9.479e-55
Identity = 110/319 (34.48%), Postives = 174/319 (54.55%), Query Frame = 3
Query:  168 PMQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPR-GSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGT 1121
            P+  R       +     A  +LGE+P  + AH+E+FRRW+ SMPHL CP D +FLL FLR SK+ H K Q R+DNFCT+ ++   G        +++   +  YLD  V LPLG  + G+++  ++   W+ ++I  +Q     +  + ++  +  T I G   +++  D++ K I  M +P  ++      Q++ P R+K+ ++ NE  + D    I+ F+M +KM+ R  ++  D+NKAFE  PGIK ++P +  GEG  LE   ++ K  F  +Y  GDP   I V+E KRP    +YL  YKDY    +GT G 
Sbjct:  290 PVSARAYLREYKDYDPNLAKSELGEDPKNIPAHLEAFRRWLSSMPHLTCPDDDDFLLMFLRHSKYVHAKAQARIDNFCTLSTTKIIGDTVLSTPVDLESKDLKKYLDWGVHLPLGYAEDGKLVFYIRLGAWNPDEISFSQLFYYVYKVVFMVTIDPRTLIGGTIFILNFSDMTTKQI--MRDPNTIRTVVRFNQEAMPARIKRFVYYNEGKLLDTTIAIFKFYMKEKMKNRIIQVGTDMNKAFEAEPGIKALMPPDVGGEGRPLEEVIKENKKNFYEFYGKGDPTSKIKVDETKRPVSARAYLHEYKDYDPNVMGTSGC 606          

HSP 4 Score: 140.584 bits (353), Expect = 1.024e-30
Identity = 82/256 (32.03%), Postives = 136/256 (53.12%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCT-ARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDY 1956
             FL+ FLR  K+ H KA+ RLDNFCT +     G E +     +E + ++ +L   +H+P+G  + G+++  +R   W+P++    +L    +  + ++     + I G  ++I+L +++   +    +P +++      QES P RVK   FYNE  +      +   +M DK+K+R   + +DI +A E  PGL+ ILP EY G G SL E  +  +  F  +Y  G+P   I VDESKRP +   YL ++ DY
Sbjct:   50 QFLIMFLRHCKYSHAKAQARLDNFCTLSTMKCIGEEIWATPVDLESKELRRYLDKGIHLPIGYTEDGKMVICLRPGEWNPDEFAFPRLFYYAYKVMFMVAFDPRTIIGGSVIIINLANVTPNQI--LKDPNVIRALVLFSQESIPGRVKRVFFYNESKIIGSALSIFLFYMKDKVKKRLQHIGSDISQAFEVEPGLKAILPPEYGGDGKSLAELIKDNRRHFYEFYGQGDPTSQIKVDESKRPVSARAYLREYKDY 303          

HSP 5 Score: 121.324 bits (303), Expect = 1.207e-24
Identity = 90/305 (29.51%), Postives = 130/305 (42.62%), Query Frame = 3
Query:  216 QFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTK 1130
            + A  +LGE+P  ++AHIE+FRRW+ SMPHL CP D  FLL FLR  K                                       Y+ SK Q    R D    +  MK  G +    PV                  + +   L   +D  DV  KS + + +P +++      Q++ P R+K+ I+  E  + D    I++F+MN+KMR R                 +K      +    G   +C E+ K RF  +Y++GDP   I V+E+KRP    +YL  YKDY    +GT GTF K
Sbjct:  632 KLAKSELGEDPKNISAHIEAFRRWLSSMPHLTCPDDDNFLLMFLRHCK---------------------------------------YVHSKAQ---ARIDNFCTLSTMKCVGEEIWATPV------------------DLKSKALRSYLDRGDV--KSNQVVKDPVVIRTMVRYTQEALPGRVKRVIYYKEGKLVDAALTIFAFYMNEKMRSR-----------------VKLTCQVFWFFNSGL--FCLEENKKRFLEFYEHGDPTSTIKVDESKRPVSARAYLREYKDYDPNVMGTSGTFIK 855          

HSP 6 Score: 75.0998 bits (183), Expect = 3.431e-10
Identity = 51/161 (31.68%), Postives = 78/161 (48.45%), Query Frame = 1
Query: 1513 GIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTK 1995
             +R  +D  D+  KS +   +P +++   +  QE+ P RVK  I+Y E  L D    + + +MN+KM+ R   VK   +       GL                 C E+ K +F  +Y++G+P   I VDESKRP +   YL ++ DY     GTSG+F K
Sbjct:  716 ALRSYLDRGDV--KSNQVVKDPVVIRTMVRYTQEALPGRVKRVIYYKEGKLVDAALTIFAFYMNEKMRSR---VKLTCQVFWFFNSGLF----------------CLEENKKRFLEFYEHGDPTSTIKVDESKRPVSARAYLREYKDYDPNVMGTSGTFIK 855          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A5J4P3R6 (CRAL-TRIO domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006189 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 6.128e-71
Identity = 119/315 (37.78%), Postives = 186/315 (59.05%), Query Frame = 3
Query:  192 NRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFE 1136
            N +S+  +  A  ++GE    V AH+ SF+RW+ S PHL  P +  FLL FLR + ++H   Q+R+DNFCT+R S +    ++ Y  V+DP++D YL++ + +PLG  ++G  ++L++   W   +I   +  +L  M  + LL ++  QI G  L+ID+   S ++     + K  K     +Q++ P R+K  +F  E  IFD  F++   +M+DKMRGR  R+K++I KAF+KVPG+K +LP EY G+ GTL  C  +     K +Y  G PLK I V+E KRP    +Y+  YK++  P +GT GTF K +
Sbjct:    7 NSLSQFFRDLAKKEVGEKYDHVGAHLISFKRWLASSPHLKLPQNDVFLLSFLRYAHYEHALAQRRIDNFCTLRCSDKLISQWYDYPTVEDPLLDTYLNAGIFIPLGFLESGLYVVLIRMASWSPTEISQVEMRTLNNMNFERLLFDQRCQIGGFVLMIDMAHSSLETARQWGDIKYAKSAFKLMQEASPARVKHLVFYKESKIFDFAFKLSELWMSDKMRGRVIRVKDNIQKAFKKVPGLKEILPEEYEGKNGTLASCVIRCSREVKEFYSKGYPLKDIQVDEDKRPASARNYIKEYKEFDAPMMGTSGTFVKID 321          

HSP 2 Score: 200.675 bits (509), Expect = 6.981e-55
Identity = 102/269 (37.92%), Postives = 165/269 (61.34%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFE 2001
            FLL FLR A ++H  A+RR+DNFCT R S K   +++ +  +ED ++ T+L++ + IPLG  ++G  + LIR   W P +I  V++  L  M  + ++  +  QI G  ++ID+   S ++   W + K  K   K++QE+ P RVK  +FY E  +FD  ++L  L+M+DKM+ R  RVK++I+KA +K+PGL++ILP EY G+ G+L  C  +   + + +Y  G P + I VDE KRP +  NY+ ++ ++     GTSG+F K +
Sbjct:   53 FLLSFLRYAHYEHALAQRRIDNFCTLRCSDKLISQWYDYPTVEDPLLDTYLNAGIFIPLGFLESGLYVVLIRMASWSPTEISQVEMRTLNNMNFERLLFDQRCQIGGFVLMIDMAHSSLETARQWGDIKYAKSAFKLMQEASPARVKHLVFYKESKIFDFAFKLSELWMSDKMRGRVIRVKDNIQKAFKKVPGLKEILPEEYEGKNGTLASCVIRCSREVKEFYSKGYPLKDIQVDEDKRPASARNYIKEYKEFDAPMMGTSGTFVKID 321          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A267E9H4 (CRAL-TRIO domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023111g1 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.992e-70
Identity = 125/322 (38.82%), Postives = 188/322 (58.39%), Query Frame = 3
Query:  183 YEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKV-PGIKTVLPTEYNGEGGTL-EYCAEKWKHRFKTYYKNGD--PLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFE 1136
            Y Y  +  + K+ A  +L ENP QV AHI S RRWV S PHL CPTD  FLL+FLR +KFD  + Q+ +DNFCTVR SPRGSP++F    +D PI++  L   + + LG ND GE I+    + +D ++I  N      +M  D ++  E+ QI+G   +++LK+ ++K  +A   P+   +     QD++P+R K  ++ +EP  F+++F+I   FM +K+R R HR   D NK  + + PG + +LP E  G+   + E  AE++K  FK+     +   L  I+V+E+KR   T  YL  Y D   P++G  GTFTK +
Sbjct:   10 YNYEGVDPKDKKKAQKELHENPDQVRAHIASLRRWVTSAPHLTCPTDDAFLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEEALKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNWQDAFPMRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTDFNKLKKAIGPGAERLLPPEMGGQNRPMEELLAERYKM-FKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSMGIAGTFTKLD 330          

HSP 2 Score: 159.844 bits (403), Expect = 6.067e-40
Identity = 95/277 (34.30%), Postives = 160/277 (57.76%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEP----KLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKI-PGLEKILPTEYNGQGGSLNE-CAEKWKNKFESYYKNGN--PFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFE 2001
            FLL+FLR AKFD  +A++ +DNFCT R S +GS E+F+   ++  +++  L   M+I LG ND GE I     + +DP++I    L    +M  D ++  E+ QI+G R +++L + ++K  ++W  P    K+++ W    Q+++P+R K  ++++EP  F+L++ +I  FM +K+++R  R   D  K  + I PG E++LP E  GQ   + E  AE++K  F+S            I+VDESKR     +YL  + D  + + G +G+FTK +
Sbjct:   59 FLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEEALKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNW----QDAFPMRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTDFNKLKKAIGPGAERLLPPEMGGQNRPMEELLAERYK-MFKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSMGIAGTFTKLD 330          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A267GCN2 (CRAL-TRIO domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023111g3 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 4.379e-70
Identity = 125/322 (38.82%), Postives = 188/322 (58.39%), Query Frame = 3
Query:  183 YEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKV-PGIKTVLPTEYNGEGGTL-EYCAEKWKHRFKTYYKNGD--PLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFE 1136
            Y Y  +  + K+ A  +L ENP QV AHI S RRWV S PHL CPTD  FLL+FLR +KFD  + Q+ +DNFCTVR SPRGSP++F    +D PI++  L   + + LG ND GE I+    + +D ++I  N      +M  D ++  E+ QI+G   +++LK+ ++K  +A   P+   +     QD++PIR K  ++ +EP  F+++F+I   FM +K+R R HR   D +K  + + PG + +LP E  G+   + E  AE++K  FK+     +   L  I+V+E+KR   T  YL  Y D   P++G  GTFTK +
Sbjct:   10 YNYEGVDPKDKKKAQKELHENPDQVRAHIASLRRWVTSAPHLTCPTDDAFLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEETLKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNWQDAFPIRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTDFSKLKKAIGPGAERLLPPEMGGQNRPMEELLAERYKM-FKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSMGIAGTFTKLD 330          

HSP 2 Score: 159.844 bits (403), Expect = 7.781e-40
Identity = 95/277 (34.30%), Postives = 160/277 (57.76%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEP----KLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKI-PGLEKILPTEYNGQGGSLNE-CAEKWKNKFESYYKNGN--PFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFE 2001
            FLL+FLR AKFD  +A++ +DNFCT R S +GS E+F+   ++  +++  L   M+I LG ND GE I     + +DP++I    L    +M  D ++  E+ QI+G R +++L + ++K  ++W  P    K+++ W    Q+++P+R K  ++++EP  F+L++ +I  FM +K+++R  R   D  K  + I PG E++LP E  GQ   + E  AE++K  F+S            I+VDESKR     +YL  + D  + + G +G+FTK +
Sbjct:   59 FLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEETLKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNW----QDAFPIRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTDFSKLKKAIGPGAERLLPPEMGGQNRPMEELLAERYK-MFKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSMGIAGTFTKLD 330          
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Match: A0A267DVC9 (CRAL-TRIO domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023111g2 PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 4.520e-70
Identity = 125/322 (38.82%), Postives = 188/322 (58.39%), Query Frame = 3
Query:  183 YEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKV-PGIKTVLPTEYNGEGGTL-EYCAEKWKHRFKTYYKNGD--PLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFE 1136
            Y Y  +  + K+ A  +L ENP QV AHI S RRWV S PHL CPTD  FLL+FLR +KFD  + Q+ +DNFCTVR SPRGSP++F    +D PI++  L   + + LG ND GE I+    + +D ++I  N      +M  D ++  E+ QI+G   +++LK+ ++K  +A   P+   +     QD++PIR K  ++ +EP  F+++F+I   FM +K+R R HR   D +K  + + PG + +LP E  G+   + E  AE++K  FK+     +   L  I+V+E+KR   T  YL  Y D   P++G  GTFTK +
Sbjct:   10 YNYEGVDPKDKKKAQKELHENPDQVRAHIASLRRWVTSAPHLTCPTDDAFLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEEALKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNWQDAFPIRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTDFSKLKKAIGPGAERLLPPEMGGQNRPMEELLAERYKM-FKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSMGIAGTFTKLD 330          

HSP 2 Score: 159.844 bits (403), Expect = 7.404e-40
Identity = 95/277 (34.30%), Postives = 160/277 (57.76%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEP----KLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKI-PGLEKILPTEYNGQGGSLNE-CAEKWKNKFESYYKNGN--PFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFE 2001
            FLL+FLR AKFD  +A++ +DNFCT R S +GS E+F+   ++  +++  L   M+I LG ND GE I     + +DP++I    L    +M  D ++  E+ QI+G R +++L + ++K  ++W  P    K+++ W    Q+++P+R K  ++++EP  F+L++ +I  FM +K+++R  R   D  K  + I PG E++LP E  GQ   + E  AE++K  F+S            I+VDESKR     +YL  + D  + + G +G+FTK +
Sbjct:   59 FLLRFLRTAKFDQSRAQQLVDNFCTVRKSPRGSPEWFEPLPLDSPIIEEALKLPMNIFLGYNDDGEGIIYSSMDNYDPDRINFNDLARFAYMNADTMMKPEKIQINGCRFIMNLKNANKKQTQAWENPRTAFKMMRNW----QDAFPIRTKALVYWHEPAFFELMFRIIMPFMKEKLRKRLHRCGTDFSKLKKAIGPGAERLLPPEMGGQNRPMEELLAERYK-MFKSAEAQAERAKLATITVDESKRLPTTKDYLKTYDDSADPSMGIAGTFTKLD 330          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:103043466])

HSP 1 Score: 101.293 bits (251), Expect = 6.250e-23
Identity = 81/283 (28.62%), Postives = 130/283 (45.94%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYK-------NGDPLKGISVEEA 1043
            A ++L E P      +++ R  + K  P+L    D  FLL+FLR  KFD+ +  + L N+     S R  P+ F   ++    V   LD      L R D  G  IL ++P  W          +   ++ L+ L+  EETQ++G+ +L+D   V   S  +   P + K+    +QD +PIR+K     NEP IF  +F I   F+ +KM  R     +D++     +P  ++VLP EY G  G L+  A  W        +         DPL+G+ + ++
Sbjct:   45 AREELQEKPEWRLRDVQALRDMILKEQPNLRTRLDDAFLLRFLRARKFDYDRAMQLLLNY---HGSRRAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYHFVDNIRAIYLTLEKLIQPEETQVNGIVILVDYTGVG-LSQASNPGPLLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLSSLHRVIP--RSVLPEEYGGVAGRLDMSA--WARTLLEAEEEFVVEFCQPDPLEGVVLPDS 317          

HSP 2 Score: 93.2041 bits (230), Expect = 3.490e-20
Identity = 67/214 (31.31%), Postives = 107/214 (50.00%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            FLL+FLR  KFD+D+A + L N+  +R +     +  K   ++  +   FL+      L + D  G  I  +R   W P     V  I  I++ L+ +I  EE+Q++GI +L+D   +   S  S   P L K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +KM ER     +D+      IP    +LP EY G  G L+  A
Sbjct:   82 FLLRFLRARKFDYDRAMQLLLNYHGSRRAWPEVFQDLKPSTVKHVLDLGFLTV-----LPRPDPQGRYILCLRPGKWKPNDYHFVDNIRAIYLTLEKLIQPEETQVNGIVILVDYTGVG-LSQASNPGPLLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLSSLHRVIP--RSVLPEEYGGVAGRLDMSA 287          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:103043466])

HSP 1 Score: 101.293 bits (251), Expect = 6.467e-23
Identity = 76/251 (30.28%), Postives = 119/251 (47.41%), Query Frame = 3
Query:  222 AIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCA 968
            A ++L E P      +++ R  + K  P+L    D  FLL+FLR  KFD+ +  + L N+     S R  P+ F   ++    V   LD      L R D  G  IL ++P  W          +   ++ L+ L+  EETQ++G+ +L+D   V   S  +   P + K+    +QD +PIR+K     NEP IF  +F I   F+ +KM  R     +D++     +P  ++VLP EY G  G L+  A
Sbjct:   46 AREELQEKPEWRLRDVQALRDMILKEQPNLRTRLDDAFLLRFLRARKFDYDRAMQLLLNY---HGSRRAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPQGRYILCLRPGKWKPNDYHFVDNIRAIYLTLEKLIQPEETQVNGIVILVDYTGVG-LSQASNPGPLLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLSSLHRVIP--RSVLPEEYGGVAGRLDMSA 288          

HSP 2 Score: 92.8189 bits (229), Expect = 4.339e-20
Identity = 67/214 (31.31%), Postives = 107/214 (50.00%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            FLL+FLR  KFD+D+A + L N+  +R +     +  K   ++  +   FL+      L + D  G  I  +R   W P     V  I  I++ L+ +I  EE+Q++GI +L+D   +   S  S   P L K+   ++Q+ +P+R+K     NEP +F  I+ +I  F+ +KM ER     +D+      IP    +LP EY G  G L+  A
Sbjct:   83 FLLRFLRARKFDYDRAMQLLLNYHGSRRAWPEVFQDLKPSTVKHVLDLGFLTV-----LPRPDPQGRYILCLRPGKWKPNDYHFVDNIRAIYLTLEKLIQPEETQVNGIVILVDYTGVG-LSQASNPGPLLAKKVVSILQDGFPIRIKAVNIINEPRIFKGIFAIIKPFLKEKMAERYVLHGSDLSSLHRVIP--RSVLPEEYGGVAGRLDMSA 288          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:103047212])

HSP 1 Score: 90.1225 bits (222), Expect = 3.691e-19
Identity = 67/274 (24.45%), Postives = 120/274 (43.80%), Query Frame = 3
Query:  156 FTPLPMQDRYEYNR----------ISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNG 941
            F PLP+  +++  +          +S  + + A  +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF+H +  + L  +   R     + D F      DP +   L       L   D  G  IL++    WD  +      L    + L+ ++ + E Q++G  L+ID  + + K    +  P +L+     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +  +  +LP+E  G
Sbjct:    1 FQPLPLLTKFQGEKEDTMTHLQAGLSPETLEKAKVELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQ---NLDMFKNLKATDPGIKQALKDGFPGVLSNLDRHGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI--VPEILPSELGG 268          

HSP 2 Score: 70.0922 bits (170), Expect = 1.884e-12
Identity = 56/205 (27.32%), Postives = 98/205 (47.80%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF+H +A R L  +   R       +  K     D  ++  L       L   D  G  I ++ +  WD  +   V ++  I + L+ +I   E Q++G  ++ID ++ + K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ DK ++R F   N++    + I  + +ILP+E  G
Sbjct:   70 FILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKAT---DPGIKQALKDGFPGVLSNLDRHGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQ-ASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI--VPEILPSELGG 268          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:103047212])

HSP 1 Score: 87.8113 bits (216), Expect = 2.157e-18
Identity = 61/239 (25.52%), Postives = 106/239 (44.35%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNG 941
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF+H +  + L  +   R     + D F      DP +   L       L   D  G  IL++    WD  +      L    + L+ ++ + E Q++G  L+ID  + + K    +  P +L+     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +  +  +LP+E  G
Sbjct:   19 ELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQ---NLDMFKNLKATDPGIKQALKDGFPGVLSNLDRHGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI--VPEILPSELGG 251          

HSP 2 Score: 69.707 bits (169), Expect = 1.912e-12
Identity = 56/205 (27.32%), Postives = 98/205 (47.80%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF+H +A R L  +   R       +  K     D  ++  L       L   D  G  I ++ +  WD  +   V ++  I + L+ +I   E Q++G  ++ID ++ + K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ DK ++R F   N++    + I  + +ILP+E  G
Sbjct:   53 FILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKAT---DPGIKQALKDGFPGVLSNLDRHGRKILVLFAANWDQSRYTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQ-ASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLI--VPEILPSELGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Match: ttpa (tocopherol (alpha) transfer protein [Source:ZFIN;Acc:ZDB-GENE-030131-4631])

HSP 1 Score: 88.1965 bits (217), Expect = 3.290e-18
Identity = 74/260 (28.46%), Postives = 123/260 (47.31%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPL-GQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWA-------EPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAM-EKIPGLEKILPTEYNGQGGSLNECAEKWKN---KFESYYKNGNPFECISVD--ESKRPKANSN 1932
            FLLKFLR   FD D A + L N+   R          +        V   L +  H  L  ++DAG  I + R + W+P++    ++  +  +  ++I+   ++QI+G++ + DL        + W         P L K+   V+ +S+PL+V+G    NEP+ F  ++++I  F+ DK+K+R     +    ++ E  P  + I P EY G G  L E  E+W +   + E Y +       +SVD  E+K P AN N
Sbjct:   48 FLLKFLRARDFDLDLALKLLINYHKWRQECPEISANLQPSS-----VIGLLKNNYHGVLKSRDDAGSRILIYRISQWNPKEFSAYEVFRVSLITSELIVQERDTQINGLKAIFDL--------QGWCFAHAFQINPFLAKKISSVLTDSFPLKVRGIHLINEPIFFRPVFKMIRPFLPDKIKQRVHIHGSSYTASLYEHFP--KAIFPPEYGGTGPGLAEACEEWTDFIMQSEDYLQR------LSVDLGETKVP-ANKN 285          

HSP 2 Score: 80.1073 bits (196), Expect = 1.641e-15
Identity = 57/218 (26.15%), Postives = 103/218 (47.25%), Query Frame = 3
Query:  330 FLLKFLRVSKFDHKKTQKRLDNFCTVRS-SPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKA-FEKVPGIKTVLPTEYNGEGGTLEYCAEKW 977
            FLLKFLR   FD     K L N+   R   P  S +          ++ +  ++   +   R+DAG  IL+ +   W+ ++    +   +  +  ++++ E +TQI+GL  + DL+         +  P + K+ +  + DS+P++++     NEP+ F  VF++   F+ DK++ R H   +    + +E  P  K + P EY G G  L    E+W
Sbjct:   48 FLLKFLRARDFDLDLALKLLINYHKWRQECPEISANL-----QPSSVIGLLKNNYHGVLKSRDDAGSRILIYRISQWNPKEFSAYEVFRVSLITSELIVQERDTQINGLKAIFDLQGWCFAHAFQI-NPFLAKKISSVLTDSFPLKVRGIHLINEPIFFRPVFKMIRPFLPDKIKQRVHIHGSSYTASLYEHFP--KAIFPPEYGGTGPGLAEACEEW 257          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: ttpal (tocopherol (alpha) transfer protein-like [Source:ZFIN;Acc:ZDB-GENE-030131-296])

HSP 1 Score: 116.316 bits (290), Expect = 2.251e-29
Identity = 71/237 (29.96%), Postives = 119/237 (50.21%), Query Frame = 3
Query:  150 TSFTPLPMQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSK-VQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGR 857
            +  +PL M   Y  + +S    + A  +LGENP      ++  R  +   P +   TD  FLL+FLR  KFDH+KT K ++++     +    PD F  F      V   L S  +++   R+  G  +++  P  W+    P+   +   +M +++L+  EETQ++G+T+L D K V    +     P ++K+    +QD++PIR+K     NEP IF  +F +   F+ +KMR R
Sbjct:   19 SQLSPLQMAGGYVCS-LSPELVERARVELGENPETRAQEVQKLREALARRPDIPARTDDAFLLRFLRARKFDHEKTFKLVESYYKCHET---WPDIFQNFRPS--AVKALLGSGFIRVLPERDSKGRRVIIQSPGKWNPSTTPMMDNIRAMYMTMELLIQSEETQVNGITILADHKGVRLAHVTNFT-PSLMKKITTVMQDAFPIRIKGHNTVNEPSIFKAMFALMKPFLKEKMRKR 248          

HSP 2 Score: 88.5817 bits (218), Expect = 6.928e-20
Identity = 50/187 (26.74%), Postives = 96/187 (51.34%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLG---------QNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTF 1728
            FLL+FLR  KFDH+K  + ++++     +                + Q F  S +   LG         ++  G  + +     W+P   PM+  I  ++M ++++I  EE+Q++GI +L D   +    + ++  P L+K+   V+Q+++P+R+KG    NEP +F  ++ L+  F+ +KM++R F
Sbjct:   78 FLLRFLRARKFDHEKTFKLVESYYKCHETW-------------PDIFQNFRPSAVKALLGSGFIRVLPERDSKGRRVIIQSPGKWNPSTTPMMDNIRAMYMTMELLIQSEETQVNGITILADHKGVRLAHVTNFT-PSLMKKITTVMQDAFPIRIKGHNTVNEPSIFKAMFALMKPFLKEKMRKRYF 250          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003570.1 (pep scaffold:Pmarinus_7.0:GL486699:2092:8510:1 gene:ENSPMAG00000003262.1 transcript:ENSPMAT00000003570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 1.365e-18
Identity = 54/159 (33.96%), Postives = 81/159 (50.94%), Query Frame = 3
Query:  195 RISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLID 668
            R+S    + A  +L E P      I++ R  +K  P +  PTD  FLL+FLR  KFD+ K    +DN+   R   R  PD F  F      V   L++ V   L + DA G  I++++P  W+    P    L + +M L++L+ +EETQ+ GL +L D
Sbjct:   31 RLSPHLVEVARQELQEKPEWRLRDIQALRDMLKEHPEIPAPTDDGFLLRFLRARKFDYDKALLLIDNYYKCR---RVWPDVFVNFYPSS--VRHVLEAGVVTALPQPDAQGRRIIVLRPGLWNPAVAPATDMLRVLYMTLEMLVRQEETQVCGLVVLAD 184          

HSP 2 Score: 63.5438 bits (153), Expect = 1.687e-11
Identity = 45/161 (27.95%), Postives = 77/161 (47.83%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHI-------PLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQ--ESYPLRVKGQI 1644
             FLL+FLR  KFD+DKA   +DN+   R                D  V  + SS  H+        L Q DA G  I ++R  +W+P   P   ++ +++M L++++  EE+Q+ G+ +L D   +      S   P  +++   V+Q   + P+ V G++
Sbjct:   75 GFLLRFLRARKFDYDKALLLIDNYYKCR------------RVWPDVFVNFYPSSVRHVLEAGVVTALPQPDAQGRRIIVLRPGLWNPAVAPATDMLRVLYMTLEMLVRQEETQVCGLVVLADYAGLGLAH-ASHLGPAFVRRVATVLQVGSTPPVSVSGRV 222          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007468.1 (pep scaffold:Pmarinus_7.0:GL477833:5549:9144:1 gene:ENSPMAG00000006747.1 transcript:ENSPMAT00000007468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.957e-17
Identity = 43/144 (29.86%), Postives = 74/144 (51.39%), Query Frame = 3
Query:  429 PDFFHYFNVDDPIVDMYLDSK-VQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGR 857
            PD F  F      V   LDS  +++   R+  G  +++  P  W+    P+       +M L++L+  EETQ++G+T+L+D K +    +     P ++K+    +QD++PIR+K     NEP IF  +F +   F  +KM+ R
Sbjct:    8 PDIFQDFRPSA--VKELLDSGFIRVLPERDSKGRRVIIQSPGKWNPSTTPIIDNFKAMYMTLELLIQSEETQVNGITILVDHKGMGLAHVTNFT-PSLMKKITTVIQDAFPIRIKGHHTINEPSIFKAMFALIKPFFKEKMQKR 148          

HSP 2 Score: 73.559 bits (179), Expect = 8.994e-16
Identity = 33/116 (28.45%), Postives = 68/116 (58.62%), Query Frame = 1
Query: 1375 QNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKER 1722
            ++  G  + +     W+P   P++     ++M L+++I  EE+Q++GI +L+D   +    + ++  P L+K+   V+Q+++P+R+KG    NEP +F  ++ LI  F  +KM++R
Sbjct:   34 RDSKGRRVIIQSPGKWNPSTTPIIDNFKAMYMTLELLIQSEETQVNGITILVDHKGMGLAHVTNFT-PSLMKKITTVIQDAFPIRIKGHHTINEPSIFKAMFALIKPFFKEKMQKR 148          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:566769])

HSP 1 Score: 56.225 bits (134), Expect = 2.132e-9
Identity = 44/167 (26.35%), Postives = 71/167 (42.51%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILK 725
            +L E P  +   I+  R  + + P +    TD  F+L+FLR  KF H +  K L  +   R       D F  F   D  +   L +     L  +D  G  IL++    WD  +      L    + L+ ++ E E Q++G  L+ID  + S K    +  P +L+
Sbjct:   20 ELCERPDAIQQDIQEVRDMIVTRPDIGFLRTDDAFVLRFLRARKFHHFEAFKLLAQYFEYRQQ---HLDMFKNFKATDQGIRQALRNGFPGVLSHSDHYGRKILVIFASNWDQIRYTFVDILRAILLSLETMIEEPELQVNGFVLIIDWSNFSFKQASKLT-PGMLR 182          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001440.1 (pep scaffold:Pmarinus_7.0:GL476337:1030926:1032713:1 gene:ENSPMAG00000001302.1 transcript:ENSPMAT00000001440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 8.789e-9
Identity = 35/107 (32.71%), Postives = 51/107 (47.66%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSK-VQLPLGRNDAGEMILLMKP 548
            +LGENP      ++  R  +   P +   TD  FLL+FLR  KFDH+KT K + N+     +    PD F  F      V   LDS  +++   R+  G  I++  P
Sbjct:   16 ELGENPETRAQEVQKLREALARRPDIPARTDDAFLLRFLRARKFDHEKTLKLIKNYYKCHQT---WPDVFQDFR--PSAVKNVLDSGFIRVVPQRDSQGRRIIIQSP 117          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Match: EDO45692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS70])

HSP 1 Score: 49.6766 bits (117), Expect = 3.105e-6
Identity = 51/194 (26.29%), Postives = 80/194 (41.24%), Query Frame = 3
Query:  309 ICPTDSEFLLKFLRVSKFD-------HKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGR----NDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGR 857
            + P  +   +KFL   KFD       +K   ++   +C    SP            +DP+    L  K  + LGR     DA   + +  P   D    P N+ L+     L+  +    TQ  GL LL D+ + S K+ +     KIL+     ++  YP R+K     + P+ F  V  I S F+ +K+R R
Sbjct:   38 LSPVGTTTAVKFLTARKFDIDRALLLYKSYLEKCRVYCINDMSP-----------YEDPLRQELLSGKFTI-LGRKRTTGDAINPLAVTTPS--DKVSRPSNKVLTGMVFQLEQAIKSPLTQRSGLVLLYDMSNSSYKNFDFDLSQKILE----LLKGGYPARLKSVFIISPPLWFKAVLLILSSFLREKIRER 213          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: ttpal (alpha tocopherol transfer protein like [Source:NCBI gene;Acc:101167039])

HSP 1 Score: 110.538 bits (275), Expect = 5.200e-26
Identity = 89/306 (29.08%), Postives = 141/306 (46.08%), Query Frame = 3
Query:  153 SFTPLPMQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWV-KSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRND-AGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKW-------KHRFKTYYKNGDPLKGISVEEA 1043
            S+ P P Q  Y      E   + A ++L E P      +++ R  + K  P+L    D  FLL+FLR  KFD+ +  + L N+   R   R  P+ F   ++    V   LD      L R D +G  IL ++P  W     P    +   ++ L+ L+  EETQ++G+ +L+D   V   S  +   P + K+    +QD +PIR+K     NEP+IF  +F I   F+ +KM  R     +D+      +P   +VLP EY G  G L+  A  W       +  F   +   DPL+G+ + ++
Sbjct:   22 SWFPPPPQPIYSCTLTPELEAK-AREELQEKPEWRLRDVQALRDMILKEQPNLHTRLDDAFLLRFLRARKFDYDRALQLLLNYHAGR---RAWPEVFQ--DLKPSTVKHVLDLGFLTVLPRPDPSGRYILCLRPGKWKPNDYPFVDNVRAIYLTLEKLIQPEETQVNGIIILVDYTGVG-MSQASNPGPFLAKKVVSILQDGFPIRIKAVNIINEPLIFKGIFAIIKPFLKEKMAERYILHGSDLRSLHRNLPA--SVLPEEYGGTAGRLDMGA--WSRLLLDCEEEFIVEFCQPDPLEGVMLPDS 316          

HSP 2 Score: 100.138 bits (248), Expect = 1.721e-22
Identity = 66/214 (30.84%), Postives = 110/214 (51.40%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQND-AGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECA 1833
            FLL+FLR  KFD+D+A + L N+   R +     +  K   ++  +   FL+      L + D +G  I  +R   W P   P V  +  I++ L+ +I  EE+Q++GI +L+D   +   S  S   P L K+   ++Q+ +P+R+K     NEP++F  I+ +I  F+ +KM ER     +D++     +P    +LP EY G  G L+  A
Sbjct:   81 FLLRFLRARKFDYDRALQLLLNYHAGRRAWPEVFQDLKPSTVKHVLDLGFLTV-----LPRPDPSGRYILCLRPGKWKPNDYPFVDNVRAIYLTLEKLIQPEETQVNGIIILVDYTGVG-MSQASNPGPFLAKKVVSILQDGFPIRIKAVNIINEPLIFKGIFAIIKPFLKEKMAERYILHGSDLRSLHRNLPA--SVLPEEYGGTAGRLDMGA 286          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: CLVS1 (clavesin-1 [Source:NCBI gene;Acc:101158238])

HSP 1 Score: 97.4413 bits (241), Expect = 9.818e-22
Identity = 72/244 (29.51%), Postives = 113/244 (46.31%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDD-PIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTL 956
            +L ENP  ++  I+  R  + + P +    TD +F+L+FLR  KFD  +T + L  +   R     + D F  F VDD  I    +D    +    +  G  IL++    WD  +      L    + L++L+   E QI+G  L+ID  + S K    +  P ILK     +QDS+P R     F N+P     ++ I   F+ DK R R     N++N   + +  +   LP+E+   GGTL
Sbjct:   19 ELNENPDTLHQDIQQVRDMIVTRPDIGFLRTDDDFILRFLRARKFDQLETFRLLAQYFQFRQQ---NLDMFQSFKVDDLGIKRALMDGFPGVLESPDQHGRKILILFASNWDQSRNSFIDILRAILLSLEVLIENPELQINGFILIIDWSNFSFKQASKLT-PNILKLAIEGLQDSFPARFGGIHFVNQPWYIHAMYTIIKPFLKDKTRKRIFLHGNNLNSLHQLI--LPECLPSEF---GGTL 253          

HSP 2 Score: 70.8626 bits (172), Expect = 7.106e-13
Identity = 56/216 (25.93%), Postives = 98/216 (45.37%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-----------GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            +F+L+FLR  KFD  +  R L  +   R                  + Q+F    + I     D            G  I ++ ++ WD  +   + ++  I + L+++I   E QI+G  ++ID ++ S K   S   P +LK   + +Q+S+P R  G  F N+P     +Y +I  F+ DK ++R F   N++    + I  L + LP+E+ G
Sbjct:   52 DFILRFLRARKFDQLETFRLLAQYFQFRQQNL-------------DMFQSFKVDDLGIKRALMDGFPGVLESPDQHGRKILILFASNWDQSRNSFIDILRAILLSLEVLIENPELQINGFILIIDWSNFSFKQ-ASKLTPNILKLAIEGLQDSFPARFGGIHFVNQPWYIHAMYTIIKPFLKDKTRKRIFLHGNNLNSLHQLI--LPECLPSEFGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: clvs2 (clavesin 2 [Source:NCBI gene;Acc:101159632])

HSP 1 Score: 84.7297 bits (208), Expect = 2.216e-17
Identity = 61/239 (25.52%), Postives = 105/239 (43.93%), Query Frame = 3
Query:  231 DLGENPSQVNAHIESFRRWVKSMPHL-ICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDA-GEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNG 941
            +L ENP  ++  I+  R  + + P +    TD  F+L+FLR  KF+H +  + L  +   R     + D F      DP +   L       L   D  G  IL++    WD  +      L    + L+ ++ + E Q++G  L+ID  + + K    +  P +L+     +QDS+P R     F N+P     ++ +   F+ DK R R     N++N   + +     +LP+E  G
Sbjct:   19 ELKENPDTLHQDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQ---NLDMFKNLKATDPGIKQALKDGFPGVLSNLDKYGRKILVLFAANWDQSRYTFVDILRAILLSLESMIEDPELQVNGFILIIDWSNFTFKQASKLT-PSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLIN--PEILPSELGG 251          

HSP 2 Score: 67.3958 bits (163), Expect = 9.966e-12
Identity = 56/205 (27.32%), Postives = 97/205 (47.32%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDA-GEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG 1806
            F+L+FLR  KF+H +A R L  +   R       +  K     D  ++  L       L   D  G  I ++ +  WD  +   V ++  I + L+ +I   E Q++G  ++ID ++ + K   S   P +L+   + +Q+S+P R  G  F N+P     +Y +I  F+ DK ++R F   N++    + I    +ILP+E  G
Sbjct:   53 FILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKAT---DPGIKQALKDGFPGVLSNLDKYGRKILVLFAANWDQSRYTFVDILRAILLSLESMIEDPELQVNGFILIIDWSNFTFKQ-ASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKDKTRKRIFMHGNNLNSLHQLIN--PEILPSELGG 251          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: rlbp1b (retinaldehyde binding protein 1 [Source:NCBI gene;Acc:101165475])

HSP 1 Score: 77.0258 bits (188), Expect = 6.753e-15
Identity = 61/262 (23.28%), Postives = 122/262 (46.56%), Query Frame = 3
Query:  198 ISERSKQFAIDDLGENPSQVNAHIESFRRWVKS-------MPHLICPTDSE----FLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPL-GRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEG 947
            + + ++Q A D+L E   +  A ++  R  +K        +   +  T  E     +++F+R  K+D  +  + +  +   R   R  P+ F   N+    V   +++     L  R+  G ++LL   E WD E+I  ++ L  + + L+ LL  EETQI+G  ++ + K  + +    +   ++ K  +M +QDS+P R K   F ++P  F   + +    M  K+  R     +++   +++      +LP+E+NG+G
Sbjct:   40 VPDHTRQKAKDELNETEEKRVAAVKELRAMIKEKADSGDELSKGVQDTFGEKPDAMMVRFIRARKYDVARAFELMKGYVRFR---RDYPELFE--NLTPEAVRSTIEAGYPGILHSRDKYGRVVLLFNIENWDYEEITFDEILRAYCVILEKLLENEETQINGFCIIENFKGFTMQQASGIKPTELKKMVDM-LQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKGKLLERVFVHGDELENYYKEFD--PEILPSEFNGKG 293          

HSP 2 Score: 60.8474 bits (146), Expect = 1.328e-9
Identity = 49/216 (22.69%), Postives = 100/216 (46.30%), Query Frame = 1
Query: 1198 LLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWK 1845
            +++F+R  K+D  +A   +  +   R       E        + V  T  +    I   ++  G ++ L     WD E+I   +++    + L+ ++  EE+QI+G  ++ +    + +   S  +P  LK+   ++Q+S+P R K   F ++P  F   Y ++   M  K+ ER F   ++++   ++     +ILP+E+NG+G   +  A   K
Sbjct:   96 MVRFIRARKYDVARAFELMKGYVRFRRDYPELFENLTP----EAVRSTIEAGYPGILHSRDKYGRVVLLFNIENWDYEEITFDEILRAYCVILEKLLENEETQINGFCIIENFKGFTMQQA-SGIKPTELKKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKGKLLERVFVHGDELENYYKEFD--PEILPSEFNGKGSKYDGKATAAK 304          
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Match: TTPA (alpha tocopherol transfer protein [Source:NCBI gene;Acc:101155881])

HSP 1 Score: 76.2554 bits (186), Expect = 9.141e-15
Identity = 60/225 (26.67%), Postives = 102/225 (45.33%), Query Frame = 3
Query:  315 PTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRF 989
            P    FLLKFLR   FD + + K L N+   R   R SP+     +    +  +++     LP  R+ AG  +L+ +   W+++     Q   +  M  +I+  E ETQ  GL  + DL+  S      +  P + K+ +  + DS+P++++     NEP  F  VF +   F+ +K++ R H    D +           VLP EY G G  ++   + W ++ 
Sbjct:   47 PLSDGFLLKFLRARDFDVELSLKLLLNYLRWR---RDSPEISSCLSPSSVLGLLHMSYHAVLP-QRDHAGSRVLIYRIGQWNTKDWSPYQVFRVSLMTSEIISMETETQRRGLKAIFDLQGWSLGHALQI-NPSLAKKISCVLSDSFPLKVRGIHLVNEPRFFRPVFAMIRPFLPEKIKQRIHMHGADFHSDLRHF-FHPHVLPPEYGGHGPGIDEACQDWTNQL 265          

HSP 2 Score: 72.0182 bits (175), Expect = 2.181e-13
Identity = 60/223 (26.91%), Postives = 97/223 (43.50%), Query Frame = 1
Query: 1192 NFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQND-AGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDIS-RKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKF 1854
             FLLKFLR   FD + + + L N+   R                   V   L    H  L Q D AG  + + R   W+ +     ++  +  M  +II    E+Q  G++ + DL   S   +L+    P L K+   V+ +S+PL+V+G    NEP  F  ++ +I  F+ +K+K+R      D    +        +LP EY G G  ++E  + W N+ 
Sbjct:   51 GFLLKFLRARDFDVELSLKLLLNYLRWRRDSPEISSCLSPSS-----VLGLLHMSYHAVLPQRDHAGSRVLIYRIGQWNTKDWSPYQVFRVSLMTSEIISMETETQRRGLKAIFDLQGWSLGHALQ--INPSLAKKISCVLSDSFPLKVRGIHLVNEPRFFRPVFAMIRPFLPEKIKQRIHMHGADFHSDLRHF-FHPHVLPPEYGGHGPGIDEACQDWTNQL 265          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009874.1 (SMESG000009874.1)

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 325/325 (100.00%), Postives = 325/325 (100.00%), Query Frame = 3
Query:  171 MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFENVL 1145
            MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFENVL
Sbjct:    1 MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFENVL 325          

HSP 2 Score: 341.658 bits (875), Expect = 2.704e-112
Identity = 161/272 (59.19%), Postives = 221/272 (81.25%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFENVF 2010
            FLLKFLRV+KFDH K ++RLDNFCT RSS +GS +FF +F ++D +V  +L SK+ +PLG+NDAGE+I L++   WD EKIP+ + + L FMGLDI+++ EE+QIHG+ +LIDL D+SRKS+E+ AEPK+LKQ++  VQ+SYP+R+K QIF NEPV+FD+++++ S FMNDKM+ RT R+KNDI KA EK+PG++ +LPTEYNG+GG+L  CAEKWK++F++YYKNG+P + ISV+E+KRPK  ++YL  + DY   T GT G+FTKFENV 
Sbjct:   54 FLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFENVL 325          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009872.1 (SMESG000009872.1)

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 274/274 (100.00%), Postives = 274/274 (100.00%), Query Frame = 1
Query: 1189 GNFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFENVF 2010
            GNFLLKFLRVAKFDHDKAERRLDNFCTARSSKKGSEEFFKFFKIEDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFENVF
Sbjct:   52 GNFLLKFLRVAKFDHDKAERRLDNFCTARSSKKGSEEFFKFFKIEDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFENVF 325          

HSP 2 Score: 445.277 bits (1144), Expect = 1.192e-152
Identity = 197/325 (60.62%), Postives = 263/325 (80.92%), Query Frame = 3
Query:  171 MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFENVL 1145
            M DRYEY+ +SE SK+ A++ L ENP QVNAHIES RRWVKSMPH+ CPTD  FLLKFLRV+KFDH K ++RLDNFCT RSS +GS +FF +F ++D +V  +L SK+ +PLG+NDAGE+I L++   WD EKIP+ + + L FMGLDI+++ EE+QIHG+ +LIDL D+SRKS+E+ AEPK+LKQ++  VQ+SYP+R+K QIF NEPV+FD+++++ S FMNDKM+ RT R+KNDI KA EK+PG++ +LPTEYNG+GG+L  CAEKWK++F++YYKNG+P + ISV+E+KRPK  ++YL  + DY   T GT G+FTKFENV 
Sbjct:    1 MNDRYEYSGVSENSKKAAVEYLNENPEQVNAHIESLRRWVKSMPHINCPTDGNFLLKFLRVAKFDHDKAERRLDNFCTARSSKKGSEEFFKFFKIEDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFENVF 325          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009876.1 (SMESG000009876.1)

HSP 1 Score: 464.151 bits (1193), Expect = 4.776e-160
Identity = 206/325 (63.38%), Postives = 269/325 (82.77%), Query Frame = 3
Query:  171 MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFENVL 1145
            M +RYEY+ ISE++KQFAIDD+GENPSQVNAHIESFRRW+KSMPHL CPTD++FL+KFLRVSKFDHK+ +KR+DN+CTVR+SPRGSP FF+ F+++DPI++ YL++ + LPLGR + GE I L++ + WD E+IP  + + L FM +DI+ ++EETQIHG+ ++IDLKD SRK++E+  +PK +KQ N  +Q+SYP+R+K  IF NEPVIFD+VFQ+ SFFMN+KM+ RT RIKNDINKA EK PG+  +LP EY G+GGT+  C+EKWK RFK +YKNG+P+ G SV+E+KRP+E+ASYL  Y DY G TLGT GT+TKFENV 
Sbjct:    1 MTERYEYSGISEKTKQFAIDDIGENPSQVNAHIESFRRWLKSMPHLQCPTDAKFLMKFLRVSKFDHKRAEKRIDNYCTVRASPRGSPSFFNTFSINDPIINTYLETGMHLPLGRTENGETIFLVRTKVWDPEQIPFPKLIILMFMAMDIICNDEETQIHGMKMIIDLKDASRKAMESWGDPKYMKQINRVMQESYPLRIKGTIFYNEPVIFDIVFQVLSFFMNEKMKSRTIRIKNDINKAIEKNPGLDKILPMEYGGQGGTITECSEKWKIRFKEFYKNGNPVSGFSVDESKRPQESASYLAEYPDYEGQTLGTQGTYTKFENVF 325          

HSP 2 Score: 362.844 bits (930), Expect = 1.923e-120
Identity = 164/274 (59.85%), Postives = 224/274 (81.75%), Query Frame = 1
Query: 1189 GNFLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFENVF 2010
              FL+KFLRV+KFDH +AE+R+DN+CT R+S +GS  FF  F I D ++ T+L + MH+PLG+ + GE IFL+R+ VWDPE+IP  KLI+L+FM +DII N EE+QIHG++M+IDL D SRK++ESW +PK +KQ ++V+QESYPLR+KG IFYNEPV+FD++++++S FMN+KMK RT R+KNDI KA+EK PGL+KILP EY GQGG++ EC+EKWK +F+ +YKNGNP    SVDESKRP+ +++YL ++ DY+ +T GT G++TKFENVF
Sbjct:   52 AKFLMKFLRVSKFDHKRAEKRIDNYCTVRASPRGSPSFFNTFSINDPIINTYLETGMHLPLGRTENGETIFLVRTKVWDPEQIPFPKLIILMFMAMDIICNDEETQIHGMKMIIDLKDASRKAMESWGDPKYMKQINRVMQESYPLRIKGTIFYNEPVIFDIVFQVLSFFMNEKMKSRTIRIKNDINKAIEKNPGLDKILPMEYGGQGGTITECSEKWKIRFKEFYKNGNPVSGFSVDESKRPQESASYLAEYPDYEGQTLGTQGTYTKFENVF 325          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009988.1 (SMESG000009988.1)

HSP 1 Score: 333.954 bits (855), Expect = 2.866e-109
Identity = 151/322 (46.89%), Postives = 211/322 (65.53%), Query Frame = 3
Query:  171 MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTLGTHGTFTKFE 1136
            M D Y Y+ +++R KQ A+ +L E+P QVNAHIESFRRWVKSMPHL CPTDS FLL FLRV+KFDH K QKRLDNFCTVRSS RG P++F + +++D + + +  +K  +PLGR   GE +       W+ ++IP+ + + + FM L++ L  +  QI+G+   +D+    +  +EA+++PK++K      QD YPIR K Q+   EP  + V + I  FF+N+K R R  RIK DI K FEK+PG++ +LP EY G+G  ++   +KW    + +Y  G P   ISV+E+KRP ET  Y   Y DY G +LGT GTFTKF+
Sbjct:    1 MADTYTYDGLTDRDKQVALTELNEDPKQVNAHIESFRRWVKSMPHLNCPTDSRFLLMFLRVAKFDHAKAQKRLDNFCTVRSSARGHPEYFQFPDINDAVFEKFFQTKQMIPLGRTVDGETLFFGVSNLWNPKEIPIKKLMQVMFMSLEVQLQNQYLQIYGMKAFMDMHGCGKSFMEAVSDPKVMKAMTRVWQDCYPIRFKGQVIYREPGWYSVFYNIMEFFLNEKHRKRVFRIKEDIQKGFEKIPGLEALLPEEYGGKGPKMDEAIDKWAKEVRDFYTKGSPWANISVDESKRPVETLKYFEQYADYTGESLGTKGTFTKFD 322          

HSP 2 Score: 247.669 bits (631), Expect = 3.853e-76
Identity = 119/269 (44.24%), Postives = 182/269 (67.66%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTFGTSGSFTKFE 2001
            FLL FLRVAKFDH KA++RLDNFCT RSS +G  E+F+F  I D V + F  +K  IPLG+   GE +F   SN+W+P++IP+ KL+ ++FM L++ +  +  QI+G++  +D++   +  +E+ ++PK++K   +V Q+ YP+R KGQ+ Y EP  + + Y ++  F+N+K ++R FR+K DI+K  EKIPGLE +LP EY G+G  ++E  +KW  +   +Y  G+P+  ISVDESKRP     Y   ++DY  ++ GT G+FTKF+
Sbjct:   54 FLLMFLRVAKFDHAKAQKRLDNFCTVRSSARGHPEYFQFPDINDAVFEKFFQTKQMIPLGRTVDGETLFFGVSNLWNPKEIPIKKLMQVMFMSLEVQLQNQYLQIYGMKAFMDMHGCGKSFMEAVSDPKVMKAMTRVWQDCYPIRFKGQVIYREPGWYSVFYNIMEFFLNEKHRKRVFRIKEDIQKGFEKIPGLEALLPEEYGGKGPKMDEAIDKWAKEVRDFYTKGSPWANISVDESKRPVETLKYFEQYADYTGESLGTKGTFTKFD 322          
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Match: SMESG000009877.1 (SMESG000009877.1)

HSP 1 Score: 309.301 bits (791), Expect = 7.913e-100
Identity = 150/325 (46.15%), Postives = 215/325 (66.15%), Query Frame = 3
Query:  171 MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPTDSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIVDMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDILLSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMKKQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTVLPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASYLVAYKDYVGPTL-GTHGTFTKFENV 1142
            M D Y+Y  +S R  +   +++ E+ +QVNAHIESFRRWV SMPHL CPTDS+FLL FLR +KFDH   Q+RLDNFCT+RSSPRGSP FF + ++ + I++  L S   +P+G++ AGEM+LL K   W  E+I V   L + +M  D++L+ E TQI+G+  + DL+   RK++EA ++P + K      QD++PIRMK  I    P +F ++ +I  FFM DK + R  +I +  +K F KV G+K ++PTEY G GG L+   E W    +T+Y  GDP   ISV+E KRP +T S+L  Y++Y G T+ GT G++TK+E++
Sbjct:    1 MADVYKYETLSVRDSEILKNEIKEDKNQVNAHIESFRRWVVSMPHLKCPTDSKFLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQ-DKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYEDL 324          

HSP 2 Score: 228.024 bits (580), Expect = 1.206e-68
Identity = 114/273 (41.76%), Postives = 184/273 (67.40%), Query Frame = 1
Query: 1195 FLLKFLRVAKFDHDKAERRLDNFCTARXXXXXXXXXXXXXXXXDQVVQTFLSSKMHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQIHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNEPVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNGQGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDYQNKTF-GTSGSFTKFENVF 2010
            FLL FLR AKFDH  A+RRLDNFCT RSS +GS  FFKF  +++ +++  L S  +IP+G++ AGE++ L ++  W PE+I +  ++ +++M  D+I+  E +QI+GI  + DL    RK+LE+W++P L K   ++ Q+++P+R+KG I Y  P LF +I +++  FM DK K+R  ++ +   K   K+ GL++I+PTEY G GG L +  E W  + E++Y  G+P+  ISVDE+KRP    ++L ++ +Y+ +T  GT GS+TK+E+++
Sbjct:   54 FLLMFLRTAKFDHSVAQRRLDNFCTIRSSPRGSPRFFKFPSLKNSIIEKVLRSHQNIPMGKDSAGEMVLLFKTGDWKPEEISVENILQVVYMTFDLILTRESTQINGIVSIFDLEGCCRKTLEAWSDPHLTKNIMRIWQDAFPIRMKGIILYKPPTLFHIILKIMEFFMIDKHKKRILQIDSQ-DKLFSKVSGLKEIMPTEYGGNGGKLKDKVESWIGEVETFYDKGDPWSFISVDENKRPGDTVSFLRNYEEYKGETIGGTPGSYTKYEDLY 325          
The following BLAST results are available for this feature:
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTPAL5.432e-2530.24alpha tocopherol transfer protein like [Source:HGN... [more]
TTPAL5.432e-2530.24alpha tocopherol transfer protein like [Source:HGN... [more]
CLVS11.189e-2029.10clavesin 1 [Source:HGNC Symbol;Acc:HGNC:23139][more]
CLVS11.189e-2029.10clavesin 1 [Source:HGNC Symbol;Acc:HGNC:23139][more]
CLVS21.444e-1825.94clavesin 2 [Source:HGNC Symbol;Acc:HGNC:23046][more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG339666.605e-3228.57gene:FBgn0053966 transcript:FBtr0100007[more]
CG316361.104e-2425.56gene:FBgn0051636 transcript:FBtr0079324[more]
CG316361.104e-2425.56gene:FBgn0051636 transcript:FBtr0343865[more]
CG339651.714e-2425.56gene:FBgn0053965 transcript:FBtr0100006[more]
CG129261.737e-2428.24gene:FBgn0033437 transcript:FBtr0088502[more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal1.061e-2329.33tocopherol (alpha) transfer protein-like [Source:Z... [more]
ttpal2.393e-2330.00tocopherol (alpha) transfer protein-like [Source:Z... [more]
clvs23.392e-1825.52clavesin 2 [Source:NCBI gene;Acc:566769][more]
rlbp1b5.803e-1523.11retinaldehyde binding protein 1b [Source:ZFIN;Acc:... [more]
rlbp1b5.803e-1523.11retinaldehyde binding protein 1b [Source:ZFIN;Acc:... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal7.777e-2630.68tocopherol (alpha) transfer protein-like [Source:N... [more]
clvs18.317e-2128.69clavesin 1 [Source:NCBI gene;Acc:100037913][more]
clvs11.106e-2028.69clavesin 1 [Source:NCBI gene;Acc:100037913][more]
thg1l1.620e-1825.94tRNA-histidine guanylyltransferase 1-like [Source:... [more]
ggh1.266e-1726.13gamma-glutamyl hydrolase (conjugase, folylpolygamm... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttpal4.204e-2530.65tocopherol (alpha) transfer protein-like [Source:M... [more]
Ttpal4.204e-2530.65tocopherol (alpha) transfer protein-like [Source:M... [more]
Clvs11.108e-2029.10clavesin 1 [Source:MGI Symbol;Acc:MGI:1921688][more]
Clvs11.108e-2029.10clavesin 1 [Source:MGI Symbol;Acc:MGI:1921688][more]
Clvs21.250e-1825.94clavesin 2 [Source:MGI Symbol;Acc:MGI:2443223][more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BTX7|TTPAL_HUMAN2.609e-2430.24Alpha-tocopherol transfer protein-like OS=Homo sap... [more]
sp|Q9D3D0|TTPAL_MOUSE2.941e-2430.65Alpha-tocopherol transfer protein-like OS=Mus musc... [more]
sp|Q5RFR0|TTPAL_PONAB3.148e-2430.24Alpha-tocopherol transfer protein-like OS=Pongo ab... [more]
sp|Q5M7E1|CLVS1_XENLA4.597e-2028.69Clavesin-1 OS=Xenopus laevis OX=8355 GN=clvs1 PE=2... [more]
sp|Q8IUQ0|CLVS1_HUMAN5.708e-2029.10Clavesin-1 OS=Homo sapiens OX=9606 GN=CLVS1 PE=1 S... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QTG81.615e-8934.55Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5J4P3R66.128e-7137.78CRAL-TRIO domain-containing protein OS=Paragonimus... [more]
A0A267E9H41.992e-7038.82CRAL-TRIO domain-containing protein OS=Macrostomum... [more]
A0A267GCN24.379e-7038.82CRAL-TRIO domain-containing protein OS=Macrostomum... [more]
A0A267DVC94.520e-7038.82CRAL-TRIO domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal6.250e-2328.62alpha tocopherol transfer protein like [Source:NCB... [more]
ttpal6.467e-2330.28alpha tocopherol transfer protein like [Source:NCB... [more]
clvs23.691e-1924.45clavesin 2 [Source:NCBI gene;Acc:103047212][more]
clvs22.157e-1825.52clavesin 2 [Source:NCBI gene;Acc:103047212][more]
ttpa3.290e-1828.46tocopherol (alpha) transfer protein [Source:ZFIN;A... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal2.251e-2929.96tocopherol (alpha) transfer protein-like [Source:Z... [more]
ENSPMAT00000003570.11.365e-1833.96pep scaffold:Pmarinus_7.0:GL486699:2092:8510:1 gen... [more]
ENSPMAT00000007468.11.957e-1729.86pep scaffold:Pmarinus_7.0:GL477833:5549:9144:1 gen... [more]
clvs22.132e-926.35clavesin 2 [Source:NCBI gene;Acc:566769][more]
ENSPMAT00000001440.18.789e-932.71pep scaffold:Pmarinus_7.0:GL476337:1030926:1032713... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO456923.105e-626.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttpal5.200e-2629.08alpha tocopherol transfer protein like [Source:NCB... [more]
CLVS19.818e-2229.51clavesin-1 [Source:NCBI gene;Acc:101158238][more]
clvs22.216e-1725.52clavesin 2 [Source:NCBI gene;Acc:101159632][more]
rlbp1b6.753e-1523.28retinaldehyde binding protein 1 [Source:NCBI gene;... [more]
TTPA9.141e-1526.67alpha tocopherol transfer protein [Source:NCBI gen... [more]
back to top
BLAST of CRAL-TRIO domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009874.12.704e-112100.00SMESG000009874.1[more]
SMESG000009872.11.192e-152100.00SMESG000009872.1[more]
SMESG000009876.14.776e-16063.38SMESG000009876.1[more]
SMESG000009988.12.866e-10946.89SMESG000009988.1[more]
SMESG000009877.17.913e-10046.15SMESG000009877.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017805 ID=SMED30017805|Name=CRAL-TRIO domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2050bp
GATAATAATAAGTTCACCTGAGTTTCATATGATCAGAATAATAAATCAGA
TCAAAAGATTACAGGCAGATTCTGGCTGAAATCTGATGAGACAATTTGCT
ATAAGTATAGCAAAGGATTTTATTTTTGCATTAATAATTTATTTTGCAAA
CTTCTTTCACGCCTTTGCCAATGCAGGATCGCTACGAATACAATCGGATC
TCAGAAAGATCAAAACAATTTGCAATAGACGACCTTGGTGAAAATCCTTC
ACAGGTTAATGCCCATATCGAAAGTTTTAGGAGGTGGGTCAAATCCATGC
CTCATTTAATTTGTCCAACAGATTCCGAGTTTTTACTGAAGTTTTTGCGA
GTTTCTAAGTTTGATCATAAAAAAACCCAAAAGAGATTGGATAACTTTTG
TACTGTTAGATCCTCTCCAAGAGGATCTCCTGATTTCTTCCATTATTTTA
ACGTCGATGACCCTATCGTAGATATGTATTTGGACTCCAAGGTACAACTT
CCATTAGGAAGAAATGATGCGGGAGAAATGATTCTTTTAATGAAACCAGA
AGGGTGGGACAGTGAAAAAATTCCTGTCAACCAATTTCTTTCTCTCTTTT
TCATGGGTCTGGATATTTTGTTGTCTGAAGAGGAAACCCAGATTCATGGC
TTGACGCTGCTAATAGATTTGAAAGACGTTTCGAGGAAATCTATCGAAGC
AATGGCTGAACCAAAAATCCTAAAGCAATACAATATGGCCGTCCAGGACT
CCTATCCAATCCGAATGAAAAAACAGATCTTCTGTAATGAACCTGTAATT
TTTGATGTGGTTTTTCAAATATATTCATTTTTCATGAATGACAAGATGAG
AGGCAGGACCCACCGAATTAAAAATGACATCAACAAAGCATTTGAAAAAG
TTCCCGGTATAAAAACGGTTTTGCCCACCGAATACAACGGTGAAGGGGGC
ACTCTGGAATATTGTGCAGAAAAATGGAAACATAGATTTAAAACTTACTA
CAAAAATGGAGATCCCCTCAAAGGTATATCGGTTGAAGAAGCAAAACGAC
CTAAGGAGACTGCATCATATCTCGTCGCATATAAAGACTATGTCGGCCCA
ACTTTAGGAACCCATGGAACTTTTACAAAATTCGAAAATGTGTTATAAAA
TTTGACGGAACAAAATGGGAAATTATTAAATAAAATATGGAAATTTTCTG
CTGAAGTTTCTAAGAGTTGCTAAATTCGATCATGATAAAGCGGAAAGGCG
ATTAGACAATTTTTGTACAGCTCGATCATCGAAAAAAGGTTCTGAAGAAT
TTTTCAAGTTTTTCAAAATTGAAGATCAAGTCGTTCAAACCTTTCTTAGC
TCCAAAATGCATATTCCATTGGGACAAAATGACGCTGGAGAAATAATTTT
TCTCATTCGATCTAATGTATGGGATCCAGAAAAAATACCAATGGTGAAAC
TGATTGTTTTAATATTCATGGGATTAGATATAATCATAAATATGGAAGAA
TCCCAGATCCATGGAATACGAATGCTGATAGATTTGAATGACATCTCTCG
GAAATCCTTAGAATCATGGGCTGAACCAAAGTTACTGAAACAATGGCACA
AAGTTGTCCAGGAATCGTATCCTTTGAGAGTTAAAGGACAAATCTTTTAC
AACGAACCGGTTCTTTTCGATTTGATTTATGAACTTATTTCACTGTTCAT
GAATGATAAGATGAAAGAAAGAACATTCCGGGTAAAAAATGATATTAAAA
AGGCGATGGAAAAAATTCCAGGTTTAGAAAAAATTCTACCTACAGAATAC
AATGGTCAAGGGGGTTCACTGAATGAATGTGCAGAAAAATGGAAAAACAA
ATTTGAATCCTATTACAAAAATGGTAACCCCTTCGAATGTATTTCAGTAG
ACGAGTCTAAGCGGCCAAAAGCAAATTCAAATTATTTAACAGACCATTCA
GATTATCAGAATAAAACCTTTGGAACTTCGGGAAGTTTTACAAAATTTGA
AAATGTTTTTTAACCACCAGATTAACTTATCGGGTTTATTTAATAAAAAG
back to top

protein sequence of SMED30017805-orf-1

>SMED30017805-orf-1 ID=SMED30017805-orf-1|Name=SMED30017805-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=219bp
MHIPLGQNDAGEIIFLIRSNVWDPEKIPMVKLIVLIFMGLDIIINMEESQ
IHGIRMLIDLNDISRKSLESWAEPKLLKQWHKVVQESYPLRVKGQIFYNE
PVLFDLIYELISLFMNDKMKERTFRVKNDIKKAMEKIPGLEKILPTEYNG
QGGSLNECAEKWKNKFESYYKNGNPFECISVDESKRPKANSNYLTDHSDY
QNKTFGTSGSFTKFENVF*
back to top

protein sequence of SMED30017805-orf-2

>SMED30017805-orf-2 ID=SMED30017805-orf-2|Name=SMED30017805-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MQDRYEYNRISERSKQFAIDDLGENPSQVNAHIESFRRWVKSMPHLICPT
DSEFLLKFLRVSKFDHKKTQKRLDNFCTVRSSPRGSPDFFHYFNVDDPIV
DMYLDSKVQLPLGRNDAGEMILLMKPEGWDSEKIPVNQFLSLFFMGLDIL
LSEEETQIHGLTLLIDLKDVSRKSIEAMAEPKILKQYNMAVQDSYPIRMK
KQIFCNEPVIFDVVFQIYSFFMNDKMRGRTHRIKNDINKAFEKVPGIKTV
LPTEYNGEGGTLEYCAEKWKHRFKTYYKNGDPLKGISVEEAKRPKETASY
LVAYKDYVGPTLGTHGTFTKFENVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR036865CRAL-TRIO_dom_sf
IPR036273CRAL/TRIO_N_dom_sf
IPR001071CRAL-bd_toc_tran
IPR001251CRAL-TRIO_dom
IPR011074CRAL/TRIO_N_dom
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006810transport
Vocabulary: molecular function
TermDefinition
GO:0005215transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00180CRETINALDHBPcoord: 249..258
score: 42.5
coord: 182..203
score: 26.14
coord: 54..76
score: 35.87
NoneNo IPR availableGENE3DG3DSA:1.10.8.20coord: 5..82
e-value: 6.1E-10
score: 41.1
NoneNo IPR availablePANTHERPTHR10174RETINALDEHYDE BINDING PROTEIN-RELATEDcoord: 9..296
IPR011074CRAL/TRIO, N-terminal domainSMARTSM01100CRAL_TRIO_N_2coord: 51..76
e-value: 0.0015
score: 27.8
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 103..260
e-value: 6.3E-4
score: 29.0
IPR001251CRAL-TRIO lipid binding domainPFAMPF00650CRAL_TRIOcoord: 105..257
e-value: 6.9E-19
score: 68.1
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 96..263
score: 10.913
IPR001251CRAL-TRIO lipid binding domainCDDcd00170SEC14coord: 107..258
e-value: 5.46611E-16
score: 72.0326
IPR036865CRAL-TRIO lipid binding domain superfamilyGENE3DG3DSA:3.40.525.10coord: 87..267
e-value: 3.3E-36
score: 126.2
IPR036865CRAL-TRIO lipid binding domain superfamilySUPERFAMILYSSF52087CRAL/TRIO domaincoord: 104..278
IPR036273CRAL/TRIO, N-terminal domain superfamilySUPERFAMILYSSF46938CRAL/TRIO N-terminal domaincoord: 10..80