Coiled-coil domain containing 191

Overview
NameCoiled-coil domain containing 191
Smed IDSMED30017794
Length (bp)2781
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain containing 191 (SMED30017794) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain containing 191 (SMED30017794) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain containing 191 (SMED30017794) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain containing 191 (SMED30017794) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017794

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30017794h1SMcG0010013 Contig42282newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017794h1SMcG0010013 Contig42282uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017794h1SMcG0010013 dd_Smed_v6_8967_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017794h1SMcG0010013 dd_Smed_v6_8967_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30017794h1SMcG0010013 dd_Smed_v6_8967_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017794h1SMcG0010013 dd_Smed_v4_8967_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain containing 191 vs. Ensembl Human
Match: CCDC191 (coiled-coil domain containing 191 [Source:HGNC Symbol;Acc:HGNC:29272])

HSP 1 Score: 75.8702 bits (185), Expect = 2.495e-13
Identity = 165/614 (26.87%), Postives = 275/614 (44.79%), Query Frame = 1
Query: 1003 KVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQ----LIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIK-----------ADSLLKQIKENRNLISNSSESDNRI--HIINSP-----TELHEDDENLEKNYL--PNTKLQNQFVLK-MEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCW-KRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESAD--SHYLKTLMKISFNHWRTTNHRQQIRLDKLG---IQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK 2751
            + F +N Q   +YF AW   I   ++K+ +A     WK   K+ RAW  Y+R  +L  +    +  ++    K+ +A  + +  +L+ C   W  +   E   R     +E  +KKM + ++A         A L KLS        L +E+ +          ETA         L S   C  + P  +         +    +  P ++    L    +Q     ET         P  +  F +R   Q++LI +QK K++EQQK I  +K           A+  L   +   +L+S   E + R    ++NSP     TE   D  N        P   +    +LK ME RA +R   R    EK+KKQ+EEK  QL+ +  E+ K E EEK  + +  +E++  +++KE  KQKR+KR Q+   IA   Y+ +LL+  G+E +K+L     QN + A+ HY L + +K +  W +R  E++     +    FY +IL++R +      ++  +L EE      H+L+   K  F  W   N  +++++D  G   I  ++   R L + +  TW++     ++ER +E R   LR+KV  I+PDF+
Sbjct:  317 QTFKENQQCQKRYFAAWHKLILDHRIKLGKAGTLSDWKIQLKVLRAWRDYTRFQKLERETQALENDLREENRKQQLATEYNRKQVLRHCFTEWQHWHGAELLKRELALTKEETRKKMDALLQA---------ASLGKLSANGLSGISLPEEATAMVGPPVKNGQETAVPPLWEKPPLGSS-GCMLSPPLGRTTTGNLQGSLQNVSLSAPGNKQHKTLGAEPSQQPGSNETLRTTSQKAEPLCLGHFHNRHVFQQQLIEKQKKKLQEQQKTILELKKNLQLAEAQWAAEHALAVTEAQSHLLSKPREEEPRTCQMLVNSPVASPGTEGRSDSRNSLSGLRRKPKQLMTPHPILKAMEERAIQRAECRRILAEKKKKQEEEKLAQLKAQEEERQKREAEEKEAQLERKREEKRLKKMKELEKQKRIKRNQQLEAIAKEHYERVLLRKKGLEPWKRLRMQSKQNIQVAEEHYSLFLQRKYMLTWFQRSQESLARKMAQ-ADQFYSQILLKRVI--QSWLQYVIDLQEEVRKFCVHFLQ---KKIFRAW--FNMVREVKIDSQGKHEIAAEHSDRRILWITL-RTWKKFVKFMKEERVKEERRQQLRRKVVEILPDFQ 911          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Fly
Match: CG17258 (gene:FBgn0031496 transcript:FBtr0335481)

HSP 1 Score: 51.6026 bits (122), Expect = 3.782e-6
Identity = 55/176 (31.25%), Postives = 91/176 (51.70%), Query Frame = 1
Query: 2251 LLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKS--FYYRILMRRCLYHMKLF-KHRYELMEESADSHYLKTLMKISFNHW-RTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFKPVNDN 2766
            LLK  G+E FK+L+  K +N  K++      I K S   W     T ++ ++KI+K+   ++ IL RR LY   L+ ++    M  + D H L++ M+  F  W + + H + I  D    Q  + +E  LK ++   WR+LP   + E+E E R    R K+  ++PD+KP  D+
Sbjct:  700 LLKRTGMEGFKRLLERKRENLVKSEEFRCRLITKNSFSSW-HSYSTYRQ-REKIIKAEICWHNILKRRALYAWILYVQNEKSKMLVAIDWHALRS-MEHWFARWHKYSTHCRMIE-DSKTRQAISHHEWHLKWKVLDCWRRLPQILKIEKETEERRQRWRMKIWELLPDYKPREDS 871          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Fly
Match: CG17258 (gene:FBgn0031496 transcript:FBtr0300814)

HSP 1 Score: 51.6026 bits (122), Expect = 3.818e-6
Identity = 53/175 (30.29%), Postives = 89/175 (50.86%), Query Frame = 1
Query: 2251 LLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKS--FYYRILMRRCLYHMKLF-KHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFKPVNDN 2766
            LLK  G+E FK+L+  K +N  K++      I K S   W     T ++ ++KI+K+   ++ IL RR LY   L+ ++    M  + D H L++ M+  F  W   +   ++  D    Q  + +E  LK ++   WR+LP   + E+E E R    R K+  ++PD+KP  D+
Sbjct:  703 LLKRTGMEGFKRLLERKRENLVKSEEFRCRLITKNSFSSW-HSYSTYRQ-REKIIKAEICWHNILKRRALYAWILYVQNEKSKMLVAIDWHALRS-MEHWFARWHKYSTHCRMIEDSKTRQAISHHEWHLKWKVLDCWRRLPQILKIEKETEERRQRWRMKIWELLPDYKPREDS 874          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Fly
Match: CG17258 (gene:FBgn0031496 transcript:FBtr0335482)

HSP 1 Score: 51.6026 bits (122), Expect = 3.947e-6
Identity = 53/175 (30.29%), Postives = 89/175 (50.86%), Query Frame = 1
Query: 2251 LLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKS--FYYRILMRRCLYHMKLF-KHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFKPVNDN 2766
            LLK  G+E FK+L+  K +N  K++      I K S   W     T ++ ++KI+K+   ++ IL RR LY   L+ ++    M  + D H L++ M+  F  W   +   ++  D    Q  + +E  LK ++   WR+LP   + E+E E R    R K+  ++PD+KP  D+
Sbjct:  701 LLKRTGMEGFKRLLERKRENLVKSEEFRCRLITKNSFSSW-HSYSTYRQ-REKIIKAEICWHNILKRRALYAWILYVQNEKSKMLVAIDWHALRS-MEHWFARWHKYSTHCRMIEDSKTRQAISHHEWHLKWKVLDCWRRLPQILKIEKETEERRQRWRMKIWELLPDYKPREDS 872          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Zebrafish
Match: ccdc191 (coiled-coil domain containing 191 [Source:ZFIN;Acc:ZDB-GENE-050102-4])

HSP 1 Score: 62.003 bits (149), Expect = 2.889e-9
Identity = 62/193 (32.12%), Postives = 100/193 (51.81%), Query Frame = 1
Query: 2188 QKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKT-----LMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK 2751
            QKRV+ EQE ++ A   Y   LL H G+  +++L+     N ++A+ HY  T+ ++ L  W+R V  V+  ++      Y RIL++R L   +  K    ++E  A+ H+ KT     ++    +H   T  R     D+   Q  N   R    + F+ W +LP+  R+ERERE R + LR+KV  I+PDF+
Sbjct:  696 QKRVEHEQEQSKRATQHYLTTLLLHRGLTPWRRLLEQSHANTQRAEDHYTHTLQRRCLCVWRRCVFEVQAEREASACLMYQRILLQRTLKSWRRLKDVRFILEARAE-HFYKTNIQRKMLTALLDH--MTEERITAWDDEQRAQQHN--NRRAVRKCFSGWTRLPVVLREEREREERREQLRRKVAEILPDFR 883          

HSP 2 Score: 56.6102 bits (135), Expect = 1.334e-7
Identity = 85/377 (22.55%), Postives = 168/377 (44.56%), Query Frame = 1
Query:  799 KIRCELQRKRE---QEMLESKRLKE----TQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEK--AMENQAKLDKL------SLETFEKNKLKDESISNRTTQSHLTNETARSSHR-SNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADS---LLKQIKENRNLISNSS 1872
            K R E QR+ E   QEM+  +R  E     ++L +  E+ ++  QK  +++  +  +     N+  ++  + +E K+   NLQ + K+F AW + I   +++M +A     W+   + +RAW +   + R   +    +E ++    +   A+   +  LL++C  +W +         WC+   E  +K+++   E  + K  A+ N A   KL      S     +     E+IS    +   T ++  S+ + +N S +S+ Q T            +AWQ+T++   L + +L        +  +T  + +S         F HR AA ++ + +Q+  +KEQQ+ I  ++       L++ +E   LI+  S
Sbjct:  234 KKRQEAQRQEELIQQEMIRLRREMEKKRNVEQLARNMERERLQQQKATKSS-VIPKHHNPTQNKELQLKLKNLEAKIHLLNLQRMQKHFSAWYSMILERRVRMGKAAALCDWRRQLRAWRAWRALVWARREKKEAEKTEEELRHEHRRCQQALESDRRRLLRRCFSDWRV---------WCQV--ECHRKELLQQQEETRCKMAALINSAASGKLRAVKSPSSTNHPETPCPTENIS--LQEGPATPDSGSSTAQVTNSSGRSEAQLT------------QAWQVTRRHAALSMAEL-------RRARQTQQSSRSRGAELSGGQFKHRHAALQQTVAEQRRLLKEQQEQILLLQERQNILELRRAEEKMALIATGS 577          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Zebrafish
Match: ccdc191 (coiled-coil domain containing 191 [Source:ZFIN;Acc:ZDB-GENE-050102-4])

HSP 1 Score: 60.4622 bits (145), Expect = 8.673e-9
Identity = 61/193 (31.61%), Postives = 99/193 (51.30%), Query Frame = 1
Query: 2188 QKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKT-----LMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK 2751
            QKRV+ EQE ++ A   Y   LL H G+  +++L+     N ++A+ HY  T+ ++ L  W+R V   +  ++      Y RIL++R L   +  K    ++E  A+ H+ KT     ++    +H   T  R     D+   Q  N   R    + F+ W +LP+  R+ERERE R + LR+KV  I+PDF+
Sbjct:  677 QKRVEHEQEQSKRATQHYLTTLLLHRGLTPWRRLLEQSHANTQRAEDHYTHTLQRRCLCVWRRCVFEAQAEREASACLMYQRILLQRTLKSWRRLKDVRFILEARAE-HFYKTNIQRKMLTALLDH--MTEERITAWDDEQRAQQHN--NRRAVRKCFSGWTRLPVVLREEREREERREQLRRKVAEILPDFR 864          

HSP 2 Score: 57.3806 bits (137), Expect = 7.614e-8
Identity = 84/375 (22.40%), Postives = 167/375 (44.53%), Query Frame = 1
Query:  805 RCELQRKRE---QEMLESKRLKE----TQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEK--AMENQAKLDKL------SLETFEKNKLKDESISNRTTQSHLTNETARSSHR-SNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADS---LLKQIKENRNLISNSS 1872
            R E QR+ E   QEM+  +R  E     ++L +  E+ ++  QK  +++  +  +     N+  ++  + +E K+   NLQ + K+F AW + I   +++M +A     W+   + +RAW +   + R   +    +E ++    +   A+   +  LL++C  +W +         WC+   E  +K+++   E  + K  A+ N A   KL      S     +     E+IS    +   T ++  S+ + +N S +S+ Q T            +AWQ+T++   L + +L        +  +T  + +S         F HR AA ++ + +Q+  +KEQQ+ I  ++       L++ +E   LI+  S
Sbjct:  236 RQEAQRQEELIQQEMIRLRREMEEKRNVEQLARNMERERLQQQKATKSS-VIPKHHNPTQNKELQLKLKNLEAKIHLLNLQRMQKHFSAWYSMILERRVRMGKAAALCDWRRQLRAWRAWRALVWARREKREAEKTEEELRHEHRRCQQALESDRRRLLRRCFSDWRV---------WCQV--ECHRKELLQQQEETRCKMAALINSAASGKLRAVKSPSSTNHPETPCPTENIS--LQEGPATPDSGSSTAQVTNSSGRSEAQLT------------QAWQVTRRHAALSMAEL-------RRALQTQQSSRSRGAELSGGQFKHRHAALQQTVAEQRRLLKEQQEQILLLQERQNILELRRAEEKMALIATGS 577          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Xenopus
Match: CCDC191 (coiled-coil domain containing 191 [Source:NCBI gene;Acc:100493616])

HSP 1 Score: 80.1073 bits (196), Expect = 1.150e-14
Identity = 82/370 (22.16%), Postives = 163/370 (44.05%), Query Frame = 1
Query: 1006 VFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQ-QKLIEFIKADSLLKQIKEN------RNLISNSS--ESDNRIHIINSPTELHEDDENL------EKNYLP------NTKLQNQF-------VLKMEARAKERERIRVE 2031
            ++ +N + +  +F +W   +   ++KM +A+    WK   K+FRAW   + S++L  + +  +  ++    K+ +A   ++  LL+ C++ W L+   EKE R  E  +E  K+KM + ++A   +    ++ +  +      + +L   +I+    +S      A ++H           C    PA   K P+ AWQIT++   L  ++L+ +  Q              +      +F HR   Q++LI++Q+ +++EQ QK++  ++   L+   ++N         +SN +   S+ R    N  TE  +   N+       +N+ P      +T+    F       +  ME RA +R   R E
Sbjct:  129 IYAENRKCLQTHFSSWYKLVLDQRVKMGKARALADWKLQLKVFRAWRDSTWSSKLERETHKLETDLRDQNRKQQVAQESYQRRLLRHCLVEWQLWSRAEKEKRELEARKEETKRKMAALLDAASSRGAPKESPITHMGSPPSGEQRLSSGTIA----ESAPLTPVAMTNH-----------C----PAEPAKAPQHAWQITREHAALTPEELLQHRPQAPSLTPKRQPTGPTRVAPYGENFEHRHHFQQQLIQEQRRQLEEQKQKILGLMENQRLMVAKQDNLKATALTAALSNPTPNPSETRRKASNPGTEGPDAARNVAPPSSDARNWSPPQSAVSSTRRPKGFSTSPHPAIKAMEGRAAQRAERRKE 479          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Xenopus
Match: CCDC191 (coiled-coil domain containing 191 [Source:NCBI gene;Acc:100493616])

HSP 1 Score: 80.1073 bits (196), Expect = 1.305e-14
Identity = 82/370 (22.16%), Postives = 163/370 (44.05%), Query Frame = 1
Query: 1006 VFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQ-QKLIEFIKADSLLKQIKEN------RNLISNSS--ESDNRIHIINSPTELHEDDENL------EKNYLP------NTKLQNQF-------VLKMEARAKERERIRVE 2031
            ++ +N + +  +F +W   +   ++KM +A+    WK   K+FRAW   + S++L  + +  +  ++    K+ +A   ++  LL+ C++ W L+   EKE R  E  +E  K+KM + ++A   +    ++ +  +      + +L   +I+    +S      A ++H           C    PA   K P+ AWQIT++   L  ++L+ +  Q              +      +F HR   Q++LI++Q+ +++EQ QK++  ++   L+   ++N         +SN +   S+ R    N  TE  +   N+       +N+ P      +T+    F       +  ME RA +R   R E
Sbjct:  319 IYAENRKCLQTHFSSWYKLVLDQRVKMGKARALADWKLQLKVFRAWRDSTWSSKLERETHKLETDLRDQNRKQQVAQESYQRRLLRHCLVEWQLWSRAEKEKRELEARKEETKRKMAALLDAASSRGAPKESPITHMGSPPSGEQRLSSGTIA----ESAPLTPVAMTNH-----------C----PAEPAKAPQHAWQITREHAALTPEELLQHRPQAPSLTPKRQPTGPTRVAPYGENFEHRHHFQQQLIQEQRRQLEEQKQKILGLMENQRLMVAKQDNLKATALTAALSNPTPNPSETRRKASNPGTEGPDAARNVAPPSSDARNWSPPQSAVSSTRRPKGFSTSPHPAIKAMEGRAAQRAERRKE 669          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Mouse
Match: Ccdc191 (coiled-coil domain containing 191 [Source:MGI Symbol;Acc:MGI:1922661])

HSP 1 Score: 52.7582 bits (125), Expect = 2.341e-6
Identity = 58/196 (29.59%), Postives = 95/196 (48.47%), Query Frame = 1
Query: 2188 QKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCL-----YHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLD---KLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK 2751
            QKR+KR QE   +A   Y+ +LL+  G+E +K+L      N E A+ ++ L + +K L  W +  +     +      FY ++L RR +     Y   L K    L        YL  L K  F  W TT   +++++D   KL +  ++  +R + M     W+      ++ER +E R D LR+KV+ I+PDF+
Sbjct:  694 QKRIKRIQELEAVAKGHYERVLLRKKGLEPWKRLRMQSKHNIEVAEKYHSLALQRKCLLNWFQYSQETLAMKTAKADQFYSQLLYRRSIRSWLQYVSDLEKEVRRL------CTYL--LQKKIFKAWLTTV--RELKMDSQRKLKVATEHC-DRKILMLTLEMWKAFVKLTKEERVKEERRDHLRRKVSEILPDFQ 878          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Mouse
Match: Ccdc191 (coiled-coil domain containing 191 [Source:MGI Symbol;Acc:MGI:1922661])

HSP 1 Score: 52.373 bits (124), Expect = 2.812e-6
Identity = 58/196 (29.59%), Postives = 95/196 (48.47%), Query Frame = 1
Query: 2188 QKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCL-----YHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLD---KLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK 2751
            QKR+KR QE   +A   Y+ +LL+  G+E +K+L      N E A+ ++ L + +K L  W +  +     +      FY ++L RR +     Y   L K    L        YL  L K  F  W TT   +++++D   KL +  ++  +R + M     W+      ++ER +E R D LR+KV+ I+PDF+
Sbjct:  636 QKRIKRIQELEAVAKGHYERVLLRKKGLEPWKRLRMQSKHNIEVAEKYHSLALQRKCLLNWFQYSQETLAMKTAKADQFYSQLLYRRSIRSWLQYVSDLEKEVRRL------CTYL--LQKKIFKAWLTTV--RELKMDSQRKLKVATEHC-DRKILMLTLEMWKAFVKLTKEERVKEERRDHLRRKVSEILPDFQ 820          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Mouse
Match: Ccdc191 (coiled-coil domain containing 191 [Source:MGI Symbol;Acc:MGI:1922661])

HSP 1 Score: 50.8322 bits (120), Expect = 7.147e-6
Identity = 58/196 (29.59%), Postives = 95/196 (48.47%), Query Frame = 1
Query: 2188 QKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCL-----YHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLD---KLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK 2751
            QKR+KR QE   +A   Y+ +LL+  G+E +K+L      N E A+ ++ L + +K L  W +  +     +      FY ++L RR +     Y   L K    L        YL  L K  F  W TT   +++++D   KL +  ++  +R + M     W+      ++ER +E R D LR+KV+ I+PDF+
Sbjct:  280 QKRIKRIQELEAVAKGHYERVLLRKKGLEPWKRLRMQSKHNIEVAEKYHSLALQRKCLLNWFQYSQETLAMKTAKADQFYSQLLYRRSIRSWLQYVSDLEKEVRRL------CTYL--LQKKIFKAWLTTV--RELKMDSQRKLKVATEHC-DRKILMLTLEMWKAFVKLTKEERVKEERRDHLRRKVSEILPDFQ 464          
BLAST of Coiled-coil domain containing 191 vs. UniProt/SwissProt
Match: sp|Q8NCU4|CC191_HUMAN (Coiled-coil domain-containing protein 191 OS=Homo sapiens OX=9606 GN=CCDC191 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.198e-12
Identity = 165/614 (26.87%), Postives = 275/614 (44.79%), Query Frame = 1
Query: 1003 KVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQ----LIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIK-----------ADSLLKQIKENRNLISNSSESDNRI--HIINSP-----TELHEDDENLEKNYL--PNTKLQNQFVLK-MEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCW-KRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESAD--SHYLKTLMKISFNHWRTTNHRQQIRLDKLG---IQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK 2751
            + F +N Q   +YF AW   I   ++K+ +A     WK   K+ RAW  Y+R  +L  +    +  ++    K+ +A  + +  +L+ C   W  +   E   R     +E  +KKM + ++A         A L KLS        L +E+ +          ETA         L S   C  + P  +         +    +  P ++    L    +Q     ET         P  +  F +R   Q++LI +QK K++EQQK I  +K           A+  L   +   +L+S   E + R    ++NSP     TE   D  N        P   +    +LK ME RA +R   R    EK+KKQ+EEK  QL+ +  E+ K E EEK  + +  +E++  +++KE  KQKR+KR Q+   IA   Y+ +LL+  G+E +K+L     QN + A+ HY L + +K +  W +R  E++     +    FY +IL++R +      ++  +L EE      H+L+   K  F  W   N  +++++D  G   I  ++   R L + +  TW++     ++ER +E R   LR+KV  I+PDF+
Sbjct:  317 QTFKENQQCQKRYFAAWHKLILDHRIKLGKAGTLSDWKIQLKVLRAWRDYTRFQKLERETQALENDLREENRKQQLATEYNRKQVLRHCFTEWQHWHGAELLKRELALTKEETRKKMDALLQA---------ASLGKLSANGLSGISLPEEATAMVGPPVKNGQETAVPPLWEKPPLGSS-GCMLSPPLGRTTTGNLQGSLQNVSLSAPGNKQHKTLGAEPSQQPGSNETLRTTSQKAEPLCLGHFHNRHVFQQQLIEKQKKKLQEQQKTILELKKNLQLAEAQWAAEHALAVTEAQSHLLSKPREEEPRTCQMLVNSPVASPGTEGRSDSRNSLSGLRRKPKQLMTPHPILKAMEERAIQRAECRRILAEKKKKQEEEKLAQLKAQEEERQKREAEEKEAQLERKREEKRLKKMKELEKQKRIKRNQQLEAIAKEHYERVLLRKKGLEPWKRLRMQSKQNIQVAEEHYSLFLQRKYMLTWFQRSQESLARKMAQ-ADQFYSQILLKRVI--QSWLQYVIDLQEEVRKFCVHFLQ---KKIFRAW--FNMVREVKIDSQGKHEIAAEHSDRRILWITL-RTWKKFVKFMKEERVKEERRQQLRRKVVEILPDFQ 911          
BLAST of Coiled-coil domain containing 191 vs. UniProt/SwissProt
Match: sp|Q95KD7|CC191_MACFA (Coiled-coil domain-containing protein 191 OS=Macaca fascicularis OX=9541 GN=CCDC191 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.437e-6
Identity = 59/197 (29.95%), Postives = 100/197 (50.76%), Query Frame = 1
Query: 2188 QKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLG---IQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK-PVNDN 2766
            QKR+KR Q+   IA   Y+ +LL+  G+E +K L     QN + A+ HY L + +K L  W +  +     +      FY +IL++R +      ++  +L EE      ++ L K  F  W   N  +++++D  G   I  ++   R L +  F TW++     ++ER +E R   LR+KV  I+PDF+ P +D+
Sbjct:  728 QKRIKRNQQLEAIAKEHYEGVLLRKKGLEPWKILRMQSKQNVQVAEEHYCLFLQRKYLLTWFQCSQESLARKMAQADQFYSQILLKRVIRSW--LQYMTDLQEE-VRKFCVRFLQKKIFRAW--FNMVREVKIDSRGKHEIAAEHSDRRILWI-TFRTWKKFVKFMKEERVKEERRQQLRRKVVEILPDFQVPGSDH 918          
BLAST of Coiled-coil domain containing 191 vs. TrEMBL
Match: A0A1L8HC24 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=ccdc191 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 8.757e-27
Identity = 155/623 (24.88%), Postives = 294/623 (47.19%), Query Frame = 1
Query:  982 IAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQ----------QKLI----EFIKADSLLKQI-------KENRNLISN-SSESDNRIHIINSPTE----LHEDDENLEKNYLPNT--KLQNQFVLKMEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK--PVN 2760
            I E++  +++  N + +  +F +W   +   ++KM +A+    WK   ++FRAW  Y  S++L  +    +  ++    K+  A   ++  +L+ C++ W L+   EKE R  E  +E  K+KM + ++A    A    A  + L   T         S +NR        +   SS+ +  + Q+ I  T   PA   K PK AWQ+T +   L  ++L+ +  Q         +    K      +F HR   Q++LI++Q+ ++++Q          Q+LI    + ++A +L   +       KE R   SN  +E  + +  + SP+            +     P       +  +  ME RA +R   R E  E ++K+++EK  Q++ +  E+ + E  EK    +  +E++  ++ KE+ +Q ++++EQE    A   Y+ +LL+ +G+E +K+LVT   QN ++A+ H+   I ++ L  W+++V  +   +    +  + RI +RR   H + +K    +MEE A   Y   L + +F  W      +++ L +         +R +++  F  WR  P   R+E+ +E R + LR+KV+ I+PDF+  PV+
Sbjct:  311 IGEML-GQIYAVNRKCLQAHFSSWYKLVLERRVKMGKARALADWKRQLRVFRAWRDYVWSSKLKRETQKLEMDLRDENRKQQAAQESYRRRILRHCLVEWQLWSRAEKEKRELEARKEETKRKMAALLDA----ASSLGAPKEPLVTHTG--------SPANR-------EQKVSSSNTAVSAPQTPITLTKHCPAEPPKAPKHAWQVTLEHAALTPEELLQHRAQASSLSHKHQSDGPTKVASYGENFEHRHHFQQQLIQEQRRQLEDQKQTILGLMENQRLIIAKQDNMQATALTAALSNPIPNPKETRRRTSNFGTEKPSAVQPLASPSPDTRIWSPPQSTVSSGRRPTGFHTSPHPAIKAMEERAAQRAERRKEMEELKRKKEQEKLAQMKAEEEERLQKEAAEKEALLERKREEKRLQKQKEKERQLKLQKEQEQLGQAKAHYEKILLRSWGLEPWKRLVTQSRQNLQRAERHHSSIIQRRCLLAWQQEVSDIVSDKTSRAERLWDRIQLRRSFQHWRKYKDYLSVMEERAAQRYKAFLQRKTFLAWLDLAQEEKMALWEKQKTAAEHNQRRIQLTAFRIWRSFPQYLREEKLKEERREQLRKKVSEILPDFRMSPVS 913          
BLAST of Coiled-coil domain containing 191 vs. TrEMBL
Match: A0A2C9KNJ6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055198 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.773e-26
Identity = 175/678 (25.81%), Postives = 320/678 (47.20%), Query Frame = 1
Query:  988 EIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENM--AVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKL---SLETFEKNKLKDESISNRTTQSHLTNETARS-------------SHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQD------------EKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKE-------------QQKL---------------IEFIKADSLLKQIKENRNLISNSSESD------NRIHIINS-PTELHEDDENLEKN------------YLPNTKLQN----QFVLKMEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHY---LKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDF-KPVNDN 2766
            E ++ ++ +KNLQ + ++F AW + + S +L + + K    WK   KI+ AW S+ RS +L   +  E+   ++I  ++ M  AV  W  + L++C L W LF  +  E +  EK +E  K KM+S ++A+ E  +  QAKL++    + +T +  K KD    + T  S    E++               + RS  S+    +  S+R       PKE WQ+T + + L    + +   QD            +++   P   K      + N+F HR  AQ++ +++Q+++++E             QQ L               +E ++      QI    N +    ++       N    IN+ P ++  D+ +  +                +T  QN    Q +  ME RA ER RI+ ER +K+++Q+EEK  Q++++  E+      EKR +    ++K+  E+ KEE K+++    +E N+IA+  Y+  +LK+ G+  FKKL++   +N  K+  H +  ILKK    WK+     ++ ++ +    +  ++++   +  + FK+  +L+E  A+ HY   LKT +  ++  W      ++  L K+ +     Y  +L  + F  WR L   +++E ER+ R   LR+KV S+IPD+  PV+D+
Sbjct:  288 EAIKSRITSKNLQCLHRHFTAWYDLVLSRRLLLGKVKAMSDWKLMLKIWGAWRSHVRSQKL--DVEAEKHEREMIDSQKQMLKAVRHWTISTLRQCFLTWQLFAKECVERKELEKEQEQTKNKMMSLLKAVAEGKVGKQAKLNETLAPTKKTVQLGKFKDTQSDDLTIVSIEDQESSTPVVKLAWGESENAPTFRSETSISGLSESVSSRG---RSLPKEPWQVTHQHLKLSKKDISNLTAQDGVVRQHTDLEIRKRFGTQPWMNKHF----VANNFEHRYNAQQQTLKEQQNQLREQKRLIEELQYEQKQQSLKHRLAPGTVSSPLPPLEVLEVPPPGTQIPRGDNSVDAGKQNGKVTVEKNACQEINTKPGDVSGDETDRARQTTSRSEVTSVSQGTSSTACQNTKYLQVLKNMEQRAAERARIKAEREDKKRQQEEEKLAQIQKEQQEKLMEIEAEKRAKAAAYRQKKLLEKQKEEEKKRQEALLEEKNKIAEEHYRKAILKYRGLLPFKKLISLSKRNWLKSVKHRDKEILKKCFKAWKQFAAEERQGKEHLADQMHQFLVIKHSFHSWRNFKYHIQLLERRAERHYQDNLKTKLFQAWVEWVIVE--KENFLSKMAL-ASQYYISNLTRRTFNDWRYLKERQKREEERQARKLELRKKVASLIPDYAPPVSDS 953          
BLAST of Coiled-coil domain containing 191 vs. TrEMBL
Match: A0A402EBG7 (Uncharacterized protein OS=Paroedura picta OX=143630 GN=parPi_0001536 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.958e-20
Identity = 184/660 (27.88%), Postives = 313/660 (47.42%), Query Frame = 1
Query:  835 EMLESKRL-KETQEL----IKLQEKHKVSTQKLEETTK-ALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQ-EKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQ--LIDNVNQDE-KYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSES-DNRI------HIINSPTELHEDDENLEKNYLPNTKLQN--QFVLKMEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKA--QHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTT-NHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDF 2748
            EM+E + L ++ QE+     KL++ H++    L  T   +LD   K+   E+  ++ E++  K+   N Q + +YF AW   I   K+K+ +A+    WK   K  RAW  Y+ S ++  +    + +++    K  +A  F +  +L      W  +   E E R  +   E  +KKM + +E +  EK   N+           E    +D+S+S       L  E      R  K+  S    T  +  I  +KPK AWQ+T+K V L      + D + +   ++   P  + +   P  +  F H  A Q++LI +Q+ +++EQQ+LI  ++ +  LK+ +EN    +  S +  N+I      + I  P+     D+ L      N K+ +    V  ME RA +R   R E  E +KKQ+EE+  +L  +  E+ + E  EK  + +  +E+R  +++KE  KQKR++REQ+    A   Y   LLK++G+E +K+L+    QN   A  QH +EL   +K L  W +        +    +  Y  +L++RC      +K     +EE+A+  +  +L K +F  W  T N  +Q+   K     D   +R + +  F  WRQ PM  ++ER +E R+  LR++V  I+PDF
Sbjct:  251 EMVEKRLLMQQAQEMERRRHKLKKTHRLIEAGLPPTLPVSLDCEKKRQRKEKEAMLQELL-NKIDTANHQCLQRYFSAWYKLILDLKIKLGKAQALANWKCQLKALRAWRDYTWSQKMEQETQKMESQLRDQNRKIQLAAEFNRKYILHHYFAEWQCWSRMETEKRELQVKREETRKKMANLLEEVALEKNPTNR------PWNAGETEGAQDQSVSYGEVDEILRLEKEPPDARMEKA-NSCFPKTGQKCNIPPEKPKWAWQVTQKHVALKAHNRVMADGLARSSIQHLVIPSPKMA---PGWLGPFEHHHAFQQQLIEEQRQQLQEQQELILELQGNQGLKKAQENAGQTTAVSRAVGNQITENQADYKIMKPS--RSGDQQLVAKARRNLKVSSAHPIVKAMEERAIQRAERRKEVEEAKKKQEEERLARLTAEEEERQRQEAAEKEAQLEKRREERRLQKMKELEKQKRLEREQQLLLKAKEHYIKALLKYWGLEPWKRLMEKTQQNMMVAERQHCHELQ--RKCLVSWLQHTRATLARKTAQAEELYACLLLKRCWRSWIKYKDYASALEENANKFHEASLKKTAFGVWLDTFNKEKQVSWRKQKT-ADEYNDRRVTLIAFRAWRQFPMLMKEERAKEERLHRLRKRVAEILPDF 894          
BLAST of Coiled-coil domain containing 191 vs. TrEMBL
Match: A0A1S3JMH3 (coiled-coil domain-containing protein 191-like OS=Lingula unguis OX=7574 GN=LOC106174548 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 7.898e-19
Identity = 185/725 (25.52%), Postives = 332/725 (45.79%), Query Frame = 1
Query:  784 QIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEI--VEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESI----SNRTTQSHLTNETARS---SHRSNKSLQSQIQCTSARPAIQNKK---PKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKH---------------------------PKIINSFAHRDAAQKELIRQQKSKIKEQQKLIE----------FIKADSLLKQIKENRNLISNSSESDNRIHIINSPTE-------------LHEDDENLEKNYLPNTKL-QNQFVLKMEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLY----ERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFKPV 2757
            Q EM +IR ++Q +R++E     R K+  EL++ Q+  +   ++ EE  +    ++KK   +R +++  +  VEK+    NL+++ K+F AW N +   ++ M + K    WK   + + AW ++ R+ RL  +    ++ +K    K   A +  ++ LL +    W +++  E+  R     +   + KM + ++A         A   +L     E   +   S     S R     L  + AR    S RS+ S     +  +A+ A Q +    P + WQ+TKK V+L   +L    N D +    PH+     H                           P ++NS +HR  AQKE++++Q+ +I+EQQK+IE            +     + I+E  N ++ +  +D ++  +N   E             + E  E  +        +  ++F+  MEAR+ ER R++ ER E+++K +EE+  +LE++  E+   E EEKR R +  KE++  E+ +E  KQK V++ Q+  + A+  Y+  LLKH G   ++KL+     N E A  H    +L+  L  W    + V E + ++       ++ RRC  + K +     ++EE AD  Y++ L       W    H    +    G + D +     E  L   +   W++ P   + ERE+ERR + +R+KV SI+PDF+ +
Sbjct:  265 QKEMARIRKQMQEERKKEEERKLREKQQSELLE-QQAREEFERQREEEERRQMEHLKKIDEKRVQLMKRLEEVEKRKAADNLKILHKHFSAWYNVVLEKRIAMGKVKAMADWKCLLRAWNAWKTFVRAKRLEREAQHYEQDLKNYHRKVQQAESHHRSQLLFRYFHAWQMWLKQEQLDRQAANEQSRLQSKMAALLDA---------AATGRLWSSRQEGEGVASGSSHRPESAREKVDALFEQPARPRPQSARSSTSTLDSFKVPAAKKAWQPQPATVPTQPWQVTKKHVHLSKKELAAMGNHDNQ--SNPHDNPPGPHGDYVDNQSDGQKSDGRTNQKKAPWQREPFMVNSHSHRTEAQKEMLKKQREQIQEQQKMIEELQFQQNQLILQQQLKTQRTIREQLNQMTIADVTDEQMKKMNKEPEKTDRSGGSTARSAVSESSEKSDNTAASKKSMASSKFLKNMEARSAERARLKAEREERKRKAEEEQLAKLEQEAEERRLQEEEEKRARIEARKEQKRLEKQRELEKQKMVEKAQQQMKQAEEHYRLALLKHKGFLPWRKLMDMSRNNMEVAVDHANTVLLRNCLLSWHAHTKEVNEEKTEMADEMAKFLISRRCFNNWKQYGRYMTILEEKADRFYVRHLQVKILRAW--AEHASDEKF--AGWERDRIAKEHNEWRLLNSVLKAWKEFPKMLKAEREKERRREEMRKKVASILPDFEGL 973          
BLAST of Coiled-coil domain containing 191 vs. TrEMBL
Match: A0A2I0MSY6 (KIAA1407 ortholog (Fragment) OS=Columba livia OX=8932 GN=A306_00002929 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.789e-16
Identity = 186/687 (27.07%), Postives = 332/687 (48.33%), Query Frame = 1
Query:  784 QIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEK-HKVSTQKLEETT-KALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAW-KNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLE-TFEKNKLKDESISNRTT-QSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPL-DQLI--DNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLIS------NSSESDNR----------IHIINSPTELHEDDENLEKNYLPNTKLQNQF-----VLK-MEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHW-RTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFK 2751
            Q EM K+R E+  KR   M E+ R++      K QEK  K+S Q++  TT + L    ++   E+ K   E++ +   NK  + + ++F AW K  +E  ++KME+A+    WK   K  RAW +Y+ + ++  +    +  ++    K+ ++V   +  LL+ C L W  +   E E R  +   E  K+KM   +EA+          L K  L+   E  K     + +R   Q +   ET        ++ Q +    +A  +   +KP+ AW+IT K       DQ +  +      + ++ P  + +   P   + F HR A Q+ LI +Q+ ++++QQ+LI  ++ +  L + KE     +      N+S S  R           H+  SP   H   EN  +  L + +  +Q      +LK ME RA +R   R +  E +++++EEK  Q++ +   + + E EEK  + +  +E+R +++LKE  KQ+R+++EQ+  + A N Y+ +LL+  GI  +K+L     +N   AQ H+ L + +K L  W +D +     +    + FY  +L+RR   +   +K     +EE+  + +   L +  F  W   T   + I  +KL +  ++  +R L +    TW+Q P+  +KERERE R + LR++V  I+P+F+
Sbjct:  213 QREMVKLRKEMAEKR-HIMAEAWRVER-----KRQEKSQKLSMQEVSITTSQPLVLKKEEQGEEKQKKAQELLRRIQTNKQ-RCMQRHFSAWLKVLLEHHRIKMEKARALADWKCQLKALRAWRNYTWAQKIEQEAQQLEVHLQDQNRKKQLSVEHNQRRLLRSCFLAWQRWSRAETEKRKLQIQREETKRKMAQLLEAM---------SLGKGGLDRPLEVKKPGTAEVKHRQGLQQNKPTETCLIQKEPGQT-QGRSCWDAAHTSHSYRKPRHAWEITLKHAAPSAQDQAVYRNRTAPLSQQFQAPGPKTA---PAYGSCFEHRHAFQQRLIEEQRRQLQKQQELILELQENQRLSRAKEEAAQATAITQQLNNSASQTREEKQSRCKNTTHL--SPPVFH-GPENT-RAVLQDRRASSQLTSPHPILKAMEERATQRAERRRKLEEAKQRREEEKLAQMKAEEEARQRKEAEEKEAQREKQREERRQQKLKELEKQRRLEKEQQLLKKARNHYEKVLLRKRGIVPWKRLRELAKENLVVAQRHHCLGLQRKCLMTWLQDTQGSLMEKASRAEDFYSHMLLRRGFRNWLKYKDYLSTLEETVSNIHSACLKRKYFWAWFDLTMEERSILWEKLKVATEHSNKR-LMLNALKTWKQYPLLMKKEREREERRNQLRRRVAEILPNFQ 874          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Nematostella
Match: EDO45245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC4])

HSP 1 Score: 57.7658 bits (138), Expect = 1.568e-8
Identity = 37/137 (27.01%), Postives = 72/137 (52.55%), Query Frame = 1
Query: 1006 VFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKL-IQMKE-----NMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQ 1398
            V  +NLQL+ ++F AW   +   ++K  +A     W+   + + AW +Y       + I  ++E   + +QMKE      +A+NF + +LL++CI+ W LFV + + +R  ++  + +  KM + +EA     + N+
Sbjct:   16 VARQNLQLLRRHFSAWYTVVVEQRIKFGKASALADWRCKLRAWNAWRAY------VWHIKSDKEAQAIAVQMKERHRKEQIALNFHRKHLLQRCIVAWQLFVRESQHNRKLQEEHQRKTNKMAALLEAAASGRLWNK 146          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Medaka
Match: ccdc191 (coiled-coil domain containing 191 [Source:NCBI gene;Acc:101175606])

HSP 1 Score: 61.2326 bits (147), Expect = 4.927e-9
Identity = 79/362 (21.82%), Postives = 159/362 (43.92%), Query Frame = 1
Query:  784 QIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISN--RTTQSHLTNETARSSHRSNKSLQSQI-------QCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIK 1842
            Q E+ ++R E++++R QE L  +R        K  E H+ +     +TT A  +  ++N  +  +   E ++ KV   N + + ++F  W + +   +L+M +A  +F+W+   + +RAW +   + R +  +   +E ++    K  +AV   +  LL++C+  W +         WC  + E R       I A Q++     A L   +++   K K+   +I+N  +  Q  L N++  S+ +   S            Q  +A   +    P + WQ+T++      +         E +  +  +  S         F  R A Q+++I QQ+  +KEQQ+ I  +K +  +K ++
Sbjct:  240 QQELVRLRREMEQRRAQEQLPRQR--------KRSELHQAAANT--QTTPAHLTKQQQNIEQLRR--EEWIQAKVHTSNFKCVQRHFCGWHSAVLERQLQMSKATAFFSWRRQLRAWRAWRAVVCAERRHRDVAKTKEELRTENRKHQLAVESDRRRLLRRCLYEWQV---------WCRIMREQR------CILAQQQETKRKMAALLSAAVKGHLKTKI---TIANQQQVIQPELGNQSETSAKKDQNSSDPSSPGGSMIHQGKNATRTVSG--PLQPWQVTRRHTAPTAEDFHKARQWVEDFTSSTASTGS--------RFEGRHAVQQQIITQQRKLLKEQQEQIARLKEEQNMKDLR 561          
BLAST of Coiled-coil domain containing 191 vs. Ensembl Medaka
Match: ccdc191 (coiled-coil domain containing 191 [Source:NCBI gene;Acc:101175606])

HSP 1 Score: 60.8474 bits (146), Expect = 5.379e-9
Identity = 79/362 (21.82%), Postives = 159/362 (43.92%), Query Frame = 1
Query:  784 QIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISN--RTTQSHLTNETARSSHRSNKSLQSQI-------QCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIK 1842
            Q E+ ++R E++++R QE L  +R        K  E H+ +     +TT A  +  ++N  +  +   E ++ KV   N + + ++F  W + +   +L+M +A  +F+W+   + +RAW +   + R +  +   +E ++    K  +AV   +  LL++C+  W +         WC  + E R       I A Q++     A L   +++   K K+   +I+N  +  Q  L N++  S+ +   S            Q  +A   +    P + WQ+T++      +         E +  +  +  S         F  R A Q+++I QQ+  +KEQQ+ I  +K +  +K ++
Sbjct:  227 QQELVRLRREMEQRRAQEQLPRQR--------KRSELHQAAANT--QTTPAHLTKQQQNIEQLRR--EEWIQAKVHTSNFKCVQRHFCGWHSAVLERQLQMSKATAFFSWRRQLRAWRAWRAVVCAERRHRDVAKTKEELRTENRKHQLAVESDRRRLLRRCLYEWQV---------WCRIMREQR------CILAQQQETKRKMAALLSAAVKGHLKTKI---TIANQQQVIQPELGNQSETSAKKDQNSSDPSSPGGSMIHQGKNATRTVSG--PLQPWQVTRRHTAPTAEDFHKARQWVEDFTSSTASTGS--------RFEGRHAVQQQIITQQRKLLKEQQEQIARLKEEQNMKDLR 548          
BLAST of Coiled-coil domain containing 191 vs. Planmine SMEST
Match: SMESG000064321.1 (SMESG000064321.1)

HSP 1 Score: 1528.07 bits (3955), Expect = 0.000e+0
Identity = 900/900 (100.00%), Postives = 900/900 (100.00%), Query Frame = 1
Query:   73 MGDNYNNMFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSDDNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYXXXXXXXXXXXXXXXXVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRXXXXXXXXXXXXXXXXXXXXXXXXXXXARVXXXXXXXXXXXXXXXXXXXXXXXXQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFKPVNDNKS 2772
            MGDNYNNMFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSDDNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEIKRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERLKEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS
Sbjct:    1 MGDNYNNMFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSDDNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEIKRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERLKEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS 900          
BLAST of Coiled-coil domain containing 191 vs. Planmine SMEST
Match: SMESG000064321.1 (SMESG000064321.1)

HSP 1 Score: 1523.45 bits (3943), Expect = 0.000e+0
Identity = 900/901 (99.89%), Postives = 900/901 (99.89%), Query Frame = 1
Query:   73 MGDNYNNMFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSD-DNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYXXXXXXXXXXXXXXXXVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRXXXXXXXXXXXXXXXXXXXXXXXXXXXARVXXXXXXXXXXXXXXXXXXXXXXXXQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFKPVNDNKS 2772
            MGDNYNNMFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSD DNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEIKRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERLKEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS
Sbjct:    1 MGDNYNNMFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSDADNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEIKRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERLKEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS 901          
BLAST of Coiled-coil domain containing 191 vs. Planmine SMEST
Match: SMESG000064321.1 (SMESG000064321.1)

HSP 1 Score: 1510.35 bits (3909), Expect = 0.000e+0
Identity = 893/893 (100.00%), Postives = 893/893 (100.00%), Query Frame = 1
Query:   94 MFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSDDNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYXXXXXXXXXXXXXXXXVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRXXXXXXXXXXXXXXXXXXXXXXXXXXXARVXXXXXXXXXXXXXXXXXXXXXXXXQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFKPVNDNKS 2772
            MFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSDDNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEIKRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERLKEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS
Sbjct:    1 MFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSDDNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEIKRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERLKEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS 893          
BLAST of Coiled-coil domain containing 191 vs. Planmine SMEST
Match: SMESG000064321.1 (SMESG000064321.1)

HSP 1 Score: 1506.5 bits (3899), Expect = 0.000e+0
Identity = 893/894 (99.89%), Postives = 893/894 (99.89%), Query Frame = 1
Query:   94 MFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSD-DNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYXXXXXXXXXXXXXXXXVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRXXXXXXXXXXXXXXXXXXXXXXXXXXXARVXXXXXXXXXXXXXXXXXXXXXXXXQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAXXXXXXXXXXIDILRQKVTSIIPDFKPVNDNKS 2772
            MFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSD DNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEIKRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERLKEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS
Sbjct:    1 MFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVIIKNNSEMLNDSDADNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELEFNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSVLANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEIKRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQRKREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNERFKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNSRKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCILNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSLETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAIQNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIINSFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSSESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERIRVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERLKEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKAQHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLFKHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYERSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS 894          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain containing 191 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1912.495e-1326.87coiled-coil domain containing 191 [Source:HGNC Sym... [more]
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG172583.782e-631.25gene:FBgn0031496 transcript:FBtr0335481[more]
CG172583.818e-630.29gene:FBgn0031496 transcript:FBtr0300814[more]
CG172583.947e-630.29gene:FBgn0031496 transcript:FBtr0335482[more]
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc1912.889e-932.12coiled-coil domain containing 191 [Source:ZFIN;Acc... [more]
ccdc1918.673e-931.61coiled-coil domain containing 191 [Source:ZFIN;Acc... [more]
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC1911.150e-1422.16coiled-coil domain containing 191 [Source:NCBI gen... [more]
CCDC1911.305e-1422.16coiled-coil domain containing 191 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccdc1912.341e-629.59coiled-coil domain containing 191 [Source:MGI Symb... [more]
Ccdc1912.812e-629.59coiled-coil domain containing 191 [Source:MGI Symb... [more]
Ccdc1917.147e-629.59coiled-coil domain containing 191 [Source:MGI Symb... [more]
back to top
BLAST of Coiled-coil domain containing 191 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8NCU4|CC191_HUMAN1.198e-1226.87Coiled-coil domain-containing protein 191 OS=Homo ... [more]
sp|Q95KD7|CC191_MACFA1.437e-629.95Coiled-coil domain-containing protein 191 OS=Macac... [more]
back to top
BLAST of Coiled-coil domain containing 191 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L8HC248.757e-2724.88Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A2C9KNJ62.773e-2625.81Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A402EBG75.958e-2027.88Uncharacterized protein OS=Paroedura picta OX=1436... [more]
A0A1S3JMH37.898e-1925.52coiled-coil domain-containing protein 191-like OS=... [more]
A0A2I0MSY61.789e-1627.07KIAA1407 ortholog (Fragment) OS=Columba livia OX=8... [more]
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO452451.568e-827.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain containing 191 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc1914.927e-921.82coiled-coil domain containing 191 [Source:NCBI gen... [more]
ccdc1915.379e-921.82coiled-coil domain containing 191 [Source:NCBI gen... [more]
back to top
BLAST of Coiled-coil domain containing 191 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000064321.10.000e+0100.00SMESG000064321.1[more]
SMESG000064321.10.000e+099.89SMESG000064321.1[more]
SMESG000064321.10.000e+0100.00SMESG000064321.1[more]
SMESG000064321.10.000e+099.89SMESG000064321.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017794 ID=SMED30017794|Name=Coiled-coil domain containing 191|organism=Schmidtea mediterranea sexual|type=transcript|length=2781bp
TATAAATCTTATATGAGTTTTTTGAAATAATTATAATTTTTCATATCGAT
AAAAATTTTTCCTTCATCTTTCATGGGGGATAATTATAATAATATGTTTG
TTTGGAAAAGTTATAAGGGATTTACAAAAGAAGAACATAAAAATAAAGAA
GTAGATGATTTAAAATACTGGAAAACGAGAACAACCGATGCTACAAATAG
CGCAATAAAAAAAGTAATTATTAAAAACAATTCGGAAATGCTAAATGATT
CGGATGATAATGTATATAGTGAAGCAAAAAATCTAGTTAAAAGTTGGTTA
ACAAATAAAAAAGTTTATGGCAATTATTACGATAAGCAATCATTTCTGAA
TTTATCCGATGATGAATTAGAATTTAATGTTCCAACTAGAACTGAAATCC
ACAAGGAATGGGAGCATCTTGTTCAGAGAATCGAAACTAAAGAGGAATAT
AAAGCTGAAATGTCTGAATATCTGTCTAAAGACAATGATAATTTAAAGGA
GGATAAAAAATTGAAATCTGTGCTAGCAAATCTGCACAAAAAAACATTTG
TAGATTCATCGAAGTTGCGCAACGTTGATTCACCCAAACCTCTTGATATG
AAAAAGAGAATTGAAAATCGACAAGAAGAAGTAAAAAAGAAACGAGAAGA
GAAACAGAAAAAAGAAGAAATAAAGCGATTGGAAATATTAGCGGAAAAAG
AAGCAAGGGTTGAAGCAATGAAAATGCTGAAAGAAGAAAAGAAACAAAAA
GAATTATCATTCAAAAAAGAAGAAGAACTTCTTCAAATTGAAATGAATAA
AATCCGTTGTGAATTACAAAGAAAAAGAGAACAAGAAATGCTAGAATCGA
AAAGGTTAAAAGAAACTCAAGAATTAATAAAATTACAAGAAAAGCACAAA
GTTTCCACTCAGAAATTGGAAGAAACTACAAAAGCTTTAGATTCGAATAT
AAAGAAAAACTCCAACGAAAGATTCAAAATTATTGCGGAAATCGTCGAGA
AAAAAGTCTTCAATAAAAATTTACAATTAATTGGAAAATATTTTCGGGCA
TGGAAAAATGAAATCGAGAGTGCAAAATTGAAAATGGAAAGGGCCAAAGT
TTGGTTCGCTTGGAAAAATTCCCGTAAAATATTTCGAGCTTGGTACAGTT
ATTCGCGGTCGGCTAGGTTATATTTTCAGATAAATGTCGAACAAGAAAGA
ATTAAATTGATTCAGATGAAAGAAAATATGGCTGTTAATTTTTGGAAGAA
CAATCTTTTAAAAAAGTGCATTCTCAATTGGAGTTTGTTTGTGATCGATG
AAAAAGAGTCTCGTTGGTGTGAGAAACTCGAGGAAATGAGAAAGAAAAAA
ATGATTTCATACATAGAGGCTATTCAAGAAAAAGCAATGGAAAATCAAGC
AAAACTTGATAAATTATCGCTTGAAACTTTTGAAAAAAATAAACTAAAAG
ATGAGAGTATCAGTAATAGAACAACTCAGAGTCATTTAACTAATGAAACT
GCTAGATCATCACATAGAAGCAATAAATCATTGCAGAGTCAAATTCAGTG
TACATCAGCGAGACCAGCTATTCAAAATAAAAAGCCGAAAGAAGCATGGC
AGATAACAAAGAAAGATGTATATTTGCCATTAGATCAGTTGATTGATAAT
GTCAATCAAGACGAAAAATATTATGAAACTCCTCACAACAGGAAATCTCT
GAAACATCCAAAGATCATAAATTCTTTTGCCCATCGCGATGCTGCTCAAA
AAGAGTTAATCAGACAGCAAAAATCTAAAATTAAAGAACAACAGAAACTT
ATTGAGTTCATCAAAGCTGACAGTTTATTAAAACAAATAAAGGAAAATCG
CAATTTAATATCGAATAGTTCAGAAAGCGATAATAGAATTCATATTATAA
ATTCTCCTACTGAACTCCACGAAGATGATGAAAATTTAGAAAAAAATTAT
TTACCGAATACAAAATTACAAAATCAATTTGTTTTAAAAATGGAGGCAAG
AGCCAAGGAAAGAGAAAGAATTAGGGTGGAAAGACTTGAAAAGCAAAAAA
AACAAGATGAAGAGAAAAAAAAACAACTCGAAGAAAAATTATTAGAGCAA
ACTAAACTTGAATTTGAAGAAAAGAGAAAAAGAGAAAAATTACTCAAAGA
GAAAAGAGAAAAAGAAAGACTAAAAGAAGAATCAAAACAGAAACGAGTCA
AACGGGAGCAGGAATGTAATCAAATAGCAGACAATTTCTACAAGCATTTA
TTACTGAAACATTACGGAATAGAAAGGTTCAAGAAATTGGTTACTGCCAA
GCTGCAAAATCATGAAAAGGCGCAACATCATTATGAATTAACAATATTAA
AGAAATCGCTTGACTGTTGGAAGAGAGACGTCGAAACCGTTAAGGAATAT
CAAGATAAAATTGTTAAATCCTTTTATTATCGTATTTTAATGAGACGATG
TCTTTATCACATGAAATTATTTAAGCATCGCTACGAACTCATGGAAGAAT
CGGCCGACAGTCATTACTTGAAAACTTTAATGAAAATATCATTTAATCAT
TGGCGAACAACCAATCACAGACAGCAAATACGACTGGACAAACTTGGAAT
TCAGTGCGATAATTTATATGAAAGATCTCTAAAAATGCAAATGTTTACAA
CATGGCGACAATTGCCCATGGCCAAAAGGAAAGAACGAGAACGAGAAAGA
AGAATAGATATATTAAGGCAGAAAGTGACGAGTATTATTCCTGATTTTAA
GCCTGTTAATGATAATAAAAGTTGAAAATCG
back to top

protein sequence of SMED30017794-orf-1

>SMED30017794-orf-1 ID=SMED30017794-orf-1|Name=SMED30017794-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=901bp
MGDNYNNMFVWKSYKGFTKEEHKNKEVDDLKYWKTRTTDATNSAIKKVII
KNNSEMLNDSDDNVYSEAKNLVKSWLTNKKVYGNYYDKQSFLNLSDDELE
FNVPTRTEIHKEWEHLVQRIETKEEYKAEMSEYLSKDNDNLKEDKKLKSV
LANLHKKTFVDSSKLRNVDSPKPLDMKKRIENRQEEVKKKREEKQKKEEI
KRLEILAEKEARVEAMKMLKEEKKQKELSFKKEEELLQIEMNKIRCELQR
KREQEMLESKRLKETQELIKLQEKHKVSTQKLEETTKALDSNIKKNSNER
FKIIAEIVEKKVFNKNLQLIGKYFRAWKNEIESAKLKMERAKVWFAWKNS
RKIFRAWYSYSRSARLYFQINVEQERIKLIQMKENMAVNFWKNNLLKKCI
LNWSLFVIDEKESRWCEKLEEMRKKKMISYIEAIQEKAMENQAKLDKLSL
ETFEKNKLKDESISNRTTQSHLTNETARSSHRSNKSLQSQIQCTSARPAI
QNKKPKEAWQITKKDVYLPLDQLIDNVNQDEKYYETPHNRKSLKHPKIIN
SFAHRDAAQKELIRQQKSKIKEQQKLIEFIKADSLLKQIKENRNLISNSS
ESDNRIHIINSPTELHEDDENLEKNYLPNTKLQNQFVLKMEARAKERERI
RVERLEKQKKQDEEKKKQLEEKLLEQTKLEFEEKRKREKLLKEKREKERL
KEESKQKRVKREQECNQIADNFYKHLLLKHYGIERFKKLVTAKLQNHEKA
QHHYELTILKKSLDCWKRDVETVKEYQDKIVKSFYYRILMRRCLYHMKLF
KHRYELMEESADSHYLKTLMKISFNHWRTTNHRQQIRLDKLGIQCDNLYE
RSLKMQMFTTWRQLPMAKRKERERERRIDILRQKVTSIIPDFKPVNDNKS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000464GABAergic neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026174CC191
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 177..274
NoneNo IPR availableCOILSCoilCoilcoord: 431..451
NoneNo IPR availableCOILSCoilCoilcoord: 563..583
NoneNo IPR availableCOILSCoilCoilcoord: 638..717
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 170..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 461..505
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 465..499
NoneNo IPR availablePANTHERPTHR22028UNCHARACTERIZEDcoord: 36..896
IPR026174Coiled-coil domain-containing protein 191PANTHERPTHR22028:SF5COILED-COIL DOMAIN-CONTAINING PROTEIN 191coord: 36..896