Zinc finger MYM-type protein 1

Overview
NameZinc finger MYM-type protein 1
Smed IDSMED30017770
Length (bp)7325
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYM-type protein 1 (SMED30017770) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30017770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger MYM-type protein 1 (SMED30017770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30017770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017770SMESG000042368.1 SMESG000042366.1 dd_Smed_v4_14779_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017770SMESG000042368.1 SMESG000042366.1 dd_Smed_v4_14779_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017770SMESG000042368.1 SMESG000042366.1 dd_Smed_v4_14779_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017770SMESG000042369.1 dd_Smed_v4_12925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017770SMESG000042369.1 dd_Smed_v4_12925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017770SMESG000077136.1 Contig13198newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017770SMESG000077136.1 Contig13198uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30017770SMESG000042369.1 dd_Smed_v4_12925_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 59.6918 bits (143), Expect = 8.336e-8
Identity = 35/115 (30.43%), Postives = 68/115 (59.13%), Query Frame = 2
Query: 3329 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            N++ L  +I+ + +LG+Q L   GN++S +S+N+GN++E++ + ++        L N+ V    S+ +Q+D+I  I   + + I +EI ++   SII DET N   +  +S C++
Sbjct:  550 NKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVR 664          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 59.6918 bits (143), Expect = 8.336e-8
Identity = 35/115 (30.43%), Postives = 68/115 (59.13%), Query Frame = 2
Query: 3329 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            N++ L  +I+ + +LG+Q L   GN++S +S+N+GN++E++ + ++        L N+ V    S+ +Q+D+I  I   + + I +EI ++   SII DET N   +  +S C++
Sbjct:  550 NKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVR 664          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 59.6918 bits (143), Expect = 8.336e-8
Identity = 35/115 (30.43%), Postives = 68/115 (59.13%), Query Frame = 2
Query: 3329 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            N++ L  +I+ + +LG+Q L   GN++S +S+N+GN++E++ + ++        L N+ V    S+ +Q+D+I  I   + + I +EI ++   SII DET N   +  +S C++
Sbjct:  550 NKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVR 664          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 59.6918 bits (143), Expect = 8.336e-8
Identity = 35/115 (30.43%), Postives = 68/115 (59.13%), Query Frame = 2
Query: 3329 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            N++ L  +I+ + +LG+Q L   GN++S +S+N+GN++E++ + ++        L N+ V    S+ +Q+D+I  I   + + I +EI ++   SII DET N   +  +S C++
Sbjct:  550 NKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVR 664          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.295e-25
Identity = 69/235 (29.36%), Postives = 114/235 (48.51%), Query Frame = 2
Query: 3044 RHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHE---------KNVGFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNR-----------QILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLD---------NATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVS 3661
            R F    Y    WL       A+YC+SC +F  E         K +G +   +    +K HA++ +H+  M+            + N Y++K    A      + +           +IL+ LID+  YL +Q  AF G++ES++S N+GN+IE++  L++Y+ ++K +LD              S LS+  QND+I ++   +  KI +EIKE    SI+LDETT+  ++  VS
Sbjct:  200 RSFQRSWYTDRPWLEYSPKNDAIYCFSCRIFLREEKFKNKTAWKTLGINTWRSATGKMKEHASTEAHMMSMV------------RWNIYSKKALQTAFDTSDIQGKAIRERERQRNREILTRLIDISLYLARQGQAFRGDDESSSSANQGNFIELVKTLAQYDSVMKLHLDAIQEKQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVS 422          

HSP 2 Score: 40.817 bits (94), Expect = 1.295e-25
Identity = 28/78 (35.90%), Postives = 46/78 (58.97%), Query Frame = 3
Query: 3642 STKWQLAIV*RYVSNDGAILEGLIKFIDV--L*TRDAKALSDIILTFLKNEKLNHKLV-AQSYDGAAVMSGESRGLQA 3866
            S K Q++ V RYV +    +E   +F+ V  L +   K L +++++ L++  L+ K +  Q YDGAA MSG  +GLQ+
Sbjct:  416 SHKEQVSFVVRYVRD----MEVKERFLQVCTLESTTGKELENVVISLLQDNGLDLKNIRGQGYDGAANMSGMYKGLQS 489          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: si:ch211-240b21.2 (si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526-125])

HSP 1 Score: 68.9366 bits (167), Expect = 5.043e-12
Identity = 35/72 (48.61%), Postives = 53/72 (73.61%), Query Frame = 3
Query: 4725 DEILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELL 4940
            D + +FM+N +L+  F+E   L K+++T P TTA AER FS++KRIK + RN +  ERL++LA++SIEK L+
Sbjct:  136 DLLQLFMEN-NLEEVFSETVTLVKILVTTPMTTAEAERCFSTLKRIKTFLRNSMTQERLNALAMLSIEKRLV 206          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 5.778e-6
Identity = 29/89 (32.58%), Postives = 53/89 (59.55%), Query Frame = 3
Query: 4743 MKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTENFYDSVINILSHKDRR 5009
            +++  L +C+       ++ LT P T A+ +R FS +K IKNY R+ +  ERLS+L+++SIE E+ + +    +F D + +  + K R+
Sbjct:  635 IQDYSLADCYPNIDTAFRIFLTSPVTVASCKRSFSKLKLIKNYLRSSMEQERLSNLSILSIEHEMARKI----DFDDVIDHFAAMKARK 719          
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Match: sp|Q5SVZ6|ZMYM1_HUMAN (Zinc finger MYM-type protein 1 OS=Homo sapiens OX=9606 GN=ZMYM1 PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.003e-7
Identity = 35/115 (30.43%), Postives = 68/115 (59.13%), Query Frame = 2
Query: 3329 NRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            N++ L  +I+ + +LG+Q L   GN++S +S+N+GN++E++ + ++        L N+ V    S+ +Q+D+I  I   + + I +EI ++   SII DET N   +  +S C++
Sbjct:  550 NKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVR 664          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2S2NR69 (Zinc finger MYM-type protein 1 OS=Schizaphis graminum OX=13262 GN=ZMYM1_111 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.964e-100
Identity = 83/225 (36.89%), Postives = 132/225 (58.67%), Query Frame = 2
Query: 3011 GNLRTRTKKCVRHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHEKNV----GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
             N + + K  +RHF+   Y    WLTG    + L+CW C+LF  EKNV    GF +LNN    +++H  S +H+  ++ LK F  + RI+       +++         KNR +L   ID VC+L   EL F G+NE   S ++GN++  +NLLS Y+ +L  +L+ + +F G S+ +QNDLI ++SN+++  I SEIK ++FV+I+LDET++  N   +S  L+
Sbjct:   44 SNHKEKNKVYIRHFNISNYLNTPWLTGSAKLNKLFCWPCVLFTREKNVWSHSGFVNLNNLTNGIQKHERSQTHISSVLKLKTFG-KPRIDLQLDEQRRSYVIRHNELVKKNRDVLKRFIDCVCFLVIHELPFRGHNERVNSFDQGNFLGCLNLLSSYDSILNVHLETSKIFRGTSNRIQNDLICSVSNIISTSIESEIKNSNFVAILLDETSDITNLSQLSTTLR 267          

HSP 2 Score: 110.153 bits (274), Expect = 5.964e-100
Identity = 77/257 (29.96%), Postives = 134/257 (52.14%), Query Frame = 2
Query: 3968 FFTTLSGLPRFFNQSSKRVAASDQYSSQRLPKVSSTRWEYNGRLVKTVTRLQNLKL-YFSSIKNQTSDFDWDKDSLILATGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDI*QKKIYDISYCIRKITEFK--------NMIDELVIQKXXXXXXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMKNRFDSLKQIKFIELTDTNLPPK------QFPVDLIKNLK-INYMQYFDIQKLETELKVIF 4690
            FF TL+G+  FF +SSKR  A   ++ +++PK + TRW ++ RLV TV    +  + +F  + + ++D  WD ++++L+  F  FL       LL  F++IF  +++LY++ Q K  DI YC++KI E K        N+ ++L             +  +      Q++    K     YKVL N+I   +++ ++ RF SL + +F+ L D   P K      +FP   ++NL+  N+ + FD  +L  EL V++
Sbjct:  368 FFQTLTGMGSFFTKSSKRTHALSNFTRKKMPKNAPTRWNFSSRLVNTVHEYNSYFIEFFQHVLDNSND--WDNEAIVLSQVFINFLDSRQTYFLLIVFSKIFSLTDILYEVLQTKRLDILYCVKKIEETKCQLQNYRLNLFEQL----------WETVLSDKGDFEPQRKIRDPKTF---YKVLFNEIFDNILTNLQARFGSLNKFEFLSLID---PSKYSNYTNEFPNSALENLQESNFGEIFDFIRLRNELIVLY 606          

HSP 3 Score: 90.8929 bits (224), Expect = 5.964e-100
Identity = 49/89 (55.06%), Postives = 63/89 (70.79%), Query Frame = 3
Query: 4743 MKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTENFYDSVINILSHKDRR 5009
            +K  DL + F E  KL +L+LTIP TTA+ ER FS++KRIK+Y R+  G ERLSSL++ISIEKELL   K+   FYD VIN    ++RR
Sbjct:  622 IKMNDLISVFQEVFKLSQLILTIPITTASVERSFSALKRIKSYQRSTQGQERLSSLSLISIEKELLHKEKNHPEFYDKVINEFIKQERR 710          

HSP 4 Score: 62.3882 bits (150), Expect = 5.964e-100
Identity = 36/83 (43.37%), Postives = 48/83 (57.83%), Query Frame = 3
Query: 3654 QLAIV*RYVSND-GAILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLNHKLVAQSYDGAAVMSGESRGLQA-LKKCYQISQF 3896
            QL+   RYV ++ G   E  I F+DV   R A  L   ++  +   +L HKLVAQ+YDGAAVMSG   GLQ  +K+ Y  + F
Sbjct:  261 QLSTTLRYVHHETGEAHERFISFVDVSADRSADGLLKYVIDIVNRYELKHKLVAQTYDGAAVMSGHVGGLQVKVKELYPRALF 343          

HSP 5 Score: 31.9574 bits (71), Expect = 5.964e-100
Identity = 14/32 (43.75%), Postives = 20/32 (62.50%), Query Frame = 1
Query: 2908 MEDDNCNCIIEKLFEQSFGSRLFGDNMEIIKN 3003
            M  D+ NC+IE L E  F  + FG+ + I+KN
Sbjct:    1 MNTDSNNCLIEHLLENEFHLKNFGEKLTIVKN 32          

HSP 6 Score: 28.8758 bits (63), Expect = 5.964e-100
Identity = 13/35 (37.14%), Postives = 19/35 (54.29%), Query Frame = 1
Query: 3871 KNVIKSANFVHGLAHRISFVLQKSCEKENQCKIFY 3975
            K +   A FVH  +H ++ VL +S      CKIF+
Sbjct:  335 KELYPRALFVHCFSHSLNLVLSQSASNIKDCKIFF 369          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: X1WND4 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.510e-93
Identity = 105/233 (45.06%), Postives = 143/233 (61.37%), Query Frame = 2
Query: 3008 LGNLRTRTKKCVRHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHEKNV----GFSDLNNFEKPVKRHAASASHLQCMIALKKF-----------STQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVS 3661
            L NL+++ KK  R+F++  Y   +WL+GC+    LYCW C+LF  E NV    GF DLNN+     RH  + SH++C+I LKKF           + +  IEK N  T KN           NR ++S LID  CYL +QEL F G++E   S NRGNY+E+INL+   +  L  +L  ATVFSGLS D+QNDLI +ISNV+ +K+  EIK  DFVSII+DETT+ +++  +S
Sbjct:   51 LQNLKSKNKKTFRYFNSSYYDSNKWLSGCEKTQKLYCWPCILFSRESNVWSKFGFVDLNNYHNLKHRHETNRSHIECLITLKKFGNIRIETCLSEAYKISIEKHNE-TIKN-----------NRYVVSRLIDATCYLAKQELPFRGHDEQITSTNRGNYVELINLMGTLDLKLSGHLSTATVFSGLSGDIQNDLIQSISNVLMKKVTLEIKNVDFVSIIMDETTDVVSKSQLS 271          

HSP 2 Score: 127.102 bits (318), Expect = 2.510e-93
Identity = 78/248 (31.45%), Postives = 137/248 (55.24%), Query Frame = 2
Query: 3968 FFTTLSGLPRFFNQSSKRVAASDQYSSQRLPKVSSTRWEYNGRLVKTVTRLQN--LKLYFSSIKNQTSDFDWDKDSLILATGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDI*QKKIYDISYCIRKITEFKNMIDELVIQKXXXXXXXXXXXXXXXQLTSQKRELSR--KNISQHYKVLINKIGQKMISEMKNRFDSLKQIKFIELTDTNLPPK---QFPVDLIKNLKINYMQYFDIQKLETELKVIF 4690
            FF TLSGL  FF++S+KR+ A +Q   +R P V+ TRW YN RLV+ ++  +   L L  + I+N      WD ++L  A GF Q + D DF   L  F +I PQ+ +L++I Q KI+D++YC  KI +F N +  +     +   +        + L S++  ++   ++   +Y+ L  +I   +++++  RF  + +++F  L D +   +   QFP   + +LK +Y +YFD   L++EL +++
Sbjct:  374 FFLTLSGLSSFFSKSTKRIYALEQEVKKRFPSVAPTRWNYNSRLVEMMSEYKQEVLNLMDTIIENGEK---WDSETLSCARGFFQTIQDFDFNFFLLIFGDILPQATILFNILQTKIFDVTYCNTKILDFVNHLKNMRNNFDQIWSKSEQYLNTEMPLRSKRLRITEVSEDKKTNYRRLFFEIIDVLVTKINERFSEISKLQFFSLLDFSKFDQFVNQFPTSSMDSLKNSYGEYFDFSILKSELTIVY 618          

HSP 3 Score: 68.9366 bits (167), Expect = 2.510e-93
Identity = 34/75 (45.33%), Postives = 50/75 (66.67%), Query Frame = 3
Query: 3645 TKWQLAIV*RYVSNDGAILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLNHKLVAQSYDGAAVMSGESRGLQAL 3869
            +K QL+I+ RY++ +G + E  + F+DV   R AK L++     L+     +KL+AQ+YDGAAVMSG+  GLQAL
Sbjct:  266 SKSQLSIIFRYITQEG-VQERFLGFVDVSQDRSAKCLAEHTFNILQEYNCENKLIAQTYDGAAVMSGQHNGLQAL 339          

HSP 4 Score: 31.5722 bits (70), Expect = 2.510e-93
Identity = 12/31 (38.71%), Postives = 23/31 (74.19%), Query Frame = 1
Query: 3883 KSANFVHGLAHRISFVLQKSCEKENQCKIFY 3975
            K+A FVH  AH+++ +L++S +   +CK+F+
Sbjct:  345 KNAMFVHCYAHKLNLILKQSVDHIKECKVFF 375          

HSP 5 Score: 87.4261 bits (215), Expect = 2.919e-13
Identity = 47/118 (39.83%), Postives = 74/118 (62.71%), Query Frame = 3
Query: 4656 FKSLKLNLKLYFCDSDI*NKKYADEILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTENFYDSVINILSHKDRR 5009
            F  LK  L + +  ++  +K+  +E+ +++K+ +L     + +KL  L+LTIP T+A AER FS++KRI  Y RN     RLS+L+++SIEK+LL  ++   +FYD VI   S K RR
Sbjct:  607 FSILKSELTIVYSSTEF-HKRNINELWLYLKSTELSESLPQVTKLSSLILTIPATSAGAERSFSTLKRIHTYLRNSQSQNRLSALSILSIEKQLLTQIQKENSFYDEVIEDYSKKPRR 723          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A3P8T3K6 (Uncharacterized protein OS=Amphiprion percula OX=161767 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 8.135e-88
Identity = 89/225 (39.56%), Postives = 133/225 (59.11%), Query Frame = 2
Query: 3011 GNLRTRTKKCVRHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHEKNV----GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            G L+T  +K  R F T  Y +  WL GC + + L+C+SCLLF    NV    G+ DL N ++ + +H  S +H+Q  IALK F    RI+       +   +    K  +NR+IL  LI+  C+L +Q+LAF GN+ES  S NRGNY+E+++  +E +  L  +L+ +TVFSGLS+ +QNDLI A+ +V+   I  EI    FV++ +DETT+  N   +S  L+
Sbjct:   81 GLLQTTGQK-TRSFQTDWYTRKSWLCGCPARNRLFCFSCLLFSTCDNVWTQMGYCDLKNLQRSLIKHERSTAHIQSQIALKTFG-MSRIDLALDEQRRLNISIHNAKVKENREILKDLINATCFLAKQQLAFRGNDESTGSANRGNYVELLHAFAEKDDRLARHLETSTVFSGLSNRIQNDLIEAVGDVIRNDIKKEIGAAPFVAVEVDETTDVTNLAQISVILR 303          

HSP 2 Score: 97.0561 bits (240), Expect = 8.135e-88
Identity = 71/241 (29.46%), Postives = 122/241 (50.62%), Query Frame = 2
Query: 3968 FFTTLSGLPRFFNQSSKRVAASDQYSSQRLPKVSSTRWEYNGRLVKTVTRLQN-LKLYFSSIKNQTSDFDWDKDSLILATGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDI*QKKIYDISYCIRKITEFKNMIDELVIQKXXXXXXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMKNRFDSLKQIKFIELTDT---NLPPKQFPVDLIKNLKINYMQYFDIQKLETEL 4678
            FF T  GL  FF++S+KR    D    +RLP+ + TRW  N RL++T++  QN L+  F  I        WD D+L++A G+ ++L       LL  + +IF +S+ L+ + Q K+ DI YC+ +I +    ++ + + KF+   +    + + L LT       R +I    K +   I + +  +MK RFD   ++ F+ L D        + F    +++L   Y ++FD  KL+ +L
Sbjct:  406 FFKTAEGLAAFFSKSTKRTHLLDDVVKRRLPRAAPTRWSSNSRLLQTISMHQNDLRTLFRVITENPD--SWDNDTLMMAAGYDRWLSKASTCFLLMAYEDIFNESDALFRVLQNKVMDIEYCLARIRDTVAALERMRL-KFDSFCDRFEQKCSTLGLTESG---DRHSIRCGRKRVFCNILENISCQMKARFDHFGELAFLGLVDCAKFGEMSQNFDDAKLQSLS-KYARFFDFVKLKADL 639          

HSP 3 Score: 90.5077 bits (223), Expect = 8.135e-88
Identity = 50/99 (50.51%), Postives = 65/99 (65.66%), Query Frame = 3
Query: 4716 KYADEILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKE-LLKTLKSTENFYDSVINILSHKDRR 5009
            K   ++L F+  +DL     E +KL +LVLT+P TTA+ ER FS++KR+K Y+RN+    RLSSLAVISIE E LLK  K  E FY  VI+    K+RR
Sbjct:  653 KSPGQLLRFLAQKDLIETVPEATKLLQLVLTVPATTASVERSFSALKRLKTYSRNRTDQGRLSSLAVISIETERLLKLKKDKEGFYKEVIDAFLQKERR 751          

HSP 4 Score: 54.299 bits (129), Expect = 8.135e-88
Identity = 30/74 (40.54%), Postives = 45/74 (60.81%), Query Frame = 3
Query: 3654 QLAIV*RYVSNDGA---ILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLNHKLVAQSYDGAAVMSGESRGLQA 3866
            Q++++ RYV+   A   + E  + F DV   R A A+++ +L  L+      KLVAQ+YDGAAVM+ E  G+QA
Sbjct:  297 QISVILRYVATSEAGCEVKEAFLGFDDVSEDRRAPAIAEYVLGVLEKYDCADKLVAQTYDGAAVMASELNGVQA 370          

HSP 5 Score: 25.0238 bits (53), Expect = 8.135e-88
Identity = 11/35 (31.43%), Postives = 19/35 (54.29%), Query Frame = 1
Query: 3871 KNVIKSANFVHGLAHRISFVLQKSCEKENQCKIFY 3975
            K  +  A F H  AH+++ VL  S +   +C+ F+
Sbjct:  373 KEKVPEAMFTHCYAHKLNLVLLHSAKCMPECRTFF 407          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A3Q1CU62 (Uncharacterized protein OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 9.655e-88
Identity = 88/226 (38.94%), Postives = 132/226 (58.41%), Query Frame = 2
Query: 3008 LGNLRTRTKKCVRHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHEKNV----GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            L +L   T +  R F T  Y +  WL GC + + L+C+SCLLF    NV    G+ DL N ++ + +H  S + +Q  IALK F    RI+       +   +    K  +NR+IL  LI+  C+L +Q+LAF GN+ES  S NRGNY+E+++  +E +  L  +L+ +TVFSGLS+ +QNDLI A+ +V+   I  EI    FV++ +DETT+  NQ  +S  L+
Sbjct:  111 LKSLLQTTGQKTRSFQTDWYTRKSWLCGCPARNRLFCFSCLLFSTCDNVWTQMGYCDLKNLQRSLIKHERSTAQIQSQIALKTFG-MSRIDLALDEQRRLNISIHNAKVKENREILKDLINATCFLAKQQLAFRGNDESTGSANRGNYVELLHAFAEKDDRLARHLETSTVFSGLSNRIQNDLIEAVGDVIRNDIKKEIGAAPFVAVEVDETTDVTNQAQISVILR 335          

HSP 2 Score: 95.9005 bits (237), Expect = 9.655e-88
Identity = 70/241 (29.05%), Postives = 122/241 (50.62%), Query Frame = 2
Query: 3968 FFTTLSGLPRFFNQSSKRVAASDQYSSQRLPKVSSTRWEYNGRLVKTVTRLQN-LKLYFSSIKNQTSDFDWDKDSLILATGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDI*QKKIYDISYCIRKITEFKNMIDELVIQKXXXXXXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMKNRFDSLKQIKFIELTDT---NLPPKQFPVDLIKNLKINYMQYFDIQKLETEL 4678
            FF T  GL  FF++S+KR    D    +RLP+ + TRW  N RL++T++  QN L+  F  I        WD D+L++A G+ ++L       LL  + +IF +++ L+ + Q K+ DI YC+ +I +    ++ + + KF+   +    + + L LT       R +I    K +   I + +  +MK RFD   ++ F+ L D        + F    +++L   Y ++FD  KL+ +L
Sbjct:  438 FFKTAEGLAAFFSKSTKRTHLLDDVVKRRLPRAAPTRWSSNSRLLQTISMHQNDLRTLFRVITENPD--SWDNDTLMMAAGYDRWLSKASTCFLLMAYEDIFNETDALFRVLQNKVMDIEYCLVRIRDTVAALEPMRL-KFDSFCDRFEQKCSTLGLTESG---DRHSIRCERKRVFCNILENISCQMKARFDHFGELAFLGLVDCAKFGEMSQNFDDAKLQSLS-KYARFFDFMKLKADL 671          

HSP 3 Score: 91.6633 bits (226), Expect = 9.655e-88
Identity = 51/99 (51.52%), Postives = 65/99 (65.66%), Query Frame = 3
Query: 4716 KYADEILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKE-LLKTLKSTENFYDSVINILSHKDRR 5009
            K   ++L F+  +DL     E +KL +LVLTIP TTA+ ER FS++KR+K Y+RN+    RLSSLAVISIE E LLK  K  E FY  VI+    K+RR
Sbjct:  685 KSPGQLLSFLAQKDLIETVPEATKLLQLVLTIPATTASVERSFSALKRLKTYSRNRTDQGRLSSLAVISIETERLLKLKKDKEGFYKEVIDAFLQKERR 783          

HSP 4 Score: 54.6842 bits (130), Expect = 9.655e-88
Identity = 30/74 (40.54%), Postives = 45/74 (60.81%), Query Frame = 3
Query: 3654 QLAIV*RYVSNDGA---ILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLNHKLVAQSYDGAAVMSGESRGLQA 3866
            Q++++ RYV+   A   + E  + F DV   R A A+++ +L  L+      KLVAQ+YDGAAVM+ E  G+QA
Sbjct:  329 QISVILRYVATSEAGCEVKEAFLGFDDVSEDRRAPAIAEYVLGVLEKYDCADKLVAQTYDGAAVMASELNGVQA 402          

HSP 5 Score: 25.0238 bits (53), Expect = 9.655e-88
Identity = 11/35 (31.43%), Postives = 19/35 (54.29%), Query Frame = 1
Query: 3871 KNVIKSANFVHGLAHRISFVLQKSCEKENQCKIFY 3975
            K  +  A F H  AH+++ VL  S +   +C+ F+
Sbjct:  405 KEKVPEAMFTHCYAHKLNLVLLHSAKCMPECRTFF 439          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A3Q1CGB3 (Uncharacterized protein OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.548e-86
Identity = 90/225 (40.00%), Postives = 132/225 (58.67%), Query Frame = 2
Query: 3011 GNLRTRTKKCVRHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHEKNV----GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            G L+T  +K  R F T  Y +  WL GC + + L+C+SCLLF    NV    G+ DL N ++ + +H  S +H+Q  IALK F    RI+            A+  +   N +IL  LI+  C+L +Q+LAF GN+ES  S NRGNY+E+++  +E +  L  +L+ +TVFSGLS+ +QNDLI A+ +V+   I  EI    FV+I +DETT+  NQ  +S  L+
Sbjct:   50 GLLQTMGQK-TRSFQTDWYTRKGWLCGCPARNRLFCFSCLLFSTCDNVWIQMGYCDLKNLQRSLIKHERSTTHIQSQIALKMFG-MSRID-----------WALDEQRRLNIKILKDLINATCFLAKQQLAFRGNDESTGSANRGNYVELLHAFTEKDDRLVRHLETSTVFSGLSNRIQNDLIEAVGDVIRNDIKKEIGAAPFVAIEVDETTDVTNQAQISVILR 261          

HSP 2 Score: 98.5969 bits (244), Expect = 2.548e-86
Identity = 72/241 (29.88%), Postives = 125/241 (51.87%), Query Frame = 2
Query: 3968 FFTTLSGLPRFFNQSSKRVAASDQYSSQRLPKVSSTRWEYNGRLVKTVTRLQN-LKLYFSSIKNQTSDFDWDKDSLILATGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDI*QKKIYDISYCIRKITEFKNMIDELVIQKXXXXXXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMKNRFDSLKQIKFIELTDT---NLPPKQFPVDLIKNLKINYMQYFDIQKLETEL 4678
            FF T  GL  FF++S+KR    D    +RLP+ + TRW  N RL++T++  QN L+  F  I  + SD  WD D L++A G+ ++L       LL  + +IF +++ L+ + Q K+ DI YC+ +I +    ++ + + KF+   +    + + L LT       R +I    K +   I + +  +MK RFD   ++ F+ L D        + F  + +++L   Y ++FD  KL+ +L
Sbjct:  364 FFKTAEGLAAFFSKSTKRTHLLDDVVKRRLPRAAPTRWSSNSRLLQTISMHQNDLRTLFRVI-TENSD-SWDNDMLMMAAGYDRWLSKASTCFLLMAYEDIFNETDALFRVLQNKVMDIEYCVARIRDTVAALERMRL-KFDSFCDRFEQKCSTLGLTESG---DRHSIRCERKRVFCNILENISCQMKARFDHFGELAFLGLVDCAKFGEMSQNFDDEKLQSLS-KYARFFDFVKLKVDL 597          

HSP 3 Score: 91.2781 bits (225), Expect = 2.548e-86
Identity = 51/99 (51.52%), Postives = 65/99 (65.66%), Query Frame = 3
Query: 4716 KYADEILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKE-LLKTLKSTENFYDSVINILSHKDRR 5009
            K   ++L F+  +DL     E +KL +LVLTIP TTA+ ER FS++KR+K Y+RN+    RLSSLAVISIE E LLK  K  E FY  VI+    K+RR
Sbjct:  611 KSPGQLLSFLAQKDLIETVPEATKLLQLVLTIPATTASMERSFSALKRLKTYSRNRTDQGRLSSLAVISIETERLLKLKKDKEGFYKEVIDAFLQKERR 709          

HSP 4 Score: 48.9062 bits (115), Expect = 2.548e-86
Identity = 28/74 (37.84%), Postives = 44/74 (59.46%), Query Frame = 3
Query: 3654 QLAIV*RYVSNDGA---ILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLNHKLVAQSYDGAAVMSGESRGLQA 3866
            Q++++ RYV+   A   + E  + F +V   R A A+++ +L  L+      KLVAQ+YDGAAVM+ E   +QA
Sbjct:  255 QISVILRYVATSEAGCEVKEAFLGFDNVSEDRRAPAIAEYVLGVLEKYDCADKLVAQTYDGAAVMASELNDVQA 328          

HSP 5 Score: 25.0238 bits (53), Expect = 2.548e-86
Identity = 11/35 (31.43%), Postives = 19/35 (54.29%), Query Frame = 1
Query: 3871 KNVIKSANFVHGLAHRISFVLQKSCEKENQCKIFY 3975
            K  +  A F H  AH+++ VL  S +   +C+ F+
Sbjct:  331 KEKVPEAMFTHCYAHKLNLVLLHSAKCMPECRTFF 365          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000034915.1 (pep primary_assembly:Astyanax_mexicanus-2.0:4:24766423:24768072:-1 gene:ENSAMXG00000029140.1 transcript:ENSAMXT00000034915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 4.611e-35
Identity = 82/227 (36.12%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 3032 KKCVRHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHEK-----NVGFSDLNNFEKPVKRHAASASHLQCMIALKKFST--------QQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            K  VRHF    +++  WLTG      LY W CLLF         N GF +L+   K  ++H  SA+HL+ ++  K F          +QR  +   + E+     V+    KNR+IL  LID V +LG+QEL F G++E   S N GNY+E+++ L+EY+  L  +L  + VF+G S  +QNDLI  ++ V+ + I  EIK+  F ++++DETT+  N   +S  L+
Sbjct:   44 KGYVRHFQASNWERYPWLTGSVQRKKLYYWDCLLFSSSDSSVWSNTGFDNLSCLTKAAQKHQNSAAHLRAVVLSKTFGDVRIDLQLNEQRRRETEMHNER-----VR----KNREILKRLIDCVIFLGKQELPFRGHDEGRVSANLGNYLELLSFLAEYDKDLHYHLSTSKVFTGTSGTIQNDLINVVAEVIGKSIKDEIKDAAFTAVMVDETTDISNTTQLSLVLR 261          

HSP 2 Score: 94.7449 bits (234), Expect = 2.248e-31
Identity = 60/192 (31.25%), Postives = 101/192 (52.60%), Query Frame = 2
Query: 3968 FFTTLSGLPRFFNQSSKRVAASDQYSSQRLPKVSSTRWEYNGRLVKTVTRLQN-LKLYFSSIKNQTSDFDWDKDSLILATGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDI*QKKIYDISYCIRKITEFKNMIDELVIQKXXXXXXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMKNRF 4540
            FF+  +GL  FF++S KR    D+   +RLP+V+ TRW    RLV TV   ++ LK  F+ I     DFD   D++  A G+   L + DF   L  F +IF  ++VL+DI Q K +D+ +C+ K+ EF   I++   Q+   +           + T+++   +  +   HYK L   I   +++++++RF
Sbjct:  360 FFSHPTGLAAFFSKSPKRTQLLDEICQKRLPRVAPTRWNLASRLVCTVFEKKDALKDVFNYIVEHHEDFD--HDAIHSADGYLSHLENFDFNFFLVTFKDIFGHADVLFDILQSKSFDMHFCLAKVEEFCTFIEQ---QREHFDQIYDTTVTETGEPTARR---THTDARAHYKALHGHILDSILNQVQDRF 543          

HSP 3 Score: 54.299 bits (129), Expect = 2.248e-31
Identity = 33/77 (42.86%), Postives = 52/77 (67.53%), Query Frame = 3
Query: 3636 ISSTKWQLAIV*RYVSNDGAILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLNHKLVAQSYDGAAVMSGESRGLQA 3866
            IS+T  QL++V RYV+ DG I E  +KF DV  ++ A  ++++++  L++ +   K+VAQ YDGAAVM+    G+QA
Sbjct:  250 ISNTT-QLSLVLRYVTEDG-IKERFVKFEDVTKSKRAHDIAELVMKCLEDFECVGKVVAQCYDGAAVMASGLNGVQA 324          

HSP 4 Score: 29.261 bits (64), Expect = 2.248e-31
Identity = 13/35 (37.14%), Postives = 20/35 (57.14%), Query Frame = 1
Query: 3871 KNVIKSANFVHGLAHRISFVLQKSCEKENQCKIFY 3975
            K  I  A F+H  AH ++ V+ +   K  +CKIF+
Sbjct:  327 KEKIPQALFIHCYAHTLNLVMSQGVAKIRECKIFF 361          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000042715.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11855083:11857132:-1 gene:ENSAMXG00000035113.1 transcript:ENSAMXT00000042715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 4.232e-23
Identity = 60/205 (29.27%), Postives = 102/205 (49.76%), Query Frame = 2
Query: 3059 GKYQQIEWLTGCKSFSALYCWSCLLFKHEKNV---GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSG--------LSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNF 3640
            G+    +WL    S   +YC++C LF  + N    GFSD  + E+ +  H  S  H  CM+AL   S      +     + +    +  +    R++L  ++ V+ +LG++ LAF G++E   S + GN++ II LL++++P L E+L     F G        LSS V  + I  +     + I +EIKE+ + S+I+D T + 
Sbjct:   35 GQTVTRQWLLYSPSTGCVYCFACKLFSSKHNTFVHGFSDWKHSER-IGEHEGSVEHRACMLALYNRS------RGTATIDSDIVKQIDAERQYWREVLKRVVAVIQFLGERGLAFRGDDELLGSAHNGNFLGIIELLAKFDPFLAEHLQR---FGGKGKGSVSYLSSTVCEEFIHLMGQRTKQAIVNEIKESKYFSVIVDSTPDL 229          

HSP 2 Score: 42.743 bits (99), Expect = 4.232e-23
Identity = 23/72 (31.94%), Postives = 42/72 (58.33%), Query Frame = 3
Query: 3654 QLAIV*RYVSNDGAILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLN-HKLVAQSYDGAAVMSGESRGLQA 3866
            QL  + R+V+NDG ++E  + F + +      +L++ ++  ++N  L+      QSYD A+ MSG+  G+QA
Sbjct:  234 QLTFIFRFVNNDGHVVERFLAF-EPIENHSGDSLAECVVAMVENLGLDLSNCRGQSYDNASNMSGKYNGIQA 304          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6285841:6288423:1 gene:ENSAMXG00000041958.1 transcript:ENSAMXT00000035531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.084e-17
Identity = 57/205 (27.80%), Postives = 97/205 (47.32%), Query Frame = 2
Query: 3059 GKYQQIEWLTGCKSFSALYCWSCLLFKHEKNV---GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSG--------LSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNF 3640
            G+    +WL    S   +YC++C LF  + N    GFSD  + E+ +  H  S  H  CM+AL   S      +     + +    +  +    R +L  ++ V+ +LG++     G +E   S + GN++ II LLS+++P L E+L     F G        LSS V  + I  +     + I ++IKE+ + S+I+D T + 
Sbjct:  199 GQTVTRQWLLYSPSTGCVYCFACKLFSSKHNTFVHGFSDWKHSER-IGEHEGSVEHRACMLALYNRS------RGTATIDSDIVKQIDAERQYWRDVLKRVVAVIQFLGER-----GLDELLGSAHNGNFLGIIELLSKFDPFLAEHLQR---FGGKGKGSVSYLSSTVCEEFIHLMGQRTKQAIVNKIKESKYFSVIVDSTPDL 388          

HSP 2 Score: 37.7354 bits (86), Expect = 1.084e-17
Identity = 21/72 (29.17%), Postives = 40/72 (55.56%), Query Frame = 3
Query: 3654 QLAIV*RYVSNDGAILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLN-HKLVAQSYDGAAVMSGESRGLQA 3866
            Q   + R+V+ND  ++E  + F + +      +L++ ++  ++N  L+      QSYD A+ MSG+  G+QA
Sbjct:  393 QPTFIFRFVNNDAHVVERFLAF-EPIENHSGDSLAECVVAMVENLGLDLSNCRGQSYDNASNMSGKYNGVQA 463          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035789.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000101.1:2843018:2852765:1 gene:ENSAMXG00000037827.1 transcript:ENSAMXT00000035789.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 1.251e-17
Identity = 35/90 (38.89%), Postives = 58/90 (64.44%), Query Frame = 2
Query: 3371 LGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNF 3640
             G  + +F G+ E    +N GN++ +I+LL+ Y+P+L+E LD  +  + LS  +QN+LI  +S  V ++I SEIKE +F S+I+D T + 
Sbjct:   44 FGFMQPSFQGHREKVGELNSGNFLSVIDLLARYDPVLRELLDKKSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDL 133          

HSP 2 Score: 32.7278 bits (73), Expect = 1.251e-17
Identity = 30/90 (33.33%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 3624 TKQQISSTKWQLAIV*RYVS-----NDGAIL----EGLIKFIDVL*TRDAKALSDIILTFLKNEKLN-HKLVAQSYDGAAVMSGESRGLQ 3863
            T Q +S    QL+ V RYV+      D AI     E  + F ++   + A+ L   I   ++++ L  HK   Q YDGA+ MSG   G+Q
Sbjct:  129 TTQDLSKVD-QLSQVFRYVTVRKDEADNAIAVDINESFLGFQNIS-DQTAQGLETKITELIQSKGLPLHKCRGQGYDGASTMSGIYSGVQ 216          

HSP 3 Score: 25.0238 bits (53), Expect = 1.251e-17
Identity = 11/39 (28.21%), Postives = 21/39 (53.85%), Query Frame = 1
Query: 3886 SANFVHGLAHRISFVLQKSCEKENQCKIFYHFIWSSKIF 4002
            +A +VH  AH ++ VL  +C+   + K +Y  +    +F
Sbjct:  225 NAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVF 263          

HSP 4 Score: 53.9138 bits (128), Expect = 2.404e-6
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 3
Query: 4734 LIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISI 4925
            L+ +++  + +   + +   KL LTIP T A+AER FS +K IKNY R+ +  +RLS LA++SI
Sbjct:  530 LLLLRHSSILSSVTDVATALKLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSI 593          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.408e-16
Identity = 52/179 (29.05%), Postives = 93/179 (51.96%), Query Frame = 2
Query: 3125 CLLFKHEKNVGFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNF--INQMA 3655
            CL       VG +D       +K+H +S +HL   +    +     ++      +  + + V+  +     +L  + DV   L    LAF G+ E    +N GN++ +I+LL+ Y+P+L+E LD  +  + LS  +QN+LI  +S  V ++I SEIKE +F S+I+D T +   ++Q++
Sbjct:   11 CLSHHPSWTVGINDWRGLSAKIKKHESSRAHLAACVVFDTWKNDLTVD---AQLDSEYKSQVRFWT----DVLMRITDVTLTLASCNLAFRGHREKVGELNSGNFLSVIDLLARYDPVLRELLDKKSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLS 182          

HSP 2 Score: 57.7658 bits (138), Expect = 1.519e-7
Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = 3
Query: 4794 KLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTE 4961
            KL LTIP T A+AER FS +K IKNY R+ +  +RLS LA++SIE +  + +  TE
Sbjct:  566 KLFLTIPVTVASAERSFSKLKMIKNYLRSTMSQDRLSGLAMLSIESQRSRRMDLTE 621          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO40596 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Q7])

HSP 1 Score: 48.1358 bits (113), Expect = 6.363e-6
Identity = 26/60 (43.33%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 4758 LDNCFNEYSK----LCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISI 4925
            L NC  E+      L +++ T+  T+A +ER FS++KR+K Y RN + +ER SSLA+IS+
Sbjct:   70 LKNCDAEFYPNVHVLLRILCTLSVTSAESERSFSTMKRLKTYLRNTMSTERESSLALISV 129          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Match: EDO40662 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J7])

HSP 1 Score: 50.447 bits (119), Expect = 9.489e-6
Identity = 26/61 (42.62%), Postives = 40/61 (65.57%), Query Frame = 3
Query: 4758 LDNCFNEYSK----LCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIE 4928
            L NC  E+      L +++ T+P T+A +ER FS++KR+K Y RN + +ER  SLA+IS+ 
Sbjct:  221 LKNCDAEFYPNVHVLLRILCTLPVTSAESERSFSTMKRLKTYLRNTMSTEREPSLALISVH 281          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000041223.1 (zinc finger MYM-type protein 1 [Source:NCBI gene;Acc:101155882])

HSP 1 Score: 150.984 bits (380), Expect = 1.412e-36
Identity = 83/216 (38.43%), Postives = 124/216 (57.41%), Query Frame = 2
Query: 3041 VRHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHEKN-----VGFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLK 3673
            VRHF    Y++  WLTG +    LYCW CLLF  +++      GF +L    K  K+H  +A HLQ ++  K F  + R+E       +        K  KNR+IL  LID V +LG+QEL+F G +ES  S NRGNY E++++++E N  L  +L     FSG S  +Q+DLI+AI  V+ ++I  E+K   FVS++++ETT+  N   ++  L+
Sbjct:   51 VRHFQVTNYERYPWLTGSEVHCKLYCWECLLFALDRHGVWSHTGFGNLTCLTKAAKKHQNTAGHLQSIVLSKTFG-ESRVELQLNEHARRETELHNEKVKKNREILKRLIDCVLFLGKQELSFRGRDESGGSSNRGNYCELLSVIAESNTDLHYHLSTNEAFSGTSGKIQDDLISAIDEVIRDEIRREVKNAPFVSVMVEETTDASNAAQLALALR 265          

HSP 2 Score: 97.8265 bits (242), Expect = 5.236e-27
Identity = 71/248 (28.63%), Postives = 121/248 (48.79%), Query Frame = 2
Query: 3968 FFTTLSGLPRFFNQSSKRVAASDQYSSQRLPKVSSTRWEYNGRLVKTV-TRLQNLKLYFSSIKNQTSDFDWDKDSLILATGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDI*QKKIYDISYCIRKITEFKNMIDELVIQKXXXXXXXXXXXXXXXQLTSQKRELSRKNISQHYKVLINKIGQKMISEMKNRFDSLKQIKFIELTDTNLP------PKQFPVDLIKNLKINYMQYFDIQKLETELKVIF 4690
            FF  L+GL  FF++S  R    D+   +RLP V+ T W+   R+V TV  + + LK  F  I    S+  +D+DS+  A GF   L   +F  LL+ FN IF  S++L+ I Q K  D+ +C+ ++ EF +      +++    +E +             R+    +  +HY+ L   I   +I + + RF   +++ F+ L D   P       + FP   + +L  ++   FD  +L+TEL V++
Sbjct:  364 FFAHLNGLVAFFSRSPWRTQLLDEICQRRLPGVTPTPWQSTSRVVNTVFEKREALKELFGHILENHSE--YDEDSVRCADGFKALLDCFEFCFLLHTFNGIFHYSDMLFSILQDKKSDVQFCLDRVKEFCD-----TVERERSRYEGVYEATERAAGAPSARKCHAVDPREHYRQLHGSILDNIICQTQTRFQDHEKMMFVTLLD---PLRFLEYRRSFPHAGLSSLARSHGALFDFSQLKTELTVMY 601          

HSP 3 Score: 45.8246 bits (107), Expect = 5.236e-27
Identity = 38/110 (34.55%), Postives = 60/110 (54.55%), Query Frame = 3
Query: 3639 SSTKWQLAIV*RYVSNDGAILEGLIKFIDVL*TRDAKALSDIILTFL-KNEKLNHKLVAQSYDGAAVMSGESRGLQALKK----------CY--QISQFRSRPSSQDKFC 3929
            +S   QLA+  RYV+  G + E  ++F DV   + A  ++ +++ FL +NE L+ K+VAQ ++GA V S    G+QA  K          CY  Q+S   S+ +S+ K C
Sbjct:  254 ASNAAQLALALRYVTRSG-VKERFVRFEDVTSGKRADDIAGLVIKFLLENECLD-KVVAQCFEGATVTSSGLNGVQAKVKESAPLALFIHCYAHQLSLVLSQGASKLKEC 361          

HSP 4 Score: 72.0182 bits (175), Expect = 6.710e-12
Identity = 42/118 (35.59%), Postives = 66/118 (55.93%), Query Frame = 3
Query: 4656 FKSLKLNLKLYFCDSDI*NKKYADEILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTENFYDSVINILSHKDRR 5009
            F  LK  L + +   D   K  +D IL F+   +L     +  +   L LTIP + A+ +R FS+++RI+ +A+N  G  RLS+LA+++IEK+ L  LK   N ++ VI     K+RR
Sbjct:  590 FSQLKTELTVMYTMDDFYGKSPSD-ILHFIHQNNLSEVMKQLYRFVCLALTIPASPASVKRTFSALERIQTHAKNTTGQTRLSALALMAIEKDFLMELKCV-NLHERVIEQFLRKERR 705          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 1.281e-17
Identity = 52/223 (23.32%), Postives = 100/223 (44.84%), Query Frame = 2
Query: 3044 RHFSTGKYQQIEWLTGCKSFSALYCWSCLLF----------------KHEKNVGFSDLNNFEKPVKRHAASASHLQCMIALKKFS-TQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVS 3661
            R FS   Y   +WL   +S  + +C++C  F                K+ K   F D       +  HA S +H   M+A  ++  +       +   +  +   VK    +NR+ +  + + +     Q +A  G+ ES    ++GN++ I+ LL++ NP++K  +      + L  D QN++I  ++ +V   I  E+ E++  SI++DET +   +  +S
Sbjct:  118 RCFSKDWYNAHKWLEYSQSKDSAFCYACRHFGLPASGESVLTSEEGFKNWKKATFKDGG-----LLGHARSEAHTTAMLAWAEYEKSTSGTASLSASLDAEYSKLVK----ENREYIKVVGETLLLTATQNIAQRGHKESEVD-SKGNFLAIMELLAKNNPIVKRKMAGQRNATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDETKDMSKKEQMS 330          

HSP 2 Score: 50.8322 bits (120), Expect = 1.281e-17
Identity = 32/77 (41.56%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 3642 STKWQLAIV*RYVSNDGAILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLNHK--LVAQSYDGAAVMSGESRGLQA 3866
            S K Q++ V RY  N G++ E  + F +     +A ALS  I+  L+   L++K  LV Q+YDGA+VMSG++ G+QA
Sbjct:  324 SKKEQMSFVIRYYYN-GSVCECFLAF-EAAQRLNAAALSQKIIEILQKHGLDYKNHLVGQAYDGASVMSGKNTGVQA 398          

HSP 3 Score: 54.6842 bits (130), Expect = 1.266e-6
Identity = 31/84 (36.90%), Postives = 49/84 (58.33%), Query Frame = 3
Query: 4764 NCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTENFYDSVINILS--HKDRR 5009
            +CF    KLCK+ L +P +TA+ ER FS++K IK   R+ I  ERLS+L V+S+E    + +       D  +++ +  H +RR
Sbjct:  582 HCF----KLCKVALALPVSTASCERSFSTLKLIKTALRSTISDERLSNLGVLSVESRRARAIN-----LDDFVDVFAKKHSNRR 656          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 76.6406 bits (187), Expect = 2.827e-13
Identity = 60/213 (28.17%), Postives = 113/213 (53.05%), Query Frame = 2
Query: 3080 WLTGCKSFSALYCWSCLLFKHEKNV-----GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYT-EKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSD-------VQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLKIC 3679
            WL   K  ++L+C+ C LF + KN+     G ++  +    +  H  S  HL CM A K+ S + R    +G T +K   A ++ +  + R +L+ LI +V  L  + LA  G+ E+  + + GN+++ + L++ ++P++K++L+   V  G +S        VQN+LI  +S+ +   I  +IK+  + SIILD T +  +   +S  +++ 
Sbjct:  183 WLMYSKVKNSLFCFCCKLFSN-KNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIR----SGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNR--VLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVV 388          

HSP 2 Score: 62.003 bits (149), Expect = 7.452e-9
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 3
Query: 4728 EILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTENFYDSVINILSHKDRR 5009
            E++ FM ++DL   +  +    ++ LT+P T A AER FS +K IK+Y R+ +  ERL++LAV+SI   + + +      YD VI+  + +  R
Sbjct:  759 ELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQIS-----YDDVIDEFASRKAR 847          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 76.6406 bits (187), Expect = 2.827e-13
Identity = 60/213 (28.17%), Postives = 113/213 (53.05%), Query Frame = 2
Query: 3080 WLTGCKSFSALYCWSCLLFKHEKNV-----GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYT-EKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSD-------VQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLKIC 3679
            WL   K  ++L+C+ C LF + KN+     G ++  +    +  H  S  HL CM A K+ S + R    +G T +K   A ++ +  + R +L+ LI +V  L  + LA  G+ E+  + + GN+++ + L++ ++P++K++L+   V  G +S        VQN+LI  +S+ +   I  +IK+  + SIILD T +  +   +S  +++ 
Sbjct:  183 WLMYSKVKNSLFCFCCKLFSN-KNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIR----SGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNR--VLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVV 388          

HSP 2 Score: 62.003 bits (149), Expect = 7.452e-9
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 3
Query: 4728 EILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTENFYDSVINILSHKDRR 5009
            E++ FM ++DL   +  +    ++ LT+P T A AER FS +K IK+Y R+ +  ERL++LAV+SI   + + +      YD VI+  + +  R
Sbjct:  759 ELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQIS-----YDDVIDEFASRKAR 847          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 76.6406 bits (187), Expect = 2.827e-13
Identity = 60/213 (28.17%), Postives = 113/213 (53.05%), Query Frame = 2
Query: 3080 WLTGCKSFSALYCWSCLLFKHEKNV-----GFSDLNNFEKPVKRHAASASHLQCMIALKKFSTQQRIEK*NGYT-EKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDNATVFSGLSSD-------VQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVSNCLKIC 3679
            WL   K  ++L+C+ C LF + KN+     G ++  +    +  H  S  HL CM A K+ S + R    +G T +K   A ++ +  + R +L+ LI +V  L  + LA  G+ E+  + + GN+++ + L++ ++P++K++L+   V  G +S        VQN+LI  +S+ +   I  +IK+  + SIILD T +  +   +S  +++ 
Sbjct:  183 WLMYSKVKNSLFCFCCKLFSN-KNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIR----SGKTIDKQEMALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNR--VLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVV 388          

HSP 2 Score: 62.003 bits (149), Expect = 7.452e-9
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 3
Query: 4728 EILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTLKSTENFYDSVINILSHKDRR 5009
            E++ FM ++DL   +  +    ++ LT+P T A AER FS +K IK+Y R+ +  ERL++LAV+SI   + + +      YD VI+  + +  R
Sbjct:  759 ELISFMSDKDLSEIYPNFWTALRIALTLPVTVAQAERSFSKLKLIKSYLRSTMSQERLTNLAVVSINHSVGEQIS-----YDDVIDEFASRKAR 847          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000069312.1 (SMESG000069312.1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.078e-22
Identity = 66/214 (30.84%), Postives = 100/214 (46.73%), Query Frame = 2
Query: 3041 VRHFSTGKYQQIEWLTGCKSFSALYCWSCLLFKHEKNVGFSDL------NNFEKPVKR--HAASASHLQCMIALKKFSTQQRIEK*NGYTEKNFCAAVK*KS*KNRQILSWLIDVVCYLGQQELAFCGNNESAA---SINRGNYIEIINLLSEYNPLLKENLDNATVFSG----LSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTN 3637
             R  + G      WL      S+ YC+ CLLF    N   S L      N   KP K   H  S +H     A K+   ++RI    G  +    A ++ +  K R +L  L+  V +L  Q LA  G+ ES A   S N GN++  + LL+EY+PLL  ++D+A    G    LS   QN+ I+ +++ V  K+ ++IK   +  I+ D T +
Sbjct:  165 TRRLANGDEINQTWLLYSPLKSSAYCFCCLLFPKSINNQRSGLTLPEGFNKLRKPEKMSAHENSPTHRASFTAWKE--AERRIMSGKG-IDAELQAQMQNEKQKWRDVLKRLLSCVKFLASQNLALRGHAESLATNNSSNVGNFLATLKLLAEYDPLLSNHIDHARQNPGSVSYLSPQTQNESISLLASKVRNKLLNDIKRNKYYGILFDSTPD 375          

HSP 2 Score: 35.4242 bits (80), Expect = 5.078e-22
Identity = 33/121 (27.27%), Postives = 55/121 (45.45%), Query Frame = 2
Query: 3968 FFTTLSGLPRFFNQSSKRVAASDQYSSQRLPKVSSTRWEYNGRLVKTV----TRLQNLKLYFSSIKNQTSDFDWDKDSLILATGFSQFLYDPDFLVLLYFFNEIFPQSEVLYDI*QKKIYD 4318
            FF T+  +  +F++S+ R        S  + +   TRW      VK V      +  L   FS+  +QT D   D + L+        + D +FLVLL+F+++I  +     D  QK++ D
Sbjct:  493 FFRTIKSIYLYFSRSTLRWNELKNVISNTVKRECETRWSARADAVKAVHNGVNEIVGLLEIFSADNSQTQDTRADAERLLAN------ILDFNFLVLLHFWHQILGK----IDRVQKRLQD 603          

HSP 3 Score: 32.3426 bits (72), Expect = 5.078e-22
Identity = 25/65 (38.46%), Postives = 33/65 (50.77%), Query Frame = 3
Query: 3675 YVSNDG-AILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLN-HKLVAQSYDGAAVMSGESRGLQ 3863
            Y SN    I E  + FI+ L  +DA  L  +I   L+ + L      +Q YD AA+MSG   GLQ
Sbjct:  393 YFSNKTVTIKESFLGFIE-LHAKDAATLEHVIADTLEADNLRLDDCRSQCYDNAALMSGHISGLQ 456          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000067273.1 (SMESG000067273.1)

HSP 1 Score: 57.3806 bits (137), Expect = 9.817e-9
Identity = 32/98 (32.65%), Postives = 57/98 (58.16%), Query Frame = 3
Query: 4656 FKSLKLNLKLYFCDSDI*NKKYADEILIFMKNRDLDNCFNEYSKLCKLVLTIPPTTATAERVFSSIKRIKNYARNKIGSERLSSLAVISIEKELLKTL 4949
             +S +L ++L      I +    + IL ++ + +++  F       +++LT+P + A  ER FS +K IKNY R+ +G E+L+ LA+ISIE E  K++
Sbjct:   50 LESNELQIELILLSRKIEDDTKPENILKWIYSNNVEELFPNALIALRVLLTLPVSVAKGERTFSKLKMIKNYQRSTMGQEKLNGLAIISIESETAKSI 147          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000052596.1 (SMESG000052596.1)

HSP 1 Score: 56.225 bits (134), Expect = 1.912e-8
Identity = 35/117 (29.91%), Postives = 65/117 (55.56%), Query Frame = 2
Query: 3326 KNRQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENL----DNATVFSGLSSD-VQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVS 3661
            ++++IL  ++D++  L +  L+F G+ ES  S NRG ++EI NL++ +NP L  +L     NA  +   ++   QN  I  +++++   I  + K   F +I LD T++   Q  +S
Sbjct:   16 QSQEILPLIVDIINTLARLNLSFRGHKESTDSSNRGLFLEITNLIARWNPDLAAHLQRSSQNALGYPRYTTPSSQNKKIQTVASLLKADIAEKAKMAKFFAICLDNTSDLSKQGQLS 132          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000009678.1 (SMESG000009678.1)

HSP 1 Score: 57.3806 bits (137), Expect = 2.981e-8
Identity = 38/115 (33.04%), Postives = 61/115 (53.04%), Query Frame = 2
Query: 3332 RQILSWLIDVVCYLGQQELAFCGNNESAASINRGNYIEIINLLSEYNPLLKENLDN-----ATVFSGLSSDVQNDLITAISNVVTEKI*SEIKETDFVSI-ILDETTNFINQMAV 3658
            R IL  ++ V  ++ ++ LAF GN+E   S   GNY++++ LLS+++PLL  ++D          S LSS +  + I  + N   + I  EIKE  F S  IL      ++Q+ V
Sbjct:   82 RNILKIIVAVAKFMAERGLAFRGNDELINSSQNGNYLKVLQLLSQFDPLLSNHIDKYGPQGKGSASYLSSTICEEFIKLMGNKSLKIIEKEIKEQKFYSFTILFPDLRHVDQLTV 196          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000049700.1 (SMESG000049700.1)

HSP 1 Score: 45.0542 bits (105), Expect = 3.198e-8
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 3398 GNNESAAS---INRGNYIEIINLLSEYNPLLKENLDNATVFSG----LSSDVQNDLITAISNVVTEKI*SEIKETDFVSIILDETTNFINQMAVS 3661
            G+ ES A+    N GN++  + LL+EY+PLL  +LD+A    G    LS   QN+ +  +++ V  K+ ++IK   +     D T +  ++  +S
Sbjct:  180 GHAESLATNNGSNVGNFLATLKLLAEYDPLLFNHLDHARQNPGSVSYLSPQTQNEFMGLLASKVRNKLLNDIKRNKYYGSFFDSTPDQAHREHLS 274          

HSP 2 Score: 34.6538 bits (78), Expect = 3.198e-8
Identity = 28/76 (36.84%), Postives = 40/76 (52.63%), Query Frame = 3
Query: 3654 QLAIV*RYVSNDGA-----ILEGLIKFIDVL*TRDAKALSDIILTFLKNEKLN-HKLVAQSYDGAAVMSGESRGLQ 3863
             L+ V RYV  D +     I E  ++FI+ L  +DA  L  +I+  L+ + L      +Q YD AA+MSG   GLQ
Sbjct:  272 HLSRVKRYVDVDFSNKTVTIKESFLRFIE-LHAKDAATLEYVIVDTLEADNLRLDDCRSQCYDNAALMSGHISGLQ 346          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ZMYM18.336e-830.43zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM18.336e-830.43zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM18.336e-830.43zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM18.336e-830.43zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CR762475.11.295e-2529.36pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
si:ch211-240b21.25.043e-1248.61si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000043220.15.778e-632.58pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5SVZ6|ZMYM1_HUMAN4.003e-730.43Zinc finger MYM-type protein 1 OS=Homo sapiens OX=... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2NR695.964e-10036.89Zinc finger MYM-type protein 1 OS=Schizaphis grami... [more]
X1WND42.510e-9345.06Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A3P8T3K68.135e-8839.56Uncharacterized protein OS=Amphiprion percula OX=1... [more]
A0A3Q1CU629.655e-8838.94Uncharacterized protein OS=Amphiprion ocellaris OX... [more]
A0A3Q1CGB32.548e-8640.00Uncharacterized protein OS=Amphiprion ocellaris OX... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034915.14.611e-3536.12pep primary_assembly:Astyanax_mexicanus-2.0:4:2476... [more]
ENSAMXT00000042715.14.232e-2329.27pep primary_assembly:Astyanax_mexicanus-2.0:16:118... [more]
ENSAMXT00000035531.11.084e-1727.80pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035789.11.251e-1738.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042930.11.408e-1629.05pep primary_assembly:Astyanax_mexicanus-2.0:12:254... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO405966.363e-643.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406629.489e-642.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041223.11.412e-3638.43zinc finger MYM-type protein 1 [Source:NCBI gene;A... [more]
ENSORLT00000027735.11.281e-1723.32pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
ENSORLT00000028133.12.827e-1328.17zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.12.827e-1328.17zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.12.827e-1328.17zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069312.15.078e-2230.84SMESG000069312.1[more]
SMESG000067273.19.817e-932.65SMESG000067273.1[more]
SMESG000052596.11.912e-829.91SMESG000052596.1[more]
SMESG000009678.12.981e-833.04SMESG000009678.1[more]
SMESG000049700.13.198e-830.53SMESG000049700.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017770 ID=SMED30017770|Name=Zinc finger MYM-type protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=7325bp
CCTGTATAAAATATGCAACACTTATTAGAATAGCCACTGTAGATTTCGAT
TTCAAAATTTGCATTTTTTAAGTATAAGTTGCACAACTTTCAAATGATTT
AACAAAATCAAGTTAATGAATTTTACATTTTTCATTAATTTTTATTCGTA
GGTCTGTTCAAACTCTTTAAATGTATGATATTTTACAATTACACTTTCCA
TAATGGTTTAGTAACGTTTTATTTTTGTTGCAACATAAAAATTATTCTTT
TTGAATAGTCCATTGATAAAATAATAATTAACTATATTCATTGTTAATTT
TTATCACTAGTCGAATATTGACAAATAATTGGCACTTGACAACATTTATT
ATTTTAGGGATATTTTTTTAATTTTTGTCGCACATTTTACTTTATTGATT
TAAATAATGTCTTCGAAATAAAATGCTAATTCTTTTTGATGTTGCACTGT
CGATTTTATATTTTTTCCAAGACTAAAAATGTAACTTAACTGATAAATGC
ATGTATAATAAAGTTCTAGGATTACATGTTGGAAACCATTTACCCTTTCT
AAGAACTATATTCATATAATATAGCATTTTCCACACCTTTTCAGAAGTTT
TTTGCTTTTGTATTTGTAACTTTTTTTTTGTAATATGTTCTATAAAATAT
ATATTTTCTGTGATAATTTACGAATAAATTTTTATAAAATAAAATTTAAA
ATTAAAATTTATTCTAATTGTTAGAAAGCATATTAATTTTGAAGGACGTG
GAAAAATTATTAAATTGAGTCGTGGTCACATGTTTGAGAATCTTGTGCCA
AAAGTCAATGAAACCCTCAAAATAAGGTAATACCAAAACTTATTTCAATT
CCGTGTAATAAGATCGATTATTTTACTTTCCAAACTTGACGTGCTTACTT
CAAAATCAATAGTAGCCTTGTCTTCAGACAAACCAATGTGGCAATCATAT
TAATTTAACAGGCATTTATTAACACGCTTTTGTCATATGCTCAAGAAAAG
ATTTAGAATATTCATTTTCAACTAACAACGAATAATAATGTTCGCCGAAT
TGATAAACGTAGGTGATAAAGACCACTTTAATATAAAAGTTTTTATTTCC
CAAAAATATAAATTCAATCCACTTTTTTAATTGCTTTTTGAAACAAAACA
TTCAAATTTTTCTATAGGAATTTGGTTAATTTTAACATTAAATTAAATAT
TTAATAACAATAATTTTTAATAAAAACTAAACTAAAAATTCATAGTTTAT
TTAGATTTAATTTTACTCATTTCACAGAAATTATAAAAATAATTATTTGT
AGTGCTAGCAAACATAATATTATTAAAAAATATTCCGTATAACACTGTTG
TTTTAATTTCTTTACAAAAACAATATTTATTAATCAAGTCTTTTTCATTA
TTTAATCTGCACATTTATATTGATTTTATTTTATGAAATAGTAATTAAGG
AAAATGATAAAAAAATAAAGTGGTGATTGCATGATTAATAAATTTATTTT
AACTCCGTTTTTCCTTCACTCTAATATTGTTTGGAATTGGATGTGTTCGT
ATTGCGTGCATTTTCTGCGAGCATGTGAATCATATTGGGTTGAATGTCAG
TGACGAAGCGTCCATGGAAGCAACGGAAGCAATGCTTCCCTTACAGTTTC
CAACTTTTTCCCCCTAATTTCCTTTAAAATGTTATAGGTCAAATGATATT
TTCACAGAAAGAACAACACGGTGAAATTGTAAAGAAAAAAAGGAATCAAT
TTTATAATTACTTTTACTGATTTGTCAGTTAATACGTAGAACAAAATTTC
TTATTGTAGGTCGGTACATATTTAATTATAAATAATTATAATATAGCTGT
ATACTTTTGTTTCTCATATGCAAGCAAGGGAATCAATTTTAAAATTACTT
CTACTAATTTTCTTAATACGCAGAAAAAAAATTCGTATAGTAGGTGCTGC
AAATTCAATTATATATAAATTATAATATAGCGGTATATTTTTGTTTCTGA
TATGCAAACAAGTGAATTAATTTTAAAATTACTTCTGGTAATTTTGTTAA
TACGCAGAAAAAATATTGTGAGTAGGATCTGTGTATTCAATTTCAATAAT
ACATAAGTAAAAGTAATATAATTCTAATAACTGTACATTTTTGTTTCTCA
TATGCAATGCAAAATGCAAGCAAAGGAATCAATTTTGAAATTACTTCGAT
CAATTTTGTTAATACTTAGAACAAAATTTTTATAGTAGGCGATGCATAAT
TAATGATACAAATTTATGCTATAATGAAAAGCGGTGACCACAATAGCCTT
AAAGCAAAATTAATGACCCTTAATTTTTCATTAATTTTGGTACGTTACAT
ATTTTCTCATATAATTGACCACAATGGACTTTTACAAAATTTCGTGAAGT
TTTCGTTAAACTTAGGCACCTTAATTTTGTACGGTTTAAACCGTGCAAAA
TTAATGGGTAACCTTTTTCATACGATATGATTAATTCCATTATGGTTGTG
TTTAATTTGCATGGGTTTTGACAGTAATTAATCAAAATTAAATGAAATGA
ACGGAAAAAAAACAAAAAAACGTAATTTGTTAATTTTGTTTAAGGCTATT
GTGGTCACTGCTAAAGTGATACAATTTATTCTATTTAGTATATTTTGGTT
TTTTCATATGCAAGGAATCAATTTTAAAATTACTTCCAGTTTTGAGTTAA
TAGGAAAAATAAATTTCGCAAGGTAGTTTTATTTTAATTTTTGGTAGCAA
CCGTGATTCGTGACGGTTTATGTTTTAATTGTTTTTTATCGTTATTCATA
TTTTAAAAGTTAAATTGATTTTGGTAAGCATTTTGAATATTCTGCAAATA
ATATTATAAACTAAATATAATCCTCTGTTTAACAAAACTTTATTGAATAC
AAGTAATATGGAGGATGATAACTGCAATTGCATAATAGAAAAGTTATTTG
AACAATCATTTGGTTCAAGATTGTTTGGTGATAACATGGAAATAATTAAG
AATATCTTTGGGAAATTTAAGAACCAGAACAAAAAAATGTGTCCGACATT
TTTCAACAGGTAAGTATCAACAAATTGAATGGTTAACAGGGTGCAAATCA
TTTTCTGCCCTATATTGTTGGTCATGTTTGTTATTTAAACATGAGAAAAA
TGTTGGGTTTTCTGATTTAAATAATTTTGAAAAGCCGGTAAAAAGGCATG
CAGCTTCAGCTTCACATCTACAGTGTATGATTGCTTTGAAAAAATTTAGC
ACACAACAGAGAATTGAGAAATAAAATGGATACACTGAGAAAAATTTCTG
TGCAGCAGTTAAATGAAAAAGTTAAAAAAATAGACAGATCCTTAGTTGGT
TAATTGATGTCGTGTGCTATCTAGGACAACAGGAATTGGCCTTTTGTGGA
AATAATGAATCAGCAGCTTCAATTAACAGAGGAAATTACATTGAAATCAT
AAATTTACTTTCTGAATATAATCCGCTTTTAAAAGAAAATTTGGATAATG
CCACTGTTTTTTCCGGATTATCAAGTGATGTTCAGAATGATCTAATCACA
GCTATTTCTAACGTAGTAACTGAAAAAATATAGAGTGAGATTAAAGAAAC
CGATTTTGTGTCGATAATACTGGACGAAACAACAAATTTCATCAACCAAA
TGGCAGTTAGCAATTGTTTAAAGATATGTTTCAAATGACGGTGCCATTTT
AGAAGGATTAATTAAATTTATAGATGTGTTATAAACTCGAGATGCTAAAG
CTTTATCGGATATTATTTTGACCTTTTTGAAGAATGAAAAATTAAATCAC
AAATTAGTAGCTCAGAGTTACGATGGCGCTGCAGTAATGTCAGGTGAATC
AAGAGGGCTTCAAGCGTTAAAAAAATGTTATCAAATCAGCCAATTTCGTT
CACGGCCTAGCTCACAGGATAAGTTTTGTATTGCAGAAATCATGCGAAAA
GGAAAATCAATGCAAAATTTTTTACCACTTTATCTGGTCTTCCAAGATTT
TTCAACCAATCATCAAAACGTGTAGCTGCATCTGATCAATATTCTTCTCA
GCGACTACCAAAAGTTTCTTCTACGAGGTGGGAGTACAATGGAAGGCTTG
TAAAAACTGTTACTCGCTTACAGAATCTCAAATTATATTTCTCATCTATT
AAAAATCAAACATCCGATTTTGATTGGGATAAAGATAGTCTTATTTTAGC
TACTGGGTTCTCGCAGTTCTTATATGATCCAGATTTTTTAGTGCTACTAT
ACTTCTTCAACGAAATTTTTCCACAATCTGAAGTTTTATATGATATATAA
CAAAAAAAGATCTATGACATATCCTACTGTATTCGAAAAATTACAGAGTT
TAAAAATATGATAGATGAGTTAGTGATTCAGAAATTCGAAGAAAATTTTG
AAATAATTAACTTGGAGCTCAATATTCTACAACTAACATCGCAAAAAAGA
GAACTTTCTAGGAAAAATATTTCACAGCATTATAAAGTATTAATTAATAA
AATTGGGCAAAAAATGATTTCGGAAATGAAAAATCGCTTTGATTCATTGA
AACAAATTAAATTCATTGAATTAACTGATACCAATTTACCTCCAAAACAA
TTTCCTGTGGACCTTATAAAAAACTTAAAAATTAATTATATGCAATATTT
TGATATTCAAAAGCTTGAAACTGAACTTAAAGTTATATTTTTGTGATTCA
GACATTTAGAACAAAAAATATGCTGATGAAATTCTTATCTTTATGAAGAA
TCGTGACTTAGACAATTGTTTTAATGAATATTCAAAACTTTGTAAGTTGG
TGTTAACAATTCCACCAACAACAGCAACAGCAGAACGAGTTTTCTCAAGT
ATAAAAAGAATTAAAAATTACGCTCGCAACAAAATTGGATCGGAAAGATT
AAGTTCATTGGCCGTAATTTCAATAGAAAAGGAACTACTTAAGACACTTA
AATCCACAGAAAATTTTTATGATTCCGTAATCAATATACTTTCTCATAAG
GACAGAAGAATTTTTCTTAAATAACTTGGTCTGTGAATTCTTTTTTCCAA
AATGATTTAATAGGTTGCTTCCCAAAAATAAAATTTCACGCCTCGTCACT
GATATATATGTATGTGTTTGAATGGCGCCTCGGTGATAATTTTATGTAGA
ATGGATAAATTTATTTTTTCTCGCTATTATTCATTGTTTTTTGAGTTGAA
AGTTATTTTCATTTATTTTGAGAATTTTGGAGAATATGAGCGTTTCATAA
GATCTAAAGTTTTCTTTTTGCAAATTGGTGTGTTTATTTTACCTATATTC
AAAATCAGTATATTTTATTTGAATCGTTGAAAATTATTAAAAACAATTAT
TAGTAAATTTTTTAGTGAAGGTTTTATATAACAATCAGCTCGCAGAGAAA
ATTAGAATTCTAAATTGACAAAACGTTTATAATAATTTTTTTTCTACTTT
TATTAATAATTCAGCTTATACATGTAGAAATAGTATTTTCAAATATTAAT
GATTTCTAAAGTATTGAGAAATTGAGATTAAACATAGACACCTTATAAGA
AGTAAGTTCAGTCAAGGCTTTTTTTAATGTTTTAAAAGATCGTACATTAT
TAAATAAAATAGTCGATATTCAAATAAATGGCTTATCTTCGTTAACCCTC
TAATACGCGTGTACGCCCACCTCAAGGTGGACTATACGGTGGCGCTGATT
TAGCGCTCAAATAATTTGTCTTGCTATTTAATGCATCAGAGCGACTACAG
GCAAGATTTCCACTATACAACGATGGATGAAAGGTTGTGACAGCATTCAT
AGTTTTCCTTTAACAGCCAGTTGAGTTTGAATTTCATATAAATACAGAAG
AAAATTCATATTAAATTTAAAAAAAGATTAGTAAAAATAATCATTAACAT
TACTCAATCCGAAAATTGCATTTGACCAGCGTACTCGTGTTAAGGAACTT
CGCAAATGAACCATGAACATATGAAATTGAATAATAACCATAAAGTTCCA
TTTAATTGAGTCTTCATTGCTTGATCTTATTAAGGAAACCCAAAAATAGA
TTTTAAAAACAAAATTCCACGACTAACAGGGGTTAATTTCTTTAGGAATT
TTATTTTCCGTGAATTAAGTATAATAAATTTCACTATAAAACTGTATAAA
ATATTTTGTTATCTAAAAAATCTACCTAAAGCATTGCAGCACGGTAAATA
TTGAAGTTGTGATAAAACAGCATAGTATTTCGCCTTTTTTATTGTTTTTA
ATATTATGTTTGAGACCTGAGAGATGAAATGTTAAATCAAATGTTTTCCT
GGGCTAAGTAAAAATGATTTTTTTTTGCAAAGATTTTCTTAAACATTAAG
GAAAAGTAAATGAAATTCTTTTATCTCTATCTTGAATGCAATCTCTTCTT
TGGAAACCCCTGTTTAGCATGGCCTTATATTCGCCTGTTTATGGAGGATG
GGGAGATAAGTTTTATTTTTTTAACAAAATTTTAGGATATTGCTAATGGT
GGCATGCTATTGGATTTTGTTGGGTGTAAAAATGGTTTTCCCGAATCTCA
AACCTCATCACCTTCAATTATAAGTTTTGATTTCTATATAATTTACCATG
ATTTTATAGACAAGAACCATCAATTTCGATAGTTTCAGGTACTAAAATTA
ATTTTATTTTTTATCTACCATGGAAACCGAATGCTAGTGGTAACTATCAC
GTAGAAAATGATGCCACGGAAATTTAGACTAGTGAAATTTGGTGATTGGC
ATTTGATATATGCTAAAATATTAAGTGTATTAATAAAAAAGAGATTCGAG
TCCATTGAGGTCATAAAAGAGAATCTAACGAAGGAGCTGAAGGCCCTCTC
TCCGGTGGCCTATGCAAAGTGCATGGATGACTGGATCAAGCGTTGGCACA
TGTGCGTCGTTCAAATGGGTGTTATTTTAAAGGCGACAAAATAAATTAGC
AAGAAAATTGAGACAATTTTGTTTTATTTACAAATTCCCGGCACTTATTG
ATCATATTGTATTTCAAACTTTAATAAAAATCTTAATTGAGAAAAATTTA
ACTACTCTAGCAGTAATATATTTGTGTTGTGACACACTGAGAGACAGGCG
GAATTACCATTTTATATTTATAAATTACTATGTGTATAGAAAAAGTGAAA
GTTAAAGTCCATTGTGTTAAATGTAATAAAATAAATCTGCGGAAATTGTA
TTTTGAAAACAGAATTTATATGTAAAAAAAGTGTTCAAATAAAAGTAGTG
AATTATGCGCCATCTTGCACATTTTTTGTACCCTTATACTACTAACTAAA
TTATAATTTCAACACTAAATAAAGG
back to top

protein sequence of SMED30017770-orf-1

>SMED30017770-orf-1 ID=SMED30017770-orf-1|Name=SMED30017770-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MIDELVIQKFEENFEIINLELNILQLTSQKRELSRKNISQHYKVLINKIG
QKMISEMKNRFDSLKQIKFIELTDTNLPPKQFPVDLIKNLKINYMQYFDI
QKLETELKVIFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR025398DUF4371
IPR008906HATC_C_dom
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding