Ankyrin repeat containing protein

Overview
NameAnkyrin repeat containing protein
Smed IDSMED30017748
Length (bp)716
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin repeat containing protein (SMED30017748) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin repeat containing protein (SMED30017748) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin repeat containing protein (SMED30017748) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin repeat containing protein (SMED30017748) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017748

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30017748SMESG000017030.1 dd_Smed_v4_9221_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017748SMESG000017030.1 dd_Smed_v4_8700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017748SMESG000017030.1 dd_Smed_v4_8700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin repeat containing protein vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 60.077 bits (144), Expect = 6.084e-10
Identity = 41/131 (31.30%), Postives = 67/131 (51.15%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNK------IIIRILNEAR---------LLLACKNGDLKNVSKLV-NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L +H  D+ A D +  + + +A  + NK      +II +L+            L  A  NG ++ V+ L+  G+ I   DK  RR +HWA   G++++V LLI    ++T +DK   +PL  A  N
Sbjct:   88 EAVQVLIKHSADVNARDKNWQTPLHVA--AANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASN 216          
BLAST of Ankyrin repeat containing protein vs. Ensembl Human
Match: TNKS (tankyrase [Source:HGNC Symbol;Acc:HGNC:11941])

HSP 1 Score: 60.077 bits (144), Expect = 8.020e-10
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ ++    I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  764 EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 874          

HSP 2 Score: 52.373 bits (124), Expect = 3.416e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  300 VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 406          

HSP 3 Score: 50.447 bits (119), Expect = 1.442e-6
Identity = 30/95 (31.58%), Postives = 49/95 (51.58%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +IL+E+          RLL A K GDL+ V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  627 AAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 721          
BLAST of Ankyrin repeat containing protein vs. Ensembl Human
Match: TNKS (tankyrase [Source:HGNC Symbol;Acc:HGNC:11941])

HSP 1 Score: 60.077 bits (144), Expect = 8.170e-10
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ ++    I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  764 EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 874          

HSP 2 Score: 50.447 bits (119), Expect = 1.469e-6
Identity = 30/95 (31.58%), Postives = 49/95 (51.58%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +IL+E+          RLL A K GDL+ V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  627 AAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 721          
BLAST of Ankyrin repeat containing protein vs. Ensembl Human
Match: TNKS (tankyrase [Source:HGNC Symbol;Acc:HGNC:11941])

HSP 1 Score: 60.077 bits (144), Expect = 8.170e-10
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ ++    I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  764 EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 874          

HSP 2 Score: 50.447 bits (119), Expect = 1.469e-6
Identity = 30/95 (31.58%), Postives = 49/95 (51.58%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +IL+E+          RLL A K GDL+ V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  627 AAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 721          
BLAST of Ankyrin repeat containing protein vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 59.6918 bits (143), Expect = 1.020e-9
Identity = 41/131 (31.30%), Postives = 67/131 (51.15%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNK------IIIRILNEAR---------LLLACKNGDLKNVSKLV-NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L +H  D+ A D +  + + +A  + NK      +II +L+            L  A  NG ++ V+ L+  G+ I   DK  RR +HWA   G++++V LLI    ++T +DK   +PL  A  N
Sbjct:   88 EAVQVLIKHSADVNARDKNWQTPLHVA--AANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASN 216          

HSP 2 Score: 50.8322 bits (120), Expect = 9.408e-7
Identity = 37/126 (29.37%), Postives = 60/126 (47.62%), Query Frame = 2
Query:   14 KLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEA-------------RLLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            + L ++  +I+ +D DGN+ + +A + G++++I  L  +              L LA  N       KL++ G  I+  DK  R  +H A   GN+E +KLL     D   +DKC  +PL  A  N
Sbjct:  323 QTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAAN 448          
BLAST of Ankyrin repeat containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 49.2914 bits (116), Expect = 1.086e-6
Identity = 34/92 (36.96%), Postives = 49/92 (53.26%), Query Frame = 2
Query:  446 FCNTSLRNKT-FVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNH---KRIIKYFGAIQAKDHLCIFMEYL 709
            F N+ L  +  F K   IG G+FG++YK   +    V AIK I+L++  E  IE +I Q +  L+    + + KYFG+      L I MEYL
Sbjct:    3 FANSKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQ-AEDEIE-DIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYL 92          
BLAST of Ankyrin repeat containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 49.2914 bits (116), Expect = 1.169e-6
Identity = 34/92 (36.96%), Postives = 49/92 (53.26%), Query Frame = 2
Query:  446 FCNTSLRNKT-FVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNH---KRIIKYFGAIQAKDHLCIFMEYL 709
            F N+ L  +  F K   IG G+FG++YK   +    V AIK I+L++  E  IE +I Q +  L+    + + KYFG+      L I MEYL
Sbjct:    3 FANSKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQ-AEDEIE-DIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYL 92          
BLAST of Ankyrin repeat containing protein vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 48.1358 bits (113), Expect = 2.595e-6
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  491 HIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 712
            HI +G+FG +++        V A K + +++   K+IE  IN F  +L H+ ++KY+G       + IFMEY S
Sbjct: 1130 HIASGSFGSVHRAMDIDSHRVIAAKVMRIQRENHKAIESEINIF-RQLIHENLVKYYGVQVEDSDVIIFMEYCS 1202          
BLAST of Ankyrin repeat containing protein vs. Ensembl Celegans
Match: mtk-1 (MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O01837])

HSP 1 Score: 48.1358 bits (113), Expect = 2.642e-6
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  491 HIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 712
            HI +G+FG +++        V A K + +++   K+IE  IN F  +L H+ ++KY+G       + IFMEY S
Sbjct: 1130 HIASGSFGSVHRAMDIDSHRVIAAKVMRIQRENHKAIESEINIF-RQLIHENLVKYYGVQVEDSDVIIFMEYCS 1202          
BLAST of Ankyrin repeat containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 48.1358 bits (113), Expect = 2.942e-6
Identity = 31/81 (38.27%), Postives = 44/81 (54.32%), Query Frame = 2
Query:  476 FVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNH---KRIIKYFGAIQAKDHLCIFMEYL 709
            F K   IG G+FG++YK   +    V AIK I+L++  E  IE +I Q +  L+    + + KYFG+      L I MEYL
Sbjct:   34 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQ-AEDEIE-DIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYL 112          
BLAST of Ankyrin repeat containing protein vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0330383)

HSP 1 Score: 56.225 bits (134), Expect = 8.086e-9
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:   14 KLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            KLL +H  D    + DG +  ++ ++S + +   +   + LL A K G+L  V +LV   +I C D   R   P+H A    N E  + L+E   D+ A+DK  + PL
Sbjct:  603 KLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKGNLARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPL 710          
BLAST of Ankyrin repeat containing protein vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0084890)

HSP 1 Score: 56.225 bits (134), Expect = 8.444e-9
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query:   14 KLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            KLL +H  D    + DG +  ++ ++S + +   +   + LL A K G+L  V +LV   +I C D   R   P+H A    N E  + L+E   D+ A+DK  + PL
Sbjct:  603 KLLLKHGADPMKKNRDGATPADLVKESDHDVAELLRGPSALLDAAKKGNLARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPL 710          
BLAST of Ankyrin repeat containing protein vs. Ensembl Fly
Match: CG8526 (gene:FBgn0037759 transcript:FBtr0082142)

HSP 1 Score: 52.7582 bits (125), Expect = 9.380e-8
Identity = 31/101 (30.69%), Postives = 55/101 (54.46%), Query Frame = 2
Query:   44 EALDGDGNSVVEIAEKSGNKIIIRILNEARLLLA-CKNGDLKNVSKL-VNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            EA+D D + ++    K+G K+  + L +A LL A  + G +K +    + G+ +   D+  R  +H+AC+ GN E+V  L+    +   +D+  MSP+D A
Sbjct:  476 EAIDTDNHDIINALLKNGAKLNDQPLVQAELLRALTERGKIKRLESFRLAGANLTLADRTGRTALHYACQLGNHEVVDYLLPHYENPYIKDELGMSPIDYA 576          
BLAST of Ankyrin repeat containing protein vs. Ensembl Fly
Match: CG8526 (gene:FBgn0037759 transcript:FBtr0334682)

HSP 1 Score: 52.7582 bits (125), Expect = 9.728e-8
Identity = 31/101 (30.69%), Postives = 55/101 (54.46%), Query Frame = 2
Query:   44 EALDGDGNSVVEIAEKSGNKIIIRILNEARLLLA-CKNGDLKNVSKL-VNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            EA+D D + ++    K+G K+  + L +A LL A  + G +K +    + G+ +   D+  R  +H+AC+ GN E+V  L+    +   +D+  MSP+D A
Sbjct:  475 EAIDTDNHDIINALLKNGAKLNDQPLVQAELLRALTERGKIKRLESFRLAGANLTLADRTGRTALHYACQLGNHEVVDYLLPHYENPYIKDELGMSPIDYA 575          
BLAST of Ankyrin repeat containing protein vs. Ensembl Fly
Match: JIL-1 (gene:FBgn0020412 transcript:FBtr0076237)

HSP 1 Score: 52.373 bits (124), Expect = 1.489e-7
Identity = 33/99 (33.33%), Postives = 45/99 (45.45%), Query Frame = 2
Query:  434 CDHKFCNTSLRN-----KTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLSA 715
            C+ ++ NT L+N          G+   NGA+G  +    S  D VF  K I L K     ++  I+  L   NHK I+ Y G  + K    I MEYLS 
Sbjct:  604 CEIQYFNTGLQNIPCRPDDLELGTRTSNGAYGTCHFVVDSSTDLVFLAKIIPLSKFRPSEVDALISCALDTTNHKNIVSYHGTFREKCETWIVMEYLSG 702          
BLAST of Ankyrin repeat containing protein vs. Ensembl Zebrafish
Match: tnksb (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase b [Source:NCBI gene;Acc:567533])

HSP 1 Score: 59.6918 bits (143), Expect = 6.885e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN  +++ +     I   +  +A LL A K G L  V KL +   I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  696 EICKLLLKHGADPSKKNRDGNMALDMVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 806          

HSP 2 Score: 51.6026 bits (122), Expect = 3.118e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  242 VLLQHGADPNIRNTDGKSALDLADPSAKTVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQYGADVHAKDKGGLVPL 348          

HSP 3 Score: 50.447 bits (119), Expect = 9.810e-7
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +ILNE           RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  559 ASQMGNEAVQQILNENVPPRNSDVDYRLLEAAKAGDLDTVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPL 653          
BLAST of Ankyrin repeat containing protein vs. Ensembl Zebrafish
Match: tnksb (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase b [Source:NCBI gene;Acc:567533])

HSP 1 Score: 59.6918 bits (143), Expect = 6.885e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN  +++ +     I   +  +A LL A K G L  V KL +   I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  696 EICKLLLKHGADPSKKNRDGNMALDMVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 806          

HSP 2 Score: 51.6026 bits (122), Expect = 3.118e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  242 VLLQHGADPNIRNTDGKSALDLADPSAKTVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQYGADVHAKDKGGLVPL 348          

HSP 3 Score: 50.447 bits (119), Expect = 9.810e-7
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +ILNE           RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  559 ASQMGNEAVQQILNENVPPRNSDVDYRLLEAAKAGDLDTVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPL 653          
BLAST of Ankyrin repeat containing protein vs. Ensembl Zebrafish
Match: tnksb (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase b [Source:NCBI gene;Acc:567533])

HSP 1 Score: 59.6918 bits (143), Expect = 7.562e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN  +++ +     I   +  +A LL A K G L  V KL +   I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  705 EICKLLLKHGADPSKKNRDGNMALDMVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 815          

HSP 2 Score: 51.6026 bits (122), Expect = 3.421e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  242 VLLQHGADPNIRNTDGKSALDLADPSAKTVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQYGADVHAKDKGGLVPL 348          

HSP 3 Score: 50.0618 bits (118), Expect = 1.076e-6
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +ILNE           RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  568 ASQMGNEAVQQILNENVPPRNSDVDYRLLEAAKAGDLDTVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPL 662          
BLAST of Ankyrin repeat containing protein vs. Ensembl Zebrafish
Match: tnksb (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase b [Source:NCBI gene;Acc:567533])

HSP 1 Score: 59.6918 bits (143), Expect = 7.638e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN  +++ +     I   +  +A LL A K G L  V KL +   I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  712 EICKLLLKHGADPSKKNRDGNMALDMVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 822          

HSP 2 Score: 50.0618 bits (118), Expect = 1.077e-6
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +ILNE           RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  575 ASQMGNEAVQQILNENVPPRNSDVDYRLLEAAKAGDLDTVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPL 669          

HSP 3 Score: 47.7506 bits (112), Expect = 7.265e-6
Identity = 28/114 (24.56%), Postives = 55/114 (48.25%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR---------PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   + R+         P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  242 VLLQHGADPNIRNTDGKSALDLADPSAKTVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTSQKMLSTPLHLAAGYNRVRIVQLLLQYGADVHAKDKGGLVPL 355          
BLAST of Ankyrin repeat containing protein vs. Ensembl Zebrafish
Match: tnksa (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase a [Source:ZFIN;Acc:ZDB-GENE-030131-7450])

HSP 1 Score: 59.6918 bits (143), Expect = 7.714e-10
Identity = 37/111 (33.33%), Postives = 56/111 (50.45%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ ++    I   +  +A LL A K G L  V KL +   I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  717 EICKLLLKHGADPTKKNRDGNTPLDMVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSLENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 827          

HSP 2 Score: 49.6766 bits (117), Expect = 1.354e-6
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +ILNE           RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  580 AAQMGNEAVQQILNENIPVRNSDVDYRLLEAAKAGDLDTVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPL 674          

HSP 3 Score: 48.1358 bits (113), Expect = 4.693e-6
Identity = 28/114 (24.56%), Postives = 55/114 (48.25%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR---------PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   + R+         P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  246 VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTSQKMLSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 359          
BLAST of Ankyrin repeat containing protein vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 60.077 bits (144), Expect = 7.972e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ +     I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  667 EICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTQENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 777          

HSP 2 Score: 52.7582 bits (125), Expect = 2.184e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  203 VLLQHGADPSIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 309          

HSP 3 Score: 52.373 bits (124), Expect = 2.904e-7
Identity = 34/108 (31.48%), Postives = 53/108 (49.07%), Query Frame = 2
Query:   56 GDGNSVVEI----AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            G   S+V +    A + GN+ + +ILNE+          RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  517 GSDASIVSLQGFTAAQMGNEAVQQILNESTPVRTSDVDYRLLEASKAGDLDTVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 624          
BLAST of Ankyrin repeat containing protein vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 60.077 bits (144), Expect = 8.418e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ +     I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  743 EICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTQENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 853          

HSP 2 Score: 52.7582 bits (125), Expect = 2.303e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  278 VLLQHGADPSIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 384          

HSP 3 Score: 49.2914 bits (116), Expect = 3.056e-6
Identity = 33/109 (30.28%), Postives = 52/109 (47.71%), Query Frame = 2
Query:   56 GDGNSVVEI----AEKSGNKIIIRILN-----------EARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            G   S+V +    A + GN+ + +ILN           + RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  592 GSDASIVSLQGFTAAQMGNEAVQQILNVESTPVRTSDVDYRLLEASKAGDLDTVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 700          
BLAST of Ankyrin repeat containing protein vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 60.077 bits (144), Expect = 8.622e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ +     I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  706 EICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTQENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 816          

HSP 2 Score: 52.373 bits (124), Expect = 3.166e-7
Identity = 34/108 (31.48%), Postives = 53/108 (49.07%), Query Frame = 2
Query:   56 GDGNSVVEI----AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            G   S+V +    A + GN+ + +ILNE+          RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  556 GSDASIVSLQGFTAAQMGNEAVQQILNESTPVRTSDVDYRLLEASKAGDLDTVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 663          

HSP 3 Score: 49.6766 bits (117), Expect = 2.294e-6
Identity = 27/101 (26.73%), Postives = 51/101 (50.50%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDK 313
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK
Sbjct:  278 VLLQHGADPSIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDK 378          
BLAST of Ankyrin repeat containing protein vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 59.6918 bits (143), Expect = 1.018e-9
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ +     I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  696 EICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTQENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 806          

HSP 2 Score: 52.373 bits (124), Expect = 2.886e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  232 VLLQHGADPSIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 338          

HSP 3 Score: 51.9878 bits (123), Expect = 3.836e-7
Identity = 34/108 (31.48%), Postives = 53/108 (49.07%), Query Frame = 2
Query:   56 GDGNSVVEI----AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            G   S+V +    A + GN+ + +ILNE+          RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  546 GSDASIVSLQGFTAAQMGNEAVQQILNESTPVRTSDVDYRLLEASKAGDLDTVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 653          
BLAST of Ankyrin repeat containing protein vs. Ensembl Xenopus
Match: foxj3 (forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185])

HSP 1 Score: 59.6918 bits (143), Expect = 1.147e-9
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ +     I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  678 EICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTQENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 788          

HSP 2 Score: 51.9878 bits (123), Expect = 4.239e-7
Identity = 34/108 (31.48%), Postives = 53/108 (49.07%), Query Frame = 2
Query:   56 GDGNSVVEI----AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            G   S+V +    A + GN+ + +ILNE+          RLL A K GDL  V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  528 GSDASIVSLQGFTAAQMGNEAVQQILNESTPVRTSDVDYRLLEASKAGDLDTVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 635          

HSP 3 Score: 48.9062 bits (115), Expect = 3.889e-6
Identity = 28/112 (25.00%), Postives = 55/112 (49.11%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR-------PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   + R+       P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  209 VLLQHGADPSIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKVGLSYSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 320          
BLAST of Ankyrin repeat containing protein vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 58.5362 bits (140), Expect = 3.950e-10
Identity = 41/128 (32.03%), Postives = 65/128 (50.78%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKII------IRILN---------EARLLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            EAV++L +H  D+ A D +  + + IA  + NK +      + +L+            L  A  +G  + V  L++ G+ I   DK  RR IHWA   G+IE+VKLL+    ++T +DK   +PL  A
Sbjct:   60 EAVQILLKHSADVNARDKNWQTPLHIA--AANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAA 185          
BLAST of Ankyrin repeat containing protein vs. Ensembl Mouse
Match: Tnks (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [Source:MGI Symbol;Acc:MGI:1341087])

HSP 1 Score: 60.077 bits (144), Expect = 5.658e-10
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ ++    I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  757 EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 867          

HSP 2 Score: 52.373 bits (124), Expect = 2.388e-7
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  293 VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 399          

HSP 3 Score: 49.6766 bits (117), Expect = 1.810e-6
Identity = 30/95 (31.58%), Postives = 49/95 (51.58%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +IL+E+          RLL A K GDL+ V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  620 AAQMGNEAVQQILSESTPMRTSDVDYRLLEASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 714          
BLAST of Ankyrin repeat containing protein vs. Ensembl Mouse
Match: Tnks2 (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase 2 [Source:MGI Symbol;Acc:MGI:1921743])

HSP 1 Score: 58.5362 bits (140), Expect = 1.288e-9
Identity = 35/111 (31.53%), Postives = 55/111 (49.55%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ +     I   +  +A LL A K G L  V KL +   + C D   R   P+H A    N+E+ + L++   D+ A+DK  + PL
Sbjct:   51 EICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPL 161          
BLAST of Ankyrin repeat containing protein vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 57.7658 bits (138), Expect = 3.086e-9
Identity = 41/131 (31.30%), Postives = 67/131 (51.15%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNK------IIIRILNEAR---------LLLACKNGDLKNVSKLV-NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L +H  D+ A D +  + + +A  + NK      +II +L+            L  A  NG ++ V+ L+  G+ I   DK  RR +HWA   G++++V LLI    ++T +DK   +PL  A  N
Sbjct:   88 EAVQVLIKHSADVNARDKNWQTPLHVA--AANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASN 216          
BLAST of Ankyrin repeat containing protein vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 57.7658 bits (138), Expect = 3.283e-9
Identity = 41/131 (31.30%), Postives = 67/131 (51.15%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNK------IIIRILNEAR---------LLLACKNGDLKNVSKLV-NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L +H  D+ A D +  + + +A  + NK      +II +L+            L  A  NG ++ V+ L+  G+ I   DK  RR +HWA   G++++V LLI    ++T +DK   +PL  A  N
Sbjct:   88 EAVQVLIKHSADVNARDKNWQTPLHVA--AANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASN 216          

HSP 2 Score: 48.9062 bits (115), Expect = 3.100e-6
Identity = 37/126 (29.37%), Postives = 61/126 (48.41%), Query Frame = 2
Query:   14 KLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-----NEAR--------LLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            + L ++  +I+ +D DGN+ + +A + G++++I  L     + A+        L LA  N       KL++ G  I+  D   R  +H A   GN+E +KLL     D   +DKC  +PL  A  N
Sbjct:  323 QTLIQNGGEIDCVDKDGNTPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAAN 448          
BLAST of Ankyrin repeat containing protein vs. UniProt/SwissProt
Match: sp|Q7ZT11|ANKR1_CHICK (Ankyrin repeat domain-containing protein 1 OS=Gallus gallus OX=9031 GN=ANKRD1 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 3.436e-9
Identity = 30/70 (42.86%), Postives = 43/70 (61.43%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            AC  G L+ V KLV  G+ +E  D  +   +HWAC  GN+EIVK L+++  +  ARDK   +PL +AV+ 
Sbjct:  160 ACSEGHLEVVKKLVEAGALLELKDMLESTALHWACRGGNLEIVKFLLDKGINRNARDKLRSTPLHVAVRT 229          
BLAST of Ankyrin repeat containing protein vs. UniProt/SwissProt
Match: sp|O95271|TNKS1_HUMAN (Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 3.851e-9
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ ++    I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  764 EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 874          

HSP 2 Score: 52.373 bits (124), Expect = 1.641e-6
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  300 VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 406          

HSP 3 Score: 50.447 bits (119), Expect = 6.926e-6
Identity = 30/95 (31.58%), Postives = 49/95 (51.58%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +IL+E+          RLL A K GDL+ V +L +   + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  627 AAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 721          
BLAST of Ankyrin repeat containing protein vs. UniProt/SwissProt
Match: sp|Q6PFX9|TNKS1_MOUSE (Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus musculus OX=10090 GN=Tnks PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 3.957e-9
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ ++    I   +  +A LL A K G L  V KL     I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  757 EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 867          

HSP 2 Score: 52.373 bits (124), Expect = 1.670e-6
Identity = 29/107 (27.10%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  293 VLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 399          
BLAST of Ankyrin repeat containing protein vs. UniProt/SwissProt
Match: sp|Q5F478|ANR44_CHICK (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus OX=9031 GN=ANKRD44 PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 7.331e-9
Identity = 43/131 (32.82%), Postives = 67/131 (51.15%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNK------IIIRILNEAR---------LLLACKNGDLKNVSKLV-NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L +H  D+ A D +  + + +A  + NK      III +L+            L  A  NG ++ V+ L+  G+ I   DK  RR +HWA   G++E+V LLI    ++T +DK   +PL  A  N
Sbjct:   88 EAVQVLIKHSADVNARDKNWQTPLHVA--AANKALKCAEIIIPMLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLEVVALLINHGAEVTCKDKKGYTPLHAAASN 216          
BLAST of Ankyrin repeat containing protein vs. UniProt/SwissProt
Match: sp|Q5ZLC8|ANR52_CHICK (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus OX=9031 GN=ANKRD52 PE=2 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 1.915e-8
Identity = 37/117 (31.62%), Postives = 63/117 (53.85%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGN----KIIIRILNEAR---------LLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDK 313
            +A+ LL +H  D+ A D    + + +A  +      + II +L+            L  A  +G L+ V+ L+N G+++  CDK  R+PIHWA   G++E++KLL+ R  D+  +DK
Sbjct:   88 KALHLLLKHSADVNARDKYWQTPLHVAAANRATKCVEAIIPLLSTVNVADRTGRTALHHAVHSGHLEMVNLLLNKGASLSTCDKKDRQPIHWAAFLGHLEVLKLLVARGADVMCKDK 204          
BLAST of Ankyrin repeat containing protein vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 9.920e-28
Identity = 79/236 (33.47%), Postives = 124/236 (52.54%), Query Frame = 2
Query:   11 VKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNENXXXXXXXXX-XXXXXXXXXMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLSA 715
            VK   + KC++++ D +    +  A  S N  I+++L E+                   G+ I   D     PIH AC+  NIE  +LL+E  CD+   DK + SPL IA   + + +++++K  + +  + ++M LKC   C+HKFC TS + K       I +G++G ++    SG D  FA+K I  + I  + IE NIN F + L H+RI+K+FGA   K++  IFMEYL  
Sbjct:  555 VKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIES-------------------GAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKLIKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIPKQNIRARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEYLDT 771          
BLAST of Ankyrin repeat containing protein vs. TrEMBL
Match: A0A0F9WWT3 (Ankyrin repeat domain-containing protein OS=Trichoderma harzianum OX=5544 GN=THAR02_10290 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.130e-11
Identity = 45/127 (35.43%), Postives = 70/127 (55.12%), Query Frame = 2
Query:   11 VKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-------------NEARLLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            VKLL +   DIEA DG G + + +A ++G++ I+++L              +  LLLA +NG    V  L   G+ IE  +   + P+ WA E G+  IV+LL+E+  DI A+DK   +PL +A +N
Sbjct:  128 VKLLVKRGVDIEAKDGSGRTPLLLAAENGHEAIVKLLAKKGADIKAKDRDGQTPLLLAAENGHEAIVELLAEKGADIEAKNGYGQTPLSWAAEDGHGAIVELLVEKGADIEAKDKDGRTPLLLAAEN 254          

HSP 2 Score: 60.4622 bits (145), Expect = 4.354e-7
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 2
Query:   11 VKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNE-------------ARLLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            VKLL +   DI+A D DG + + +A ++G++ I+ +L E               L  A ++G    V  LV  G+ IE  DK+ R P+  A E+G+  IV+LL+E++ +I A D+    PL
Sbjct:  161 VKLLAKKGADIKAKDRDGQTPLLLAAENGHEAIVELLAEKGADIEAKNGYGQTPLSWAAEDGHGAIVELLVEKGADIEAKDKDGRTPLLLAAENGHGGIVELLVEKRAEIEAEDRDSWMPL 281          
BLAST of Ankyrin repeat containing protein vs. TrEMBL
Match: A0A395P1C1 (Ankyrin repeat-containing OS=Trichoderma arundinaceum OX=490622 GN=TARUN_111 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 8.100e-11
Identity = 45/127 (35.43%), Postives = 69/127 (54.33%), Query Frame = 2
Query:   11 VKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-------------NEARLLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            VKLL E   DIEA D +G + +    K+G++ I+++L             ++  L  A +NG    V  LV  G+ IE  D + + P+ WA E+G+  IVKLL+E+  DI A+D+   +PL  A +N
Sbjct:  452 VKLLVEKGADIEAKDNNGQTPLSWVAKNGHEAIVKLLVEKGADIEAKDEYSQTPLSWAAENGHEAIVKLLVEKGADIEAKDDDGQTPLSWAIENGHEAIVKLLVEKGADIEAKDEYSQTPLLWAAEN 578          
BLAST of Ankyrin repeat containing protein vs. TrEMBL
Match: G9NK45 (ANK_REP_REGION domain-containing protein OS=Hypocrea atroviridis (strain ATCC 20476 / IMI 206040) OX=452589 GN=TRIATDRAFT_190696 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 8.122e-11
Identity = 47/125 (37.60%), Postives = 68/125 (54.40%), Query Frame = 2
Query:   11 VKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNE------AR------LLLACKNGDLKNVSKLV--NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAV 343
            VKLL E   +I+A D DG + +  A + G++ ++++L E      AR      LL     G  KNV KL+   G+ IE  D+  R P+  A E G+  +VKLL+E+  DI ARDK   +PL +A 
Sbjct:  185 VKLLVEKGANIKARDEDGQTPLYWAAERGHEGVVKLLVEKGADIKARNKYGQTLLFRAAGGGHKNVVKLLVEKGADIEVKDEYGRTPVFRAAEMGHGGVVKLLVEKGADIEARDKYGQTPLSVAA 309          

HSP 2 Score: 62.003 bits (149), Expect = 1.322e-7
Identity = 42/123 (34.15%), Postives = 67/123 (54.47%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILN------EAR------LLLACKNGDLKNVSKLV--NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            + VKLL +   DI+A   DG  ++  A   G++ ++++L       EAR      LL     G  KNV KL+   G+ I+  D++ + P++WA E G+  +VKLL+E+  DI AR+K   + L
Sbjct:  117 DVVKLLIKKGADIKARGKDGQMLLFRAAGGGHENVVKLLVEKGADIEARDEDGQTLLFRAAGGGHKNVVKLLVEKGANIKARDEDGQTPLYWAAERGHEGVVKLLVEKGADIKARNKYGQTLL 239          
BLAST of Ankyrin repeat containing protein vs. TrEMBL
Match: A0A1B8GKW5 (Uncharacterized protein OS=Pseudogymnoascus verrucosus OX=342668 GN=VE01_05659 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.401e-10
Identity = 41/132 (31.06%), Postives = 70/132 (53.03%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNE-------------ARLLLACKNGDLKNVSKLV--NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNEN 355
            +AVK+L  H  D       G + + +A   G  I++++L +               L  AC NG+L +V+KL+   G+ +   ++ +  P+H+AC +GNI++ KLLI+R  D++  D  + +PLD A  N N
Sbjct:  134 DAVKVLLSHGADYTITGYKGRTPLHLAAMFGYPIVVQLLLDHGADVSAIEERQWTALHYACSNGEL-DVAKLLIDRGADVSAIEERQSMPLHFACSNGNIDVAKLLIDRGADVSTFDGRQWTPLDFACSNGN 264          
BLAST of Ankyrin repeat containing protein vs. Ensembl Cavefish
Match: tnksb (tankyrase-1 [Source:NCBI gene;Acc:103045612])

HSP 1 Score: 59.6918 bits (143), Expect = 5.507e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN  +++ +     I   +  +A LL A K G L  V KL +   I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  673 EICKLLLKHGADPSKKNRDGNMALDMVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 783          

HSP 2 Score: 51.2174 bits (121), Expect = 3.843e-7
Identity = 29/107 (27.10%), Postives = 53/107 (49.53%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+   +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  198 VLLQHGADPNIRNTDGKSALDLADPSAKTVLTGEYKKDELLEAARSGNEDKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQYGADVHAKDKGGLVPL 304          
BLAST of Ankyrin repeat containing protein vs. Ensembl Cavefish
Match: tnksb (tankyrase-1 [Source:NCBI gene;Acc:103045612])

HSP 1 Score: 59.6918 bits (143), Expect = 5.512e-10
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN  +++ +     I   +  +A LL A K G L  V KL +   I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  680 EICKLLLKHGADPSKKNRDGNMALDMVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 790          

HSP 2 Score: 47.3654 bits (111), Expect = 8.296e-6
Identity = 28/114 (24.56%), Postives = 54/114 (47.37%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR---------PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++A+ S   ++     +  LL A ++G+   +  L+    + C   + R+         P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  198 VLLQHGADPNIRNTDGKSALDLADPSAKTVLTGEYKKDELLEAARSGNEDKLMALLTPLNVNCHASDGRKSTSQKMLSTPLHLAAGYNRVRIVQLLLQYGADVHAKDKGGLVPL 311          
BLAST of Ankyrin repeat containing protein vs. Ensembl Cavefish
Match: ANKRD52 (ankyrin repeat domain 52 [Source:HGNC Symbol;Acc:HGNC:26614])

HSP 1 Score: 56.225 bits (134), Expect = 8.753e-9
Identity = 28/70 (40.00%), Postives = 42/70 (60.00%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            A  +G  + V+ L+N G+ +   DK  R+ IHWA   G++EIVK+L+ R  D+  RDK   +PL +A  N
Sbjct:  135 AAYSGHTEMVTLLLNKGANLSASDKKDRQAIHWAAYLGHLEIVKVLVSRNADVACRDKRGYTPLHVAAIN 204          
BLAST of Ankyrin repeat containing protein vs. Ensembl Cavefish
Match: ankrd44 (ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE-070912-605])

HSP 1 Score: 55.4546 bits (132), Expect = 1.640e-8
Identity = 39/131 (29.77%), Postives = 67/131 (51.15%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNK------IIIRILNEAR---------LLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L  H  D+ A D +  + + +A  + NK      +II +L+            L  A  NG  + VS L++ G+ I   DK   R +HWA   G++++V LL+++  +++ +DK   +PL  A  N
Sbjct:   84 EAVRVLIRHSADVNARDKNWQTPLHVA--AANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYTPLHAAASN 212          
BLAST of Ankyrin repeat containing protein vs. Ensembl Cavefish
Match: ankrd44 (ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE-070912-605])

HSP 1 Score: 54.6842 bits (130), Expect = 2.533e-8
Identity = 39/131 (29.77%), Postives = 67/131 (51.15%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNK------IIIRILNEAR---------LLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L  H  D+ A D +  + + +A  + NK      +II +L+            L  A  NG  + VS L++ G+ I   DK   R +HWA   G++++V LL+++  +++ +DK   +PL  A  N
Sbjct:   88 EAVRVLIRHSADVNARDKNWQTPLHVA--AANKALRCAEVIIPLLSSVNVSDRGGRTALHHAALNGHTEMVSLLLSKGANINAFDKKDGRALHWAAYMGHLDVVCLLVDQGAEVSCKDKRGYTPLHAAASN 216          
BLAST of Ankyrin repeat containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 6.158e-12
Identity = 37/111 (33.33%), Postives = 57/111 (51.35%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ ++    I   +  +A LL A K G L  V KL +G  + C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  730 EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSGENVNCRDSQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 840          

HSP 2 Score: 53.1434 bits (126), Expect = 1.872e-8
Identity = 35/119 (29.41%), Postives = 57/119 (47.90%), Query Frame = 2
Query:   14 KLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEA-----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +LL  H CD       G +  ++    GN+ + +IL+E+           +LL A K GDL  V +L    T+ C D   R   P+H+A     + +V+ L++   D+ A+DK  + PL
Sbjct:  573 RLLLSHGCDPNLPSLQGFTAAQL----GNESVQQILHESSLPVRNSDVEHQLLEAAKAGDLDTVKQLCTTQTVNCRDMEGRHSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPL 687          

HSP 3 Score: 51.2174 bits (121), Expect = 8.522e-8
Identity = 28/107 (26.17%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG + +++AE +   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  265 VLLQHGADPGIRNTDGKTALDLAEPTAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 371          
BLAST of Ankyrin repeat containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.474e-8
Identity = 40/125 (32.00%), Postives = 61/125 (48.80%), Query Frame = 2
Query:    8 AVKLLTEHKCDIEALDGDGNSVVEIAEKSGN----KIIIRILNEAR---------LLLACKNGDLKNVSKLV-NGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            AV+ L +H  D+ A D +  + + +A  +      + II +L+ +          L  A  NG  + V+ LV  G+ I   DK  RR IHWA   G+ E+VK+L+    D+  +DK   SPL  A
Sbjct:   87 AVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAA 211          
BLAST of Ankyrin repeat containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 1.058e-7
Identity = 25/67 (37.31%), Postives = 41/67 (61.19%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            A  NG+L+ V+ L++ G+ +   DK +RR +HWA   G+ E+VK+L+    D+  +DK   +PL  A
Sbjct:   54 AAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAA 120          
BLAST of Ankyrin repeat containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 50.447 bits (119), Expect = 1.372e-7
Identity = 30/95 (31.58%), Postives = 45/95 (47.37%), Query Frame = 2
Query:  458 SLRNKT-FVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNIN------QFLHKLNHKRIIKYFGAIQAKDH--LCIFMEYLSA 715
            S R  T + +G  +G GAFG +Y C  +      A+K ++    G       +N      Q L  L H+RI++YFG ++      L IFMEY+  
Sbjct:  352 SPRAPTNWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDP-GSVETSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPG 445          
BLAST of Ankyrin repeat containing protein vs. Ensembl Sea Lamprey
Match: ankdd1a (ankyrin repeat and death domain containing 1A [Source:ZFIN;Acc:ZDB-GENE-070615-8])

HSP 1 Score: 50.0618 bits (118), Expect = 1.542e-7
Identity = 41/136 (30.15%), Postives = 65/136 (47.79%), Query Frame = 2
Query:   11 VKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNE------------------ARLLLACKNGDLKNVSKLVNGSTIECCDKN-----KRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            ++LL ++KC  +  DG+ N+ + +A KSG+ + +  L E                    L LA + G L+ V  L++   I  CD N         +H A + G+ +I KLLI+   DI A    + SPL +AV+N
Sbjct:  152 LELLMDYKCAQDVSDGEKNTAIHLAAKSGHMLSLEHLLEKGPGRTLDFVNSQNANGNTALHLAAEGGHLECVRMLLDCEAI--CDINALNNESMNALHMAAKHGHEQIAKLLIDETIDINAISTKQASPLHLAVQN 285          
BLAST of Ankyrin repeat containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 52.373 bits (124), Expect = 2.968e-8
Identity = 31/85 (36.47%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  482 KGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGE------KSIEGNINQFLHKLNHKRIIKYFGAIQAKD-HLCIFMEYLSA 715
            KG  +G GAFG +Y C         A+K IE  ++        K++EG I +F+    ++RI++Y+G I+  D H+ IFMEYL  
Sbjct:    6 KGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEI-EFMKAFRNERIVQYYG-IETDDLHIYIFMEYLPG 88          
BLAST of Ankyrin repeat containing protein vs. Ensembl Nematostella
Match: EDO28023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7M5])

HSP 1 Score: 44.669 bits (104), Expect = 2.169e-6
Identity = 25/77 (32.47%), Postives = 39/77 (50.65%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVNGSTI------ECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNEN 355
            A   G ++ V  L+  + I      E  D     P+  A   G   +V++LI+ K D+TAR+   M+ LDIA++N N
Sbjct:   16 AAGAGHVRTVETLMRATNIGFSYSLEAEDWRGNTPLMTAAGRGRDRVVQVLIQHKADVTARNAKGMTALDIAIENAN 92          
BLAST of Ankyrin repeat containing protein vs. Ensembl Nematostella
Match: EDO48620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ51])

HSP 1 Score: 45.4394 bits (106), Expect = 9.965e-6
Identity = 26/88 (29.55%), Postives = 45/88 (51.14%), Query Frame = 2
Query:  101 KIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNK------RRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVK 346
            + I R L    +  A  +G ++ + KL++    +  D N       R P+H AC +GN+EI + L++    +  RD+   SPL+ A+K
Sbjct:  401 RYIRRALLPVLMCCASSSGSVQTLQKLLD----QGADPNGNINYDGRTPLHIACLNGNLEIARFLLQHGASVHVRDRFNRSPLEDAIK 484          
BLAST of Ankyrin repeat containing protein vs. Ensembl Medaka
Match: ENSORLT00000038944.1 (tankyrase-1 [Source:NCBI gene;Acc:101158122])

HSP 1 Score: 59.6918 bits (143), Expect = 6.439e-10
Identity = 37/111 (33.33%), Postives = 55/111 (49.55%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            E  KLL +H  D    + DGN+ +++ +     I   +  +A LL A K G L  V KL +   I C D   R   P+H A    N+E+ + L+E   D+ A+DK  + PL
Sbjct:  711 EICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVQKLCSPDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPL 821          

HSP 2 Score: 53.5286 bits (127), Expect = 6.877e-8
Identity = 30/107 (28.04%), Postives = 54/107 (50.47%), Query Frame = 2
Query:   17 LLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIEC--CDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            +L +H  D    + DG S +++AE S   ++     +  LL A ++G+ + +  L+    + C   D  K  P+H A     + IV+LL++   D+ A+DK  + PL
Sbjct:  247 VLLQHGADPNIRNTDGKSALDLAEPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL 353          

HSP 3 Score: 49.6766 bits (117), Expect = 1.273e-6
Identity = 30/95 (31.58%), Postives = 46/95 (48.42%), Query Frame = 2
Query:   83 AEKSGNKIIIRILNEA----------RLLLACKNGDLKNVSKLVNGSTIECCDKNKRR--PIHWACESGNIEIVKLLIERKCDITARDKCEMSPL 331
            A + GN+ + +ILNE+          RLL A K GDL  +  L     + C D   R   P+H+A     + +V+ L+    D+ A+DK  + PL
Sbjct:  574 AAQMGNEAVQQILNESVPVRNSDVDYRLLEAAKAGDLDTIKSLCTPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPL 668          
BLAST of Ankyrin repeat containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 58.9214 bits (141), Expect = 1.030e-9
Identity = 43/131 (32.82%), Postives = 66/131 (50.38%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKII------------IRILNEA---RLLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L +H  D+ A D +  + + IA  + NK +            + + + A    L  A  +G L+ V  L++ GS I   DK  RR IHWA   G+IE+VKLL     ++T +DK   +PL  A  +
Sbjct:   88 EAVQVLLKHSADVNARDKNWQTPLHIA--AANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASS 216          
BLAST of Ankyrin repeat containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 58.9214 bits (141), Expect = 1.032e-9
Identity = 43/131 (32.82%), Postives = 66/131 (50.38%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKII------------IRILNEA---RLLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L +H  D+ A D +  + + IA  + NK +            + + + A    L  A  +G L+ V  L++ GS I   DK  RR IHWA   G+IE+VKLL     ++T +DK   +PL  A  +
Sbjct:   88 EAVQVLLKHSADVNARDKNWQTPLHIA--AANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASS 216          
BLAST of Ankyrin repeat containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 58.9214 bits (141), Expect = 1.033e-9
Identity = 43/131 (32.82%), Postives = 66/131 (50.38%), Query Frame = 2
Query:    5 EAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKII------------IRILNEA---RLLLACKNGDLKNVSKLVN-GSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKN 349
            EAV++L +H  D+ A D +  + + IA  + NK +            + + + A    L  A  +G L+ V  L++ GS I   DK  RR IHWA   G+IE+VKLL     ++T +DK   +PL  A  +
Sbjct:   88 EAVQVLLKHSADVNARDKNWQTPLHIA--AANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASS 216          
BLAST of Ankyrin repeat containing protein vs. Ensembl Medaka
Match: ENSORLT00000018386.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101169196])

HSP 1 Score: 58.151 bits (139), Expect = 1.782e-9
Identity = 33/107 (30.84%), Postives = 52/107 (48.60%), Query Frame = 2
Query:   20 LTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            L  H C ++  D  G + +  A  SG++ ++        LL CK            G+ +   DK +R+PIHWA   G +E+VKLL+     +T +DK   +PL +A
Sbjct:  122 LIPHVCSLDVTDKLGRTPLHYAAHSGHREMVN-------LLVCK------------GANVSAKDKKERQPIHWAAHLGYLEVVKLLVSHGASVTCKDKHGYTPLHVA 209          
BLAST of Ankyrin repeat containing protein vs. Planmine SMEST
Match: SMESG000017030.1 (SMESG000017030.1)

HSP 1 Score: 431.409 bits (1108), Expect = 6.788e-149
Identity = 233/237 (98.31%), Postives = 235/237 (99.16%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNENXXXXXXXXXXXXXXXXXXMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 712
            SEAVKLLTEHKCDIEALD DGNS VEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCD+TARDKCEMSPLDIAVKNENK+LVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS
Sbjct:  272 SEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 508          

HSP 2 Score: 79.337 bits (194), Expect = 8.114e-17
Identity = 53/132 (40.15%), Postives = 72/132 (54.55%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-------------NEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNEN 355
            SEA+KLL EH+C+IEALDG     + +A   G+   +++L             N+  + LAC  G  + V  L++    IE  D   RRPIH AC  G+ E VKLL E KCDI A D+   S ++IA K+ N
Sbjct:  173 SEAIKLLIEHECNIEALDGANWRPIHLACNHGHSEAVKLLIEHKCDIEALDWWNQRPIHLACYQGRSEAVKLLIDHKCDIEALDWRNRRPIHLACYHGHSEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGN 304          

HSP 3 Score: 75.0998 bits (183), Expect = 2.217e-15
Identity = 46/115 (40.00%), Postives = 61/115 (53.04%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAV 343
            SEA+KLL EHKCDIEALD                      N+  + LAC +G  + V  L+     IE  D++  RPIH+AC  G+ E +KLLIE +C+I A DK    P+  A+
Sbjct:   74 SEAIKLLIEHKCDIEALDW--------------------WNQRPIHLACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAI 168          

HSP 4 Score: 68.9366 bits (167), Expect = 3.349e-13
Identity = 48/127 (37.80%), Postives = 63/127 (49.61%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-------------NEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            SEA+KLL EH+C+IEALD      +  A    +   I++L             N   + LAC +G  + V  L+     IE  D   +RPIH AC  G  E VKLLI+ KCDI A D     P+ +A
Sbjct:  140 SEAIKLLIEHECNIEALDKWNQRPIHYAINKRHSEAIKLLIEHECNIEALDGANWRPIHLACNHGHSEAVKLLIEHKCDIEALDWWNQRPIHLACYQGRSEAVKLLIDHKCDIEALDWRNRRPIHLA 266          

HSP 5 Score: 46.9802 bits (110), Expect = 7.457e-6
Identity = 27/66 (40.91%), Postives = 36/66 (54.55%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            AC +G+ + V  L+         K  +RPIH AC  G+ E +KLLIE KCDI A D     P+ +A
Sbjct:   43 ACYHGNSEAVKLLIE-------HKWNQRPIHLACYHGHSEAIKLLIEHKCDIEALDWWNQRPIHLA 101          
BLAST of Ankyrin repeat containing protein vs. Planmine SMEST
Match: SMESG000017030.1 (SMESG000017030.1)

HSP 1 Score: 431.024 bits (1107), Expect = 9.239e-149
Identity = 233/237 (98.31%), Postives = 235/237 (99.16%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNENXXXXXXXXXXXXXXXXXXMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 712
            SEAVKLLTEHKCDIEALD DGNS VEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCD+TARDKCEMSPLDIAVKNENK+LVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS
Sbjct:  277 SEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 513          

HSP 2 Score: 79.337 bits (194), Expect = 9.196e-17
Identity = 53/132 (40.15%), Postives = 72/132 (54.55%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-------------NEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNEN 355
            SEA+KLL EH+C+IEALDG     + +A   G+   +++L             N+  + LAC  G  + V  L++    IE  D   RRPIH AC  G+ E VKLL E KCDI A D+   S ++IA K+ N
Sbjct:  178 SEAIKLLIEHECNIEALDGANWRPIHLACNHGHSEAVKLLIEHKCDIEALDWWNQRPIHLACYQGRSEAVKLLIDHKCDIEALDWRNRRPIHLACYHGHSEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGN 309          

HSP 3 Score: 78.1814 bits (191), Expect = 2.036e-16
Identity = 49/125 (39.20%), Postives = 68/125 (54.40%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALD----------GDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAV 343
            SEAVKLL EHKCDIEALD          G   ++  + E   +   +   N+  + LAC +G  + V  L+     IE  D++  RPIH+AC  G+ E +KLLIE +C+I A DK    P+  A+
Sbjct:   49 SEAVKLLIEHKCDIEALDIRPIHLACYHGHSEAIKLLIEHKCDIEALDWWNQRPIHLACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAI 173          

HSP 4 Score: 70.4774 bits (171), Expect = 9.800e-14
Identity = 45/127 (35.43%), Postives = 66/127 (51.97%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEAR-------------LLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            SEA+KLL EHKCDIEALD      + +A   G+   +++L E +             +  AC +G  + +  L+     IE  DK  +RPIH+A    + E +KLLIE +C+I A D     P+ +A
Sbjct:   79 SEAIKLLIEHKCDIEALDWWNQRPIHLACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAINKRHSEAIKLLIEHECNIEALDGANWRPIHLA 205          

HSP 5 Score: 48.9062 bits (115), Expect = 1.796e-6
Identity = 28/66 (42.42%), Postives = 36/66 (54.55%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            A ++G  +   +      +E  D N  RPIH AC  GN E VKLLIE KCDI A D   + P+ +A
Sbjct:   11 AIRSGSAELFDRYFKAEFLEREDANGWRPIHHACYHGNSEAVKLLIEHKCDIEALD---IRPIHLA 73          
BLAST of Ankyrin repeat containing protein vs. Planmine SMEST
Match: SMESG000017030.1 (SMESG000017030.1)

HSP 1 Score: 431.409 bits (1108), Expect = 1.511e-148
Identity = 233/237 (98.31%), Postives = 235/237 (99.16%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNENXXXXXXXXXXXXXXXXXXMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 712
            SEAVKLLTEHKCDIEALD DGNS VEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCD+TARDKCEMSPLDIAVKNENK+LVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS
Sbjct:  305 SEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 541          

HSP 2 Score: 82.0333 bits (201), Expect = 1.044e-17
Identity = 55/132 (41.67%), Postives = 71/132 (53.79%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEAR-------------LLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNEN 355
            SEAVKLL EHKCDIEALD      + +A   G+   +++L E +             + LAC  G  + V  L++    IE  D   RRPIH AC  G+ E VKLL E KCDI A D+   S ++IA K+ N
Sbjct:  206 SEAVKLLIEHKCDIEALDWQKQRPIHLACNHGHSEAVKLLTEHKCDIEALDIWNQRPIHLACYQGRSEAVKLLIDHKCDIEALDWRNRRPIHLACYHGHSEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGN 337          

HSP 3 Score: 75.0998 bits (183), Expect = 2.289e-15
Identity = 46/115 (40.00%), Postives = 61/115 (53.04%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAV 343
            SEA+KLL EHKCDIEALD                      N+  + LAC +G  + V  L+     IE  D++  RPIH+AC  G+ E +KLLIE +C+I A DK    P+  A+
Sbjct:   74 SEAIKLLIEHKCDIEALDW--------------------WNQRPIHLACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAI 168          

HSP 4 Score: 72.4034 bits (176), Expect = 2.199e-14
Identity = 50/127 (39.37%), Postives = 63/127 (49.61%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-------------NEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            SEAVKLL EHKCDIEALD D    +  A   G+   I++L             N+  +  A      + +  L+     IE  D    RPIH AC  G+ E VKLLIE KCDI A D  +  P+ +A
Sbjct:  107 SEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAINKRHSEAIKLLIEHECNIEALDGANWRPIHLACNHGHSEAVKLLIEHKCDIEALDWQKQRPIHLA 233          

HSP 5 Score: 46.9802 bits (110), Expect = 7.399e-6
Identity = 27/66 (40.91%), Postives = 36/66 (54.55%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            AC +G+ + V  L+         K  +RPIH AC  G+ E +KLLIE KCDI A D     P+ +A
Sbjct:   43 ACYHGNSEAVKLLIE-------HKWNQRPIHLACYHGHSEAIKLLIEHKCDIEALDWWNQRPIHLA 101          
BLAST of Ankyrin repeat containing protein vs. Planmine SMEST
Match: SMESG000017030.1 (SMESG000017030.1)

HSP 1 Score: 431.409 bits (1108), Expect = 2.095e-148
Identity = 233/237 (98.31%), Postives = 235/237 (99.16%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNENXXXXXXXXXXXXXXXXXXMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 712
            SEAVKLLTEHKCDIEALD DGNS VEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCD+TARDKCEMSPLDIAVKNENK+LVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS
Sbjct:  310 SEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDLTARDKCEMSPLDIAVKNENKELVEILKAEELELLISKMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLS 546          

HSP 2 Score: 82.0333 bits (201), Expect = 1.217e-17
Identity = 55/132 (41.67%), Postives = 71/132 (53.79%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEAR-------------LLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNEN 355
            SEAVKLL EHKCDIEALD      + +A   G+   +++L E +             + LAC  G  + V  L++    IE  D   RRPIH AC  G+ E VKLL E KCDI A D+   S ++IA K+ N
Sbjct:  211 SEAVKLLIEHKCDIEALDWQKQRPIHLACNHGHSEAVKLLTEHKCDIEALDIWNQRPIHLACYQGRSEAVKLLIDHKCDIEALDWRNRRPIHLACYHGHSEAVKLLTEHKCDIEALDEDGNSAVEIAEKSGN 342          

HSP 3 Score: 78.1814 bits (191), Expect = 2.163e-16
Identity = 49/125 (39.20%), Postives = 68/125 (54.40%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALD----------GDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAV 343
            SEAVKLL EHKCDIEALD          G   ++  + E   +   +   N+  + LAC +G  + V  L+     IE  D++  RPIH+AC  G+ E +KLLIE +C+I A DK    P+  A+
Sbjct:   49 SEAVKLLIEHKCDIEALDIRPIHLACYHGHSEAIKLLIEHKCDIEALDWWNQRPIHLACNHGHSEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAI 173          

HSP 4 Score: 72.0182 bits (175), Expect = 2.586e-14
Identity = 50/127 (39.37%), Postives = 63/127 (49.61%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-------------NEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            SEAVKLL EHKCDIEALD D    +  A   G+   I++L             N+  +  A      + +  L+     IE  D    RPIH AC  G+ E VKLLIE KCDI A D  +  P+ +A
Sbjct:  112 SEAVKLLIEHKCDIEALDEDNWRPIHYACNHGHSEAIKLLIEHECNIEALDKWNQRPIHYAINKRHSEAIKLLIEHECNIEALDGANWRPIHLACNHGHSEAVKLLIEHKCDIEALDWQKQRPIHLA 238          

HSP 5 Score: 48.521 bits (114), Expect = 1.918e-6
Identity = 28/66 (42.42%), Postives = 36/66 (54.55%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            A ++G  +   +      +E  D N  RPIH AC  GN E VKLLIE KCDI A D   + P+ +A
Sbjct:   11 AIRSGSAELFDRYFKAEFLEREDANGWRPIHHACYHGNSEAVKLLIEHKCDIEALD---IRPIHLA 73          
BLAST of Ankyrin repeat containing protein vs. Planmine SMEST
Match: SMESG000017261.1 (SMESG000017261.1)

HSP 1 Score: 324.324 bits (830), Expect = 1.311e-108
Identity = 175/238 (73.53%), Postives = 200/238 (84.03%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNENXXXXXXXXXXXXXXXXXXMGLKCKLFCDHKFCNTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSIEGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLSA 715
            SEAVKLL E+KCDIEALD  G+S +EIA KS N+ II ILN   LL ACKNGDLK VS  +NG+ IE CDK++RRPIHWACESGNI++VK LI+ KCDI+ARDK  +SPLDIA+KN+NK+LVE+LKAEELE  I  MGLKCK FC+H+ CNTSLR KTF KGS IG+GAFG +YKCKGSGID VFA+KWIELKKIG K IE NIN+FL KLNH+RIIKYFGAIQ +DHLCIFMEYLS 
Sbjct:  148 SEAVKLLIENKCDIEALDESGDSPMEIAVKSHNERIIHILNGPCLLRACKNGDLKKVSTYLNGAAIEYCDKDQRRPIHWACESGNIKVVKSLIKTKCDISARDKSNLSPLDIAIKNQNKELVELLKAEELEQQILMMGLKCKSFCNHRLCNTSLRKKTFDKGSEIGSGAFGHVYKCKGSGIDTVFAVKWIELKKIGVKCIEENINKFLPKLNHQRIIKYFGAIQTEDHLCIFMEYLSG 385          

HSP 2 Score: 80.8777 bits (198), Expect = 2.524e-17
Identity = 53/132 (40.15%), Postives = 71/132 (53.79%), Query Frame = 2
Query:    2 SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRIL-------------NEARLLLACKNGDLKNVSKLVNGS-TIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNEN 355
            +E VKLL EH CDIEALD      +  A   G+   +++L             N+  +  AC  G  + V  L+     IE  D+  +RPIH AC+ G+ E VKLLIE KCDI A D+   SP++IAVK+ N
Sbjct:   49 AEIVKLLIEHNCDIEALDKWNLRPIHYACYQGHSEAVKLLIEHKCDIEAFDWWNQRPIHYACYQGRSEAVKLLIEHKCDIEAIDEWNQRPIHHACDQGHSEAVKLLIENKCDIEALDESGDSPMEIAVKSHN 180          

HSP 3 Score: 47.3654 bits (111), Expect = 4.445e-6
Identity = 27/66 (40.91%), Postives = 35/66 (53.03%), Query Frame = 2
Query:  143 ACKNGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDITARDKCEMSPLDIA 340
            A K+G      +      +E  D +   PIH AC +G+ EIVKLLIE  CDI A DK  + P+  A
Sbjct:   11 AIKSGSAVLFRRYFKEEYLERKDADLWSPIHHACFAGHAEIVKLLIEHNCDIEALDKWNLRPIHYA 76          
The following BLAST results are available for this feature:
BLAST of Ankyrin repeat containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD446.084e-1031.30ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
TNKS8.020e-1033.33tankyrase [Source:HGNC Symbol;Acc:HGNC:11941][more]
TNKS8.170e-1033.33tankyrase [Source:HGNC Symbol;Acc:HGNC:11941][more]
TNKS8.170e-1033.33tankyrase [Source:HGNC Symbol;Acc:HGNC:11941][more]
ANKRD441.020e-931.30ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-11.086e-636.96Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-11.169e-636.96Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
mtk-12.595e-633.78MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
mtk-12.642e-633.78MTK1/MEKK4 homolog [Source:UniProtKB/TrEMBL;Acc:O... [more]
gck-12.942e-638.27Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnks8.086e-931.48gene:FBgn0027508 transcript:FBtr0330383[more]
Tnks8.444e-931.48gene:FBgn0027508 transcript:FBtr0084890[more]
CG85269.380e-830.69gene:FBgn0037759 transcript:FBtr0082142[more]
CG85269.728e-830.69gene:FBgn0037759 transcript:FBtr0334682[more]
JIL-11.489e-733.33gene:FBgn0020412 transcript:FBtr0076237[more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnksb6.885e-1033.33tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnksb6.885e-1033.33tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnksb7.562e-1033.33tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnksb7.638e-1033.33tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
tnksa7.714e-1033.33tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj37.972e-1033.33forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
foxj38.418e-1033.33forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
foxj38.622e-1033.33forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
foxj31.018e-933.33forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
foxj31.147e-933.33forkhead box J3 [Source:Xenbase;Acc:XB-GENE-481185... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd283.950e-1032.03ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Tnks5.658e-1033.33tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
Tnks21.288e-931.53tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
Ankrd443.086e-931.30ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ankrd443.283e-931.30ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZT11|ANKR1_CHICK3.436e-942.86Ankyrin repeat domain-containing protein 1 OS=Gall... [more]
sp|O95271|TNKS1_HUMAN3.851e-933.33Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo s... [more]
sp|Q6PFX9|TNKS1_MOUSE3.957e-933.33Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus mu... [more]
sp|Q5F478|ANR44_CHICK7.331e-932.82Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q5ZLC8|ANR52_CHICK1.915e-831.62Serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG29.920e-2833.47Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0F9WWT32.130e-1135.43Ankyrin repeat domain-containing protein OS=Tricho... [more]
A0A395P1C18.100e-1135.43Ankyrin repeat-containing OS=Trichoderma arundinac... [more]
G9NK458.122e-1137.60ANK_REP_REGION domain-containing protein OS=Hypocr... [more]
A0A1B8GKW51.401e-1031.06Uncharacterized protein OS=Pseudogymnoascus verruc... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnksb5.507e-1033.33tankyrase-1 [Source:NCBI gene;Acc:103045612][more]
tnksb5.512e-1033.33tankyrase-1 [Source:NCBI gene;Acc:103045612][more]
ANKRD528.753e-940.00ankyrin repeat domain 52 [Source:HGNC Symbol;Acc:H... [more]
ankrd441.640e-829.77ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd442.533e-829.77ankyrin repeat domain 44 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009608.16.158e-1233.33pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
ENSPMAT00000003991.11.474e-832.00pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007954.11.058e-737.31pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
map3k21.372e-731.58mitogen-activated protein kinase kinase kinase 2 [... [more]
ankdd1a1.542e-730.15ankyrin repeat and death domain containing 1A [Sou... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO414102.968e-836.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280232.169e-632.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486209.965e-629.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038944.16.439e-1033.33tankyrase-1 [Source:NCBI gene;Acc:101158122][more]
ankrd28b1.030e-932.82ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd28b1.032e-932.82ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd28b1.033e-932.82ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000018386.21.782e-930.84serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of Ankyrin repeat containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017030.16.788e-14998.31SMESG000017030.1[more]
SMESG000017030.19.239e-14998.31SMESG000017030.1[more]
SMESG000017030.11.511e-14898.31SMESG000017030.1[more]
SMESG000017030.12.095e-14898.31SMESG000017030.1[more]
SMESG000017261.11.311e-10873.53SMESG000017261.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017748 ID=SMED30017748|Name=Ankyrin repeat containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=716bp
CTCAGAGGCAGTCAAACTGCTGACTGAGCATAAATGTGATATCGAGGCAC
TTGATGGGGATGGTAATTCAGTTGTGGAAATTGCTGAGAAATCTGGCAAT
AAAATAATTATTCGTATTCTAAATGAGGCTAGGTTGCTGCTTGCTTGTAA
AAATGGCGACTTGAAGAATGTTTCCAAGTTGGTAAACGGCTCCACCATTG
AATGTTGTGATAAGAACAAAAGGCGGCCAATTCATTGGGCATGTGAGAGC
GGCAATATTGAAATTGTCAAATTGCTGATTGAAAGGAAATGTGATATTAC
TGCAAGAGATAAATGTGAGATGTCCCCTTTGGACATCGCTGTAAAAAATG
AAAATAAGAAGCTAGTGGAGATCCTCAAGGCAGAAGAATTGGAACTTCTA
ATCTCGAAGATGGGCCTGAAATGCAAATTGTTCTGTGACCACAAGTTCTG
CAACACATCTCTCAGGAATAAAACATTTGTGAAAGGTTCACATATTGGAA
ATGGAGCATTTGGGGATATTTATAAATGCAAGGGTTCTGGAATCGACGCA
GTCTTTGCTATCAAATGGATAGAATTAAAAAAGATTGGTGAGAAAAGCAT
AGAAGGAAATATTAATCAATTCCTACACAAACTAAATCATAAAAGAATCA
TTAAATATTTTGGAGCAATTCAAGCAAAAGATCATTTATGCATTTTCATG
GAATACCTTTCTGCAG
back to top

protein sequence of SMED30017748-orf-1

>SMED30017748-orf-1 ID=SMED30017748-orf-1|Name=SMED30017748-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=238bp
SEAVKLLTEHKCDIEALDGDGNSVVEIAEKSGNKIIIRILNEARLLLACK
NGDLKNVSKLVNGSTIECCDKNKRRPIHWACESGNIEIVKLLIERKCDIT
ARDKCEMSPLDIAVKNENKKLVEILKAEELELLISKMGLKCKLFCDHKFC
NTSLRNKTFVKGSHIGNGAFGDIYKCKGSGIDAVFAIKWIELKKIGEKSI
EGNINQFLHKLNHKRIIKYFGAIQAKDHLCIFMEYLSA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016055Wnt signaling pathway
GO:0032212positive regulation of telomere maintenance via telomerase
GO:0051225spindle assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 72..101
e-value: 6.0E-5
score: 32.4
coord: 105..134
e-value: 270.0
score: 9.2
coord: 20..49
e-value: 2300.0
score: 2.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 72..104
score: 11.861
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 160..236
e-value: 3.9E-12
score: 46.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 159..237
score: 12.019
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 45..126
e-value: 7.5E-13
score: 48.9
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1..125
score: 18.298
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 145..235
e-value: 6.4E-15
score: 57.3
NoneNo IPR availableGENE3DG3DSA:1.25.40.960coord: 1..43
e-value: 2.0E-7
score: 32.9
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 41..237
e-value: 6.2E-20
score: 68.9
coord: 1..44
e-value: 0.045
score: 10.0
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 41..129
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 44..131
e-value: 6.5E-22
score: 80.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 2..126
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 165..188
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 151..236