E3 ubiquitin-protein ligase RNF13

Overview
NameE3 ubiquitin-protein ligase RNF13
Smed IDSMED30017733
Length (bp)1426
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase RNF13 (SMED30017733) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RNF13 (SMED30017733) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase RNF13 (SMED30017733) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RNF13 (SMED30017733) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017733

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30017733 dd_Smed_v4_4529_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30017733 Contig32340newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017733 Contig32340uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Human
Match: SYVN1 (synoviolin 1 [Source:HGNC Symbol;Acc:HGNC:20738])

HSP 1 Score: 51.2174 bits (121), Expect = 2.926e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  204 FKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 288          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Human
Match: SYVN1 (synoviolin 1 [Source:HGNC Symbol;Acc:HGNC:20738])

HSP 1 Score: 51.2174 bits (121), Expect = 3.074e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  255 FKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 339          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Human
Match: SYVN1 (synoviolin 1 [Source:HGNC Symbol;Acc:HGNC:20738])

HSP 1 Score: 51.2174 bits (121), Expect = 3.074e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  255 FKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 339          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Human
Match: SYVN1 (synoviolin 1 [Source:HGNC Symbol;Acc:HGNC:20738])

HSP 1 Score: 51.2174 bits (121), Expect = 3.185e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  255 FKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 339          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Human
Match: RNF126 (ring finger protein 126 [Source:HGNC Symbol;Acc:HGNC:21151])

HSP 1 Score: 49.2914 bits (116), Expect = 7.287e-6
Identity = 16/45 (35.56%), Postives = 27/45 (60.00%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHL 351
            CP+C D + +GE++ +  C H FH  C+  W +   +CP+C+  L
Sbjct:  202 CPVCKDDYALGERVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSL 246          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Celegans
Match: C01G6.4 (pep chromosome:WBcel235:II:9271265:9273042:-1 gene:WBGene00007226.1 transcript:C01G6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C01G6.4)

HSP 1 Score: 48.9062 bits (115), Expect = 1.119e-6
Identity = 21/44 (47.73%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  208 NNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPIC 339
            +N C IC   FE GE+I    C H+FH+EC+ EW     TCP C
Sbjct:   92 SNECAICMIDFEPGERIRFLPCMHSFHQECVDEWLMKSFTCPSC 135          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Celegans
Match: Y54E10BR.3 (pep chromosome:WBcel235:I:3021651:3028396:1 gene:WBGene00021842.1 transcript:Y54E10BR.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E10BR.3)

HSP 1 Score: 49.6766 bits (117), Expect = 2.042e-6
Identity = 24/74 (32.43%), Postives = 35/74 (47.30%), Query Frame = 1
Query:  133 VKVYFFQKDIQSVHVSRIAILNRHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            VK Y   K +   H+   A         C  C DTF++ E +    C H FH+ C+  W K K +CP+C+  +N
Sbjct:  218 VKEYLPMKKVTQEHIDNGAQ--------CTTCFDTFKLDEDVGALDCNHIFHRPCIEPWLKTKNSCPVCRQKVN 283          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Fly
Match: CG4325 (gene:FBgn0026878 transcript:FBtr0070342)

HSP 1 Score: 51.2174 bits (121), Expect = 1.747e-7
Identity = 23/58 (39.66%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  208 NNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLPIVID 381
            N IC IC + F   + I    C HAFH++CL  W K   TCPIC++  + A+  + +D
Sbjct:    5 NVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQ-DAAYFQLYLD 61          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Fly
Match: CG4325 (gene:FBgn0026878 transcript:FBtr0310443)

HSP 1 Score: 51.2174 bits (121), Expect = 1.747e-7
Identity = 23/58 (39.66%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  208 NNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLPIVID 381
            N IC IC + F   + I    C HAFH++CL  W K   TCPIC++  + A+  + +D
Sbjct:    5 NVICTICSERFRTSDNIQAGSCGHAFHEDCLDHWRKQSRTCPICRSQ-DAAYFQLYLD 61          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Fly
Match: CG6923 (gene:FBgn0037944 transcript:FBtr0082432)

HSP 1 Score: 49.6766 bits (117), Expect = 6.116e-6
Identity = 19/51 (37.25%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            C IC + FE+  ++ R  C H FH +C+ +W      CPIC+  + E H+P
Sbjct: 1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI-ETHMP 1236          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Fly
Match: CG6923 (gene:FBgn0037944 transcript:FBtr0307892)

HSP 1 Score: 49.6766 bits (117), Expect = 6.116e-6
Identity = 19/51 (37.25%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            C IC + FE+  ++ R  C H FH +C+ +W      CPIC+  + E H+P
Sbjct: 1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI-ETHMP 1236          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Fly
Match: CG6923 (gene:FBgn0037944 transcript:FBtr0082433)

HSP 1 Score: 49.6766 bits (117), Expect = 6.116e-6
Identity = 19/51 (37.25%), Postives = 29/51 (56.86%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            C IC + FE+  ++ R  C H FH +C+ +W      CPIC+  + E H+P
Sbjct: 1187 CAICLNLFEIENEVRRLPCMHLFHTDCVDQWLVTNKHCPICRVDI-ETHMP 1236          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Zebrafish
Match: rnf115 (ring finger protein 115 [Source:ZFIN;Acc:ZDB-GENE-061215-82])

HSP 1 Score: 51.6026 bits (122), Expect = 8.513e-7
Identity = 19/49 (38.78%), Postives = 29/49 (59.18%), Query Frame = 1
Query:  208 NNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            N  CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  LN
Sbjct:  235 NMECPVCKEDYTVGEPVRQLPCNHFFHSDCIVPWLELHDTCPVCRKSLN 283          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Zebrafish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 51.2174 bits (121), Expect = 1.150e-6
Identity = 18/46 (39.13%), Postives = 27/46 (58.70%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + F VGE + +  C H FH  C+  W +   TCP+C+  L+
Sbjct:  202 CPVCREEFSVGESVRQLPCLHYFHSSCIVPWLQLHDTCPVCRKSLD 247          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Zebrafish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 51.2174 bits (121), Expect = 1.176e-6
Identity = 18/46 (39.13%), Postives = 27/46 (58.70%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + F VGE + +  C H FH  C+  W +   TCP+C+  L+
Sbjct:  225 CPVCREEFSVGESVRQLPCLHYFHSSCIVPWLQLHDTCPVCRKSLD 270          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Zebrafish
Match: si:ch211-207l14.1 (si:ch211-207l14.1 [Source:ZFIN;Acc:ZDB-GENE-120215-234])

HSP 1 Score: 50.447 bits (119), Expect = 1.301e-6
Identity = 22/59 (37.29%), Postives = 31/59 (52.54%), Query Frame = 1
Query:  178 SRIAILNRHYNNICPICHDTFEVGEKIFRTI-CKHAFHKECLTEWFKYKITCPICQNHL 351
            SR  +     +++C ICH     G  + R + C H+FH EC+ EW   K TCP C  H+
Sbjct:  147 SRNVMSMSDADSLCLICHGDLRKGGGVIRELHCSHSFHSECIEEWLWTKQTCPTCHKHV 205          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Zebrafish
Match: ttc3 (tetratricopeptide repeat domain 3 [Source:ZFIN;Acc:ZDB-GENE-090313-3])

HSP 1 Score: 51.6026 bits (122), Expect = 2.052e-6
Identity = 22/65 (33.85%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  154 KDIQSVHVSRIAILNRHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNH 348
            K++   H +   +LN    + C ICH+     E +    C+H+FH+EC+  W K + TCP C+ H
Sbjct: 1612 KNVPEKHRNSALVLN--MEDPCIICHEDMS-AEDLCVLECRHSFHRECIKSWLKEQSTCPTCREH 1673          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Xenopus
Match: eif2ak4 (eukaryotic translation initiation factor 2 alpha kinase 4 [Source:Xenbase;Acc:XB-GENE-967321])

HSP 1 Score: 51.2174 bits (121), Expect = 3.382e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  254 FKKAVTDAIMSRRAIRNMNTLYPDATTEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 338          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Xenopus
Match: eif2ak4 (eukaryotic translation initiation factor 2 alpha kinase 4 [Source:Xenbase;Acc:XB-GENE-967321])

HSP 1 Score: 51.2174 bits (121), Expect = 3.409e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  265 FKKAVTDAIMSRRAIRNMNTLYPDATTEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 349          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Xenopus
Match: eif2ak4 (eukaryotic translation initiation factor 2 alpha kinase 4 [Source:Xenbase;Acc:XB-GENE-967321])

HSP 1 Score: 50.8322 bits (120), Expect = 3.585e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  229 FKKAVTDAIMSRRAIRNMNTLYPDATTEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 313          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Xenopus
Match: rnf126 (ring finger protein 126 [Source:NCBI gene;Acc:448402])

HSP 1 Score: 50.0618 bits (118), Expect = 4.895e-6
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  253 CPVCKEDYTVGESVRQLPCNHLFHNDCIIPWLEQHDTCPVCRKSLS 298          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Xenopus
Match: rnf126 (ring finger protein 126 [Source:NCBI gene;Acc:448402])

HSP 1 Score: 49.6766 bits (117), Expect = 5.437e-6
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  245 CPVCKEDYTVGESVRQLPCNHLFHNDCIIPWLEQHDTCPVCRKSLS 290          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Mouse
Match: Syvn1 (synovial apoptosis inhibitor 1, synoviolin [Source:MGI Symbol;Acc:MGI:1921376])

HSP 1 Score: 51.2174 bits (121), Expect = 2.281e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  204 FKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 288          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Mouse
Match: Syvn1 (synovial apoptosis inhibitor 1, synoviolin [Source:MGI Symbol;Acc:MGI:1921376])

HSP 1 Score: 51.2174 bits (121), Expect = 2.328e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  255 FKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 339          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Mouse
Match: Syvn1 (synovial apoptosis inhibitor 1, synoviolin [Source:MGI Symbol;Acc:MGI:1921376])

HSP 1 Score: 51.2174 bits (121), Expect = 2.614e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  255 FKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 339          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Mouse
Match: Syvn1 (synovial apoptosis inhibitor 1, synoviolin [Source:MGI Symbol;Acc:MGI:1921376])

HSP 1 Score: 51.2174 bits (121), Expect = 2.614e-6
Identity = 29/87 (33.33%), Postives = 40/87 (45.98%), Query Frame = 1
Query:  148 FQKDIQSVHVSRIAILN-------------RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            F+K +    +SR AI N             +  +N+C IC +    G K  R  C H FH  CL  WF+ + TCP C+  +  A LP
Sbjct:  255 FKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAK--RLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLP 339          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Mouse
Match: Ctcfl (CCCTC-binding factor (zinc finger protein)-like [Source:MGI Symbol;Acc:MGI:3652571])

HSP 1 Score: 49.2914 bits (116), Expect = 8.538e-6
Identity = 38/124 (30.65%), Postives = 63/124 (50.81%), Query Frame = -3
Query: 1038 SQTIEDLTCYLCNYKWDNKYDLYSHIVTQCHKSKKYFTCLRCKFKLNEFSLEDHDCLRSKSLHIKHISCNSIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICTQYDKSFDK 1409
            SQ+ E++ C  C   +  +Y L  H  T  HK++K F C +C     +++ +   CL++      H+  ++ +   P  CL C+ + FR K +L VHL  YH PN V +    +C + DK F +
Sbjct:  452 SQSPEEMKCRYCPAGFHERYALIQHQRT--HKNEKKFKCKQC-----DYACKQERCLKA------HMRMHTGEK--PFSCLACN-KHFRQKQLLTVHLRKYHDPNFVPN--LHLCLKCDKRFSR 557          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. UniProt/SwissProt
Match: sp|O22197|RHC1A_ARATH (Probable E3 ubiquitin-protein ligase RHC1A OS=Arabidopsis thaliana OX=3702 GN=RHC1A PE=2 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 6.477e-6
Identity = 22/65 (33.85%), Postives = 34/65 (52.31%), Query Frame = 1
Query:  184 IAILNRHY---NNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLNEAHLP 369
            I I  RH    ++ CP+C D FE+G +  +  C H +H +C+  W     +CP+C+  L  A  P
Sbjct:  176 IKIAQRHLRSSDSNCPVCKDEFELGSEAKQMPCNHIYHSDCIVPWLVQHNSCPVCRQELPSASGP 240          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. TrEMBL
Match: A0A183TA38 (C2H2-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13336 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 9.211e-35
Identity = 102/370 (27.57%), Postives = 147/370 (39.73%), Query Frame = -3
Query:  462 QTIEDLTCYLCNYKWDNKYDLYSHIVTQCHKSK---KYFTCLRCKFKLNEFSLEDHDCLRSKSLHIKHISCN-SIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICT---------------------------QYDKSFDK-----------------------HIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFSQFESNDNLKNDIF-KVPHTLDE 1406
            QT  D  CY+C  ++ +   + +H +   H+      +  C  CK  +     E H C  +K+ +++HIS N S+  G P  CL C  R F S+  L VHLL YH P   +   CG+C+                           QY K   K                       H    HV  Y L    +L +D   R P++C+ C  + N N ++HAH+IC+H T     +E+ +C IC+    S D F  HV   H      LA        M N VD   +C  CW       QL +HIL+ H+  T  + CG CN+ F    + +  + +   H   H     S        F  VP  L+E
Sbjct:   40 QTDPDSFCYMCCVEFSDGAAIQAHTLLMDHRPPYDISHQRCRGCKETVFMKWAEKHKCCLAKAAYLRHISSNVSLPGGPPYRCLFCRSRPFNSRSELTVHLLAYHRPQR-QPGVCGMCSFTFTEPLPPPPPPVPPPPANADEATLQQYTKDVKKVAELRMCEFEYAEVAPGLLDLHNHCARVHVPAYTLLLRQKLLMDFHLREPFACVICGQVFNSNVEYHAHIICRHATDIAVKEELRICSICSKGIRSEDCFNQHVKRRHEEPIAHLADLWISRELMMNAVDAGQVCTTCWEVLPNATQLQAHILVAHTS-TNPLVCGWCNLEFTAYPDPLVAFPIFLNHERNHARVLHSQALESKRTFDPVPELLNE 407          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. TrEMBL
Match: A0A183WEL8 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS10572 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.887e-32
Identity = 92/346 (26.59%), Postives = 154/346 (44.51%), Query Frame = -3
Query:  531 SQTIEDLTCYLCNYKWDNKYDLYSHIVTQCH---KSKKYFTCLRCKFKLNEFSLEDHDCLRSKSLHIKHISCNS-IKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICT-QYDKS------------------------------------------------FDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFH 1409
            +Q   + TCYLC  K+ +   + +HI+   H    + +   C  C+  +     E H C   K+++I+ +S +S + YG P  CL C  +   S++ L +HLLCYH PN   + +CG+C   YD+                                                  + HI  +HV  Y L     +  DT  R+PY+C  CS ++N N + HAHV+C H        E+ +C +C +   + D    H+  +H+   ++L     K   + N+ D  S+C+YCW  F+   QL +H+L+ H+    S+QCG C ++F   ++ +  + +L  H   H
Sbjct:   42 AQCEPNATCYLCLKKFKDPAAVQAHIILMDHFPPYTNELQQCRACRSTIMVKDTETHKCAVMKAIYIRFMSGSSNLFYGPPYRCLYCRSKPMGSRIELVIHLLCYHRPNK-STGRCGMCNFTYDEPSQPPPPNLPNLPANATEEQKRAHEKELRTLKEIQMCEPSNVDSQGLANLNAHILYDHVPAYMLWSRRNILEDTFLRYPYACPLCSYLINSNYELHAHVLCAHGNPTTIQNELKICAMCGVSAGTDDGLNKHI-AAHTDPIKRLGNIWIKRELLMNYTDPGSVCIYCWENFKHDFQLQAHLLVAHN-TKNSLQCGWCKIDFLSYSDPVLAFMMLQNHELNH 384          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. TrEMBL
Match: A0A158QE93 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7056 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.400e-30
Identity = 90/327 (27.52%), Postives = 136/327 (41.59%), Query Frame = -3
Query:  519 DFSSQTIEDLTCYLCNYKWDNKYDLYSHIVTQCHKSKKY------FTCLRCKFKLNEFSLEDHDCLRSKSLH-IKHISCNSIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICT------------------QYDKSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHS--YFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFSQF 1418
            D + QT  +  C+ C  +     D+ SHI+   H   K+       TC RC+  +       H C    S++  ++ +   I+ G P  CLLC GR F+S+  L  HLL +H PN  K  +C +C                     ++  +KH    H   Y L     ++ DT  R PY+C  C      N +FHAHVIC+H  Q++    +  C +C    +S + F  H+   H      LA  L K        D  S C  CW  FE+  +L  H+L  H   +F   + CG C + F     L+ ++ +   H   H  + 
Sbjct:   37 DENVQTCPNNFCFYCCCQLAEDCDVQSHILLLAHAPLKFGDTTLSHTCRRCQESVPLKWGPTHKCCSFNSIYNQRNFTAPVIQGGAPFRCLLCRGRAFKSRSDLVTHLLAFHRPNRPKG-QCSLCAFTFEEMPSDNYEDNGEPKPSEQKLEKHWIVEHAPTYRLISRQAVHEDTSLRVPYACFLCRRTYQNNWEFHAHVICRHGVQSDVQSRLFKCSMCQECAYSEEAFDKHIRLHHCDKLHCLANSLLKREMFMEVADPASTCSVCWENFEENFELQVHLLAAHGAPHF---LHCGCCKVEFSRGLVLLDSFLIFLNHERNHMREL 359          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. TrEMBL
Match: A0A0V0J3E6 (Gastrula zinc finger protein XlCGF7.1 OS=Schistocephalus solidus OX=70667 GN=ZG7 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 1.597e-29
Identity = 93/370 (25.14%), Postives = 149/370 (40.27%), Query Frame = -3
Query:  459 QTIEDLTCYLCNYKWDNKYDLYSHIVTQCHKSKKYFT---CLRCKFKLNEFSLEDHDCLRSKSLHIKHISCN-SIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICT--------------------------QYD-----------------------KSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFSQFESNDNLKNDIFK-VPHTLDEK 1406
            QT  D  CYLC   + +   + +H +   H++    +   C +CK  +     E H C  SKS +++++S N S+  G P  CL C  R   S+  L VHLL YH P   +   CG+CT                          QY+                          DKH    HV  Y L    +L    + R P++C+ C  + + N ++H+H++C+H T     + + +C +C+    S D F  HV   H     QLA     +  M +  D + +C  CW       QL +HIL+ H+     + CG C++ F    + +  + +L  H   H              F+ +P  L+E+
Sbjct:   31 QTEPDNFCYLCCVDFSDGVAVQAHTLLMDHEAPYNISHQHCRKCKETVFMKWSEKHKCCLSKSAYLRYVSSNVSLSGGPPYRCLFCRSRPLNSRSELTVHLLAYHRPQR-QPGVCGLCTFTFQEPPQLPPPIPPPPANADEVTLRQYEINLKKAVGEQMCKFESAELAPGLLELDKHCANTHVPAYTLLLRKELLTQFQLREPFACVICGQVFHSNVEYHSHILCRHGTDEPIKEGLRICAMCSKGIRSEDCFNQHVKRRHEESIAQLADLWTSQELMMDATDTNQVCTTCWEVLPNATQLQAHILVAHTT-DNPLVCGWCHVEFTDCPDPLIAFPILLNHERNHARVLHRQALESKKTFEPIPEPLNEE 398          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. TrEMBL
Match: A0A0R3TZ40 (C2H2-type domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS13113 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 5.493e-29
Identity = 88/326 (26.99%), Postives = 143/326 (43.87%), Query Frame = -3
Query:  516 DFSSQTIEDLTCYLCNYKWDNKYDLYSHIVTQCHKSKKYF------TCLRCKFKLNEFSLEDHDCLRSKSLH-IKHISCNSIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGICT------------------QYDKSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFSQFE 1418
            D S QT  +  C+ C Y+    +D+ SHI+   H   K+       TC RC+  +       H C    S++  ++ S + I+ G P  CLLC GR ++S+  L  HLL +H PN  +  +CG+C                     D+   +H    H   Y L     ++ D+  R PY+C+ C  I   N +FHAHVIC+H  + + +  +  C +C     S + F  H+   H   ++ LA  L  +    N  D  S C  CW  F++  +L +H+L  H      + CG C ++F  +   +  + +   H   H  + +
Sbjct:   49 DSSVQTCPNNFCFYCCYQLAEDHDVQSHILLLAHAPLKFGDTNLSHTCRRCQETVPLKWGPTHKCCGFNSIYNQRNFSASVIQGGAPFRCLLCRGRAYKSRSDLVTHLLAFHQPNRPQG-QCGLCNFTFEETPSESNEDNPELKSNDQKLIRHWIVEHAPTYRLVSRQAVHEDSGLRVPYACVICRRIYQNNWEFHAHVICRHGVKPDVESSLFKCFMCQKCANSEEAFDKHIRFQHCDKFKCLAESLLNKEMFMNVADPASTCSICWESFDENFELQAHLLTAHGT-PNFLHCGWCKVDFSRSLVPLDAFLVFLNHERNHARELQ 372          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Cavefish
Match: si:ch211-81a5.1 (si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-608])

HSP 1 Score: 52.373 bits (124), Expect = 3.863e-7
Identity = 18/46 (39.13%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  LN
Sbjct:  209 CPVCREEYSVGESVRQLPCLHCFHSDCIVPWLQLHDTCPVCRKSLN 254          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Cavefish
Match: rnf115 (ring finger protein 115 [Source:NCBI gene;Acc:107197307])

HSP 1 Score: 49.6766 bits (117), Expect = 3.648e-6
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  238 CPVCKEDYTVGEPVRQLPCNHFFHSDCIVPWLELHDTCPVCRKSLS 283          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 49.2914 bits (116), Expect = 3.850e-6
Identity = 16/46 (34.78%), Postives = 27/46 (58.70%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + +  GE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  223 CPVCKEDYSAGESVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLS 268          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Cavefish
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 49.6766 bits (117), Expect = 3.857e-6
Identity = 16/46 (34.78%), Postives = 27/46 (58.70%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + +  GE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  276 CPVCKEDYSAGESVRQLPCNHLFHNDCIVPWLEQHDTCPVCRKSLS 321          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Cavefish
Match: si:ch211-207l14.1 (E3 ubiquitin-protein ligase CIP8-like [Source:NCBI gene;Acc:111193321])

HSP 1 Score: 48.521 bits (114), Expect = 4.121e-6
Identity = 20/49 (40.82%), Postives = 28/49 (57.14%), Query Frame = 1
Query:  208 NNICPICHDTFEVGEKIFRTI-CKHAFHKECLTEWFKYKITCPICQNHL 351
            +++C ICHD    G    R + C H+FH EC+ EW   K TCP C+  +
Sbjct:  151 DSLCLICHDDLRKGGGSIRELHCSHSFHTECIEEWLWTKQTCPTCRKQV 199          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Sea Lamprey
Match: RNF115 (ring finger protein 115 [Source:HGNC Symbol;Acc:HGNC:18154])

HSP 1 Score: 49.6766 bits (117), Expect = 5.176e-7
Identity = 21/62 (33.87%), Postives = 32/62 (51.61%), Query Frame = 1
Query:  175 VSRIAILNRHYN--NICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            + RI I   H N    C +C + + VGE + +  C H FH  C+  W +   +CP+C+  LN
Sbjct:  188 LPRITIAQEHLNCSMECAVCKEDYSVGESVRQLPCLHLFHSNCIVPWLEMHDSCPVCRKGLN 249          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Sea Lamprey
Match: rnf126 (ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-070209-292])

HSP 1 Score: 47.3654 bits (111), Expect = 3.339e-6
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            C +C + F+ GEK  +  CKH +H +C+  W +   TCP+C+  L+
Sbjct:  225 CSVCKEDFDEGEKARQLPCKHIYHTDCIIPWLEMHDTCPVCRTSLS 270          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003380.1 (pep scaffold:Pmarinus_7.0:GL476517:4028:13530:1 gene:ENSPMAG00000003092.1 transcript:ENSPMAT00000003380.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.5134 bits (101), Expect = 9.391e-6
Identity = 15/41 (36.59%), Postives = 27/41 (65.85%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPIC 339
            C +C + F + +K+    C+HAFH++CL  W + + +CP+C
Sbjct:   33 CAVCLEDFTLKDKLGICPCRHAFHRKCLVRWLEIRKSCPMC 73          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Nematostella
Match: EDO29210 (pep supercontig:ASM20922v1:NEMVEscaffold_1403:17060:20569:-1 gene:NEMVEDRAFT_v1g145359 transcript:EDO29210 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 5.122e-6
Identity = 20/52 (38.46%), Postives = 29/52 (55.77%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHL---NEAH 363
            CPIC   +E GE   +  C H FH  C+  W +   +CP+C++ L   NEA+
Sbjct:   29 CPICLGDYEKGESTKQMPCDHLFHPGCILPWLEKTNSCPVCRHELPTDNEAY 80          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Nematostella
Match: EDO45479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSU5])

HSP 1 Score: 44.669 bits (104), Expect = 5.122e-6
Identity = 20/52 (38.46%), Postives = 29/52 (55.77%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHL---NEAH 363
            CPIC   +E GE   +  C H FH  C+  W +   +CP+C++ L   NEA+
Sbjct:   29 CPICLGDYEKGESTKQMPCDHLFHPGCILPWLEKTNSCPVCRHELPTDNEAY 80          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Medaka
Match: rnf115 (ring finger protein 115 [Source:NCBI gene;Acc:101158133])

HSP 1 Score: 50.447 bits (119), Expect = 1.820e-6
Identity = 18/46 (39.13%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + F VGE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  243 CPVCKEDFTVGEPVRKLPCNHFFHSDCIVPWLEMHDTCPVCRMSLS 288          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Medaka
Match: RNF126 (ring finger protein 126 [Source:NCBI gene;Acc:101169433])

HSP 1 Score: 48.521 bits (114), Expect = 9.127e-6
Identity = 17/46 (36.96%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  217 CPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            CP+C + + VGE + +  C H FH +C+  W +   TCP+C+  L+
Sbjct:  229 CPVCKEDYCVGENVRQLPCNHMFHNDCIVPWLEQHDTCPVCRKSLS 274          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Planmine SMEST
Match: SMESG000061120.1 (SMESG000061120.1)

HSP 1 Score: 120.553 bits (301), Expect = 1.400e-29
Identity = 95/361 (26.32%), Postives = 148/361 (41.00%), Query Frame = -3
Query:  459 DFSSQTIEDLTCYLCNYKWDNKYDLYSHIVTQCHKSKKYF---TCLRCKFKLNEFSLEDHDCLRSKSLHIKHI-SCNSIKYGLPLICLLCHGRKFRSKVVLFVHLLCYHSPNVVKSNKCGIC-----------------------------TQYDKSFDKHIEENHVYGYDLSFIYQLNIDTEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPYWSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNE-----FHFSQFESN---DNLKNDIFKVPHTLDEK 1418
            D + QT     C +C  ++ +   + SHI+   H  K+      C  C   +    ++ H C R K   ++ I S   IKYG P +CLLC G K  S+  L  HL   H      S  CG C                              +Y    +KH  + H     L    Q   ++  R PY C  C   L  N QF +H++C H T   Y+  +NVC  C  P  S      H N +H F    LA +  ++  + N+V L   C  CW  F+    L +HIL+ H       +CGLC  +F +   + + ++++ +H +     FH +  E N   + + ++I +V   ++ K
Sbjct:   41 DATVQTEFTYFCMICGKEFYSGAAIQSHIILFDHTLKESPYEQKCRACHEIVEVKHVDSHKCARDKMHFLELILSGTGIKYGAPNVCLLCRGAKMMSRSNLISHLFARHRYGR-GSGICGDCCFKFDEVTDAPLKTPFATEPDQPQPEYILPEYPSEMEKHYHDIHDTSNALVIKKQTQAESYIRFPYVCPYCHFELKNNAQFQSHILCVHGTSERYETYLNVCKGCGKPTESGPFLNSHANTNHCFQLTNLAKECMRQNLVQNYVPLAQTCTLCWMCFKYDFYLQAHILVTH-LTRFPFECGLCKRDFSLCGTMSEIWQIMRKHEKNHYRAFHLAALERNLTTEPIPDEIPEVADVIEPK 399          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Planmine SMEST
Match: SMESG000036261.1 (SMESG000036261.1)

HSP 1 Score: 56.6102 bits (135), Expect = 2.493e-8
Identity = 69/322 (21.43%), Postives = 132/322 (40.99%), Query Frame = -3
Query:  591 CYLCNYKWDNKYDLYSHIVTQCHKS-------------KKYFTCLRCKFKLNEFSLEDHDCLRSKSLHIKHISCNSIKYGLPLICLLCHGRK-FRSKVVLFVHLLCYHSPNVVKSNKCGICTQYDKSFDKHIEENHV---YGYDLSFIY-QLNIDTEKRHP------------YSCIACSTILNGND------QFHAHVICQH-----------------TTQNEYDKEMN-VCLICNIPYWSSDKFAMHVNNSHS---FLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEKRNQLHSHILMQHSYFTTSIQCGLCNMNF 1385
            C  C+ ++ +    ++H+ +  HK+             ++   C  C  ++   ++ +H C  ++   +K +         PLIC+LC   K F S+  L +H++  HSP +    +C +C+    + D ++ E H    +G +L+ +Y +L+  T K+              YS      IL+  D      Q   H +C H                 +  + Y+ ++  VC +C +   +  +   HV NSH+    L R+  I   K+      + +   C YC + F   ++L  H+++ H      + CG+CN N 
Sbjct:   50 CVFCHVEFQDLVQWHAHMGSFIHKAPSLTEEEAAKLHFEQLIFCKFCNQEIRVSTVNEHRCFLTEVTKLKELIEIYNNSYCPLICILCKKIKVFSSQAALQIHIVIRHSP-LKHPKRCSLCSAQFHTADLNVHEVHAVDEHGPELNLLYYKLSETTNKKSKSDSIKYTCALYYYSPTLNKDILSSCDNIGDLFQLTIHTLCFHGYVQLKTFAEHAQKEDVSVLSSYNNDLKIVCKLCGVNVTNVPQLNEHVYNSHAMELLLRREFII---KKKLFLGKIPMHLTCFYCMTIFTSVSKLQVHLMVIHGSADFGV-CGMCNKNL 366          
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Planmine SMEST
Match: SMESG000036540.1 (SMESG000036540.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.097e-7
Identity = 23/68 (33.82%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  151 QKDIQSVHVSRIAILNRHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNHLN 354
            + DI+ + V++I       N+ C IC   +EVG++++   C+H +H +CL  W     TCPIC+  L+
Sbjct:  137 EADIEKLQVTKIT----EANDTCSICLSDYEVGDEVYELPCQHKYHVQCLKTWLIKHGTCPICRKDLS 200          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYVN12.926e-633.33synoviolin 1 [Source:HGNC Symbol;Acc:HGNC:20738][more]
SYVN13.074e-633.33synoviolin 1 [Source:HGNC Symbol;Acc:HGNC:20738][more]
SYVN13.074e-633.33synoviolin 1 [Source:HGNC Symbol;Acc:HGNC:20738][more]
SYVN13.185e-633.33synoviolin 1 [Source:HGNC Symbol;Acc:HGNC:20738][more]
RNF1267.287e-635.56ring finger protein 126 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C01G6.41.119e-647.73pep chromosome:WBcel235:II:9271265:9273042:-1 gene... [more]
Y54E10BR.32.042e-632.43pep chromosome:WBcel235:I:3021651:3028396:1 gene:W... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG43251.747e-739.66gene:FBgn0026878 transcript:FBtr0070342[more]
CG43251.747e-739.66gene:FBgn0026878 transcript:FBtr0310443[more]
CG69236.116e-637.25gene:FBgn0037944 transcript:FBtr0082432[more]
CG69236.116e-637.25gene:FBgn0037944 transcript:FBtr0307892[more]
CG69236.116e-637.25gene:FBgn0037944 transcript:FBtr0082433[more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf1158.513e-738.78ring finger protein 115 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-81a5.11.150e-639.13si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
si:ch211-81a5.11.176e-639.13si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
si:ch211-207l14.11.301e-637.29si:ch211-207l14.1 [Source:ZFIN;Acc:ZDB-GENE-120215... [more]
ttc32.052e-633.85tetratricopeptide repeat domain 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif2ak43.382e-633.33eukaryotic translation initiation factor 2 alpha k... [more]
eif2ak43.409e-633.33eukaryotic translation initiation factor 2 alpha k... [more]
eif2ak43.585e-633.33eukaryotic translation initiation factor 2 alpha k... [more]
rnf1264.895e-636.96ring finger protein 126 [Source:NCBI gene;Acc:4484... [more]
rnf1265.437e-636.96ring finger protein 126 [Source:NCBI gene;Acc:4484... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syvn12.281e-633.33synovial apoptosis inhibitor 1, synoviolin [Source... [more]
Syvn12.328e-633.33synovial apoptosis inhibitor 1, synoviolin [Source... [more]
Syvn12.614e-633.33synovial apoptosis inhibitor 1, synoviolin [Source... [more]
Syvn12.614e-633.33synovial apoptosis inhibitor 1, synoviolin [Source... [more]
Ctcfl8.538e-630.65CCCTC-binding factor (zinc finger protein)-like [S... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O22197|RHC1A_ARATH6.477e-633.85Probable E3 ubiquitin-protein ligase RHC1A OS=Arab... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183TA389.211e-3527.57C2H2-type domain-containing protein OS=Schistoceph... [more]
A0A183WEL85.887e-3226.59Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A158QE932.400e-3027.52Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0V0J3E61.597e-2925.14Gastrula zinc finger protein XlCGF7.1 OS=Schistoce... [more]
A0A0R3TZ405.493e-2926.99C2H2-type domain-containing protein OS=Rodentolepi... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-81a5.13.863e-739.13si:ch211-81a5.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
rnf1153.648e-636.96ring finger protein 115 [Source:NCBI gene;Acc:1071... [more]
rnf1263.850e-634.78ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
rnf1263.857e-634.78ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-207l14.14.121e-640.82E3 ubiquitin-protein ligase CIP8-like [Source:NCBI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RNF1155.176e-733.87ring finger protein 115 [Source:HGNC Symbol;Acc:HG... [more]
rnf1263.339e-636.96ring finger protein 126 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000003380.19.391e-636.59pep scaffold:Pmarinus_7.0:GL476517:4028:13530:1 ge... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO292105.122e-638.46pep supercontig:ASM20922v1:NEMVEscaffold_1403:1706... [more]
EDO454795.122e-638.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rnf1151.820e-639.13ring finger protein 115 [Source:NCBI gene;Acc:1011... [more]
RNF1269.127e-636.96ring finger protein 126 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RNF13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061120.11.400e-2926.32SMESG000061120.1[more]
SMESG000036261.12.493e-821.43SMESG000036261.1[more]
SMESG000036540.11.097e-733.82SMESG000036540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017733 ID=SMED30017733|Name=E3 ubiquitin-protein ligase RNF13|organism=Schmidtea mediterranea sexual|type=transcript|length=1426bp
ATTATTATACTTTTTAAAACATTATAATTTATAATTTTTTTTATTTTAAT
GGAAACGGTGAGACCAGTTTTGATTATTTTGTGTATAGTATTATGGGTTA
TTGTTGTTTTACTTGGAATAGCTTTATATTGTGTTAAGGTTTATTTCTTT
CAAAAAGATATTCAATCAGTTCATGTAAGCAGAATAGCAATTTTAAATCG
GCATTATAACAATATATGTCCTATTTGCCATGATACCTTTGAAGTAGGCG
AAAAGATTTTCAGAACAATTTGCAAACACGCATTCCACAAAGAATGTCTA
ACAGAATGGTTCAAATACAAAATTACATGCCCCATTTGTCAGAATCATTT
AAATGAAGCCCATTTACCAATTGTGATAGATTAATGTTTATAATAAAATA
TTCATATATCTAACTTCTTTTTCAAATTGTGACTTGTTAGATTTTTTGTT
TGACAAAGCTTTTCATCTAATGTATGTGGAACTTTAAAAATATCATTTTT
CAAATTGTCATTTGACTCAAATTGAGAGAAATGGAACTCATTGTGTTCAT
TTAATAATTTATAGGTTTGAATTAATTCTGCATTCACCTTGAAATTCATG
TTGCAAAGTCCACATTGGATAGACGTAGTGAAATATGAATGCTGCATTAA
AATATGTGAATGCAATTGATTCCGTTTTTCAAAGTAACTCCAGCAATACA
CACATATCGAGTCTAAATCGACATGATTAGTCATACATCCTTCTTTAGCC
AATTGAATTGCTAGCTGGCGATAAAGAAATGAGTGTGAATTGTTTACATG
CATTGCAAATTTATCTGAACTCCAATAGGGTATGTTGCAAATTAGACAAA
CATTCATTTCTTTATCATACTCATTTTGGGTAGTGTGTTGACAAATCACG
TGGGCATGAAATTGATCATTGCCATTCAGTATTGTTGAGCAAGCTATGCA
AGAATACGGATGCCGTTTTTCAGTGTCTATGTTTAGTTGATAAATAAATG
ATAGATCATATCCATAAACGTGATTTTCTTCAATGTGTTTATCAAATGAT
TTATCATATTGAGTGCAAATTCCACATTTATTCGATTTGACTACATTAGG
GGAATGATAGCATAATAAATGAACAAACAATACAACTTTCGAACGAAACT
TTCTCCCATGGCAAAGTAAGCAGATTAAAGGTAATCCATATTTGATCGAA
TTGCAGCTTATATGTTTAATATGAAGAGACTTACTTCTCAAACAATCGTG
ATCCTCCAGTGAAAATTCATTTAATTTGAATTTACATCTTAAACATGTAA
AATATTTCTTACTTTTATGACATTGAGTTACAATATGACTATAAAGATCA
TATTTATTGTCCCATTTGTAATTACACAAATAGCAAGTTAAATCTTCAAT
CGTCTGGCTGGAAAAATCGCATTTAT
back to top

protein sequence of SMED30017733-orf-1

>SMED30017733-orf-1 ID=SMED30017733-orf-1|Name=SMED30017733-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
KCDFSSQTIEDLTCYLCNYKWDNKYDLYSHIVTQCHKSKKYFTCLRCKFK
LNEFSLEDHDCLRSKSLHIKHISCNSIKYGLPLICLLCHGRKFRSKVVLF
VHLLCYHSPNVVKSNKCGICTQYDKSFDKHIEENHVYGYDLSFIYQLNID
TEKRHPYSCIACSTILNGNDQFHAHVICQHTTQNEYDKEMNVCLICNIPY
WSSDKFAMHVNNSHSFLYRQLAIQLAKEGCMTNHVDLDSICVYCWSYFEK
RNQLHSHILMQHSYFTTSIQCGLCNMNFKVNAELIQTYKLLNEHNEFHFS
QFESNDNLKNDIFKVPHTLDEKLCQTKNLTSHNLKKKLDI*
back to top

protein sequence of SMED30017733-orf-2

>SMED30017733-orf-2 ID=SMED30017733-orf-2|Name=SMED30017733-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
METVRPVLIILCIVLWVIVVLLGIALYCVKVYFFQKDIQSVHVSRIAILN
RHYNNICPICHDTFEVGEKIFRTICKHAFHKECLTEWFKYKITCPICQNH
LNEAHLPIVID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005634nucleus
GO:0005637nuclear inner membrane
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0005768endosome
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031902late endosome membrane
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0008432JUN kinase binding
GO:0016740transferase activity
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0051865protein autoubiquitination
GO:0070304positive regulation of stress-activated protein kinase signaling cascade
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
IPR011016Znf_RING-CH
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD