ADP-ribosylation factor-like protein 3

Overview
NameADP-ribosylation factor-like protein 3
Smed IDSMED30017731
Length (bp)814
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADP-ribosylation factor-like protein 3 (SMED30017731) t-SNE clustered cells

Violin plots show distribution of expression levels for ADP-ribosylation factor-like protein 3 (SMED30017731) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor-like protein 3 (SMED30017731) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor-like protein 3 (SMED30017731) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Human
Match: ARL3 (ADP ribosylation factor like GTPase 3 [Source:HGNC Symbol;Acc:HGNC:694])

HSP 1 Score: 262.692 bits (670), Expect = 8.952e-89
Identity = 130/181 (71.82%), Postives = 155/181 (85.64%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYW+NYF+NTDILIYVIDSAD+KRF ET +EL ELL E KL+ VP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Human
Match: ARL2 (ADP ribosylation factor like GTPase 2 [Source:HGNC Symbol;Acc:HGNC:693])

HSP 1 Score: 205.682 bits (522), Expect = 3.203e-66
Identity = 99/180 (55.00%), Postives = 131/180 (72.78%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            MGLL +L+KMK K  +E+R+L LGLDNAGKTT+LK    E+I+ I+PT GFN+KT++ +GFKLN+WD+GGQ+ +R YWRNYF++TD LI+V+DSAD++R  +   EL  LL+E +LAG  LLI+ANKQDL  A  ++ I   L L SIR   W IQ CSA TGE +  G++W L  I  R
Sbjct:    1 MGLLTILKKMKQKE-RELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSR 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Human
Match: ARL2 (ADP ribosylation factor like GTPase 2 [Source:HGNC Symbol;Acc:HGNC:693])

HSP 1 Score: 205.682 bits (522), Expect = 3.203e-66
Identity = 99/180 (55.00%), Postives = 131/180 (72.78%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            MGLL +L+KMK K  +E+R+L LGLDNAGKTT+LK    E+I+ I+PT GFN+KT++ +GFKLN+WD+GGQ+ +R YWRNYF++TD LI+V+DSAD++R  +   EL  LL+E +LAG  LLI+ANKQDL  A  ++ I   L L SIR   W IQ CSA TGE +  G++W L  I  R
Sbjct:    1 MGLLTILKKMKQKE-RELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSR 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 171.014 bits (432), Expect = 1.167e-52
Identity = 83/166 (50.00%), Postives = 112/166 (67.47%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R NE  EEL  +L E +L    LL++ANKQDL NA  A+EI+  L L S+R R W IQ   A +G+G+ +GL+W  + ++ +K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Human
Match: ARF3 (ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:HGNC:654])

HSP 1 Score: 171.014 bits (432), Expect = 1.167e-52
Identity = 83/166 (50.00%), Postives = 112/166 (67.47%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R NE  EEL  +L E +L    LL++ANKQDL NA  A+EI+  L L S+R R W IQ   A +G+G+ +GL+W  + ++ +K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Celegans
Match: arl-3 (ADP-ribosylation factor-like protein 3 [Source:UniProtKB/Swiss-Prot;Acc:O45379])

HSP 1 Score: 225.713 bits (574), Expect = 1.314e-74
Identity = 107/179 (59.78%), Postives = 137/179 (76.54%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKG-FKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIE 632
            MGL+D+L+  K+ SG+E+RIL LGLDNAGKTT+LK L+SE++  +TPT+GFNVKTV   G  +LNVWDIGGQR IRPYW NY++N D LI+VIDS DKKRF+E + EL ELL E KL  VP+LI+ANKQDL+ AA + EI+  L+L  +RDR W IQ CSA   EG+  G+ W  S+++
Sbjct:    1 MGLIDVLKSFKSPSGREIRILLLGLDNAGKTTILKQLSSEDVQHVTPTKGFNVKTVAAMGDIRLNVWDIGGQRSIRPYWSNYYENIDTLIFVIDSNDKKRFDEMNIELGELLDEEKLRKVPVLIFANKQDLVTAASSEEITRKLNLDLLRDRTWHIQACSALKNEGINDGITWVASNLK 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Celegans
Match: evl-20 (ADP-ribosylation factor-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q19705])

HSP 1 Score: 181.415 bits (459), Expect = 3.818e-57
Identity = 86/180 (47.78%), Postives = 121/180 (67.22%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            MG L +LRK + +  +E+RIL LGLDNAGKTTL+K    E  + I PT GF++KTV  K F+LN+WD+GGQ+ +R YW+NYF++TD LI+V+DS+D++R  + SEEL +LL E +LAG  LL+ ANK DL  A   + I+  L L SI+   W+I  C A +G+ + Q + W    +  R
Sbjct:    1 MGFLKILRKQRARE-REMRILILGLDNAGKTTLMKKFLDEPTDTIEPTLGFDIKTVHFKDFQLNLWDVGGQKSLRSYWKNYFESTDALIWVVDSSDRERLLQCSEELKKLLGEERLAGASLLVLANKSDLPGAIDVNSIAQVLDLHSIKSHHWKIFSCCALSGDRLVQAMTWLCDDVGSR 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Celegans
Match: arf-3 (ADP-Ribosylation Factor related; ADP-ribosylation factor related (20.5 kD) (Arf-3) [Source:UniProtKB/TrEMBL;Acc:G5EFK4])

HSP 1 Score: 166.777 bits (421), Expect = 1.958e-51
Identity = 80/157 (50.96%), Postives = 108/157 (68.79%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEW 614
            ++VRIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS DK+R  E+ EEL+++L E +L    LL++ANKQDL NA  A+E++  L L ++R R+W IQ   A  G G+ +GL+W
Sbjct:   16 RQVRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDKERIEESREELHKMLNEDELRDATLLVFANKQDLPNAMTAAELTDKLGLHNLRSRQWYIQATCATQGHGLYEGLDW 172          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 164.851 bits (416), Expect = 1.106e-50
Identity = 80/165 (48.48%), Postives = 110/165 (66.67%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R  E  EEL  +L E +L    LL++ANKQDL  A  A+E++  L L S+R+R W IQ   A +G+G+ +GL+W  + ++ R
Sbjct:   16 REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNR 180          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Celegans
Match: arf-1.2 (ADP-ribosylation factor 1-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10943])

HSP 1 Score: 164.851 bits (416), Expect = 1.106e-50
Identity = 80/165 (48.48%), Postives = 110/165 (66.67%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R  E  EEL  +L E +L    LL++ANKQDL  A  A+E++  L L S+R+R W IQ   A +G+G+ +GL+W  + ++ R
Sbjct:   16 REMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLKNR 180          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Fly
Match: dnd (gene:FBgn0038916 transcript:FBtr0084151)

HSP 1 Score: 219.935 bits (559), Expect = 3.636e-72
Identity = 98/178 (55.06%), Postives = 136/178 (76.40%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIE 632
            MGLL LLRK++    +E RIL LGLDNAGKTT+LK LASE+I  +TPT GFN+K+V   GFKLNVWDIGGQ +IRPYW+NYF NTD+LIYVID  D+ R  E   EL E+LM+++L  VP+LI+ANKQD+ +A  A+E++  +SL+ ++ R W+I+ C+A  G G+++G++W   +++
Sbjct:    1 MGLLSLLRKLRPNPEKEARILLLGLDNAGKTTILKQLASEDITTVTPTAGFNIKSVAADGFKLNVWDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLMDNRLKQVPVLIFANKQDMPDAMSAAEVAEKMSLVQLQGRTWEIKACTAVDGTGLKEGMDWVCKNMK 178          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Fly
Match: Arl2 (gene:FBgn0004908 transcript:FBtr0081838)

HSP 1 Score: 179.104 bits (453), Expect = 4.483e-56
Identity = 87/180 (48.33%), Postives = 120/180 (66.67%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            MG L +L+KM+ K  +E+RIL LGLDNAGKTT+LK    E I+ I+PT GFN+KT++  G+ LN+WD+GGQ+ +R YWRNYF++TD L++V+DSAD+ R     +EL  LL E +LAG  LL+  NKQDL  A  ++EI   L L  I    W +   SA TGE +   ++W ++ I  R
Sbjct:    1 MGFLTVLKKMRQKE-REMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKR 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0332054)

HSP 1 Score: 167.548 bits (423), Expect = 1.350e-51
Identity = 82/157 (52.23%), Postives = 107/157 (68.15%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEW 614
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R  E  EEL  +L E +L    LLI+ANKQDL NA  A+EI+  L L S+R+R W IQ   A +G+G+ +GL+W
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDW 172          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0078573)

HSP 1 Score: 167.548 bits (423), Expect = 1.350e-51
Identity = 82/157 (52.23%), Postives = 107/157 (68.15%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEW 614
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R  E  EEL  +L E +L    LLI+ANKQDL NA  A+EI+  L L S+R+R W IQ   A +G+G+ +GL+W
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDW 172          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Fly
Match: Arf79F (gene:FBgn0010348 transcript:FBtr0299906)

HSP 1 Score: 167.548 bits (423), Expect = 1.350e-51
Identity = 82/157 (52.23%), Postives = 107/157 (68.15%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEW 614
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R  E  EEL  +L E +L    LLI+ANKQDL NA  A+EI+  L L S+R+R W IQ   A +G+G+ +GL+W
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDW 172          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Zebrafish
Match: arl3b (ADP ribosylation factor like GTPase 3b [Source:NCBI gene;Acc:797451])

HSP 1 Score: 279.641 bits (714), Expect = 1.138e-95
Identity = 129/181 (71.27%), Postives = 154/181 (85.08%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I  ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+L++ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   S+  ++
Sbjct:    1 MGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDITHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLVFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKSVNAKR 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Zebrafish
Match: arl3a (ADP ribosylation factor like GTPase 3a [Source:ZFIN;Acc:ZDB-GENE-050417-368])

HSP 1 Score: 278.1 bits (710), Expect = 4.822e-95
Identity = 130/181 (71.82%), Postives = 154/181 (85.08%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L  IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDMLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHIIRDRMWQIQSCSALTGEGVQDGMSWVCKNVTAKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Zebrafish
Match: arl3b (ADP ribosylation factor like GTPase 3b [Source:NCBI gene;Acc:797451])

HSP 1 Score: 276.944 bits (707), Expect = 1.391e-94
Identity = 128/180 (71.11%), Postives = 153/180 (85.00%), Query Frame = 3
Query:  102 GLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            GLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I  ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+L++ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   S+  ++
Sbjct:    1 GLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDITHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLVFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKSVNAKR 180          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Zebrafish
Match: arl3a (ADP ribosylation factor like GTPase 3a [Source:ZFIN;Acc:ZDB-GENE-050417-368])

HSP 1 Score: 271.166 bits (692), Expect = 2.734e-92
Identity = 128/168 (76.19%), Postives = 148/168 (88.10%), Query Frame = 3
Query:   96 KMGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQ 599
            KMGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L  IRDR WQIQ CSA TGEGVQ
Sbjct:   14 KMGLLSILRKLKSAPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDMLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHIIRDRMWQIQSCSALTGEGVQ 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Zebrafish
Match: arl3l1 (ADP ribosylation factor like GTPase 3, like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1649])

HSP 1 Score: 250.366 bits (638), Expect = 4.709e-84
Identity = 118/180 (65.56%), Postives = 145/180 (80.56%), Query Frame = 3
Query:  102 GLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            GL  ++ K+K  + QE+RI+ LGLDNAGKTTLLK LASE++N ITPTQGFN+K+V   G KLNVWDIGGQR+IRP+W+ Y +NTD+LIYVIDSADKKRF ET  EL+EL+ E  L GVPLLI+ANKQDL  A+PASEI+ GL+L + RDREWQIQ CSA +GEGVQ G+ W  ++I  +K
Sbjct:    7 GLFSVIEKLKGTTEQELRIVLLGLDNAGKTTLLKQLASEDVNTITPTQGFNIKSVTCDGMKLNVWDIGGQRKIRPFWKKYLENTDLLIYVIDSADKKRFEETGLELSELIDEENLKGVPLLIFANKQDLATASPASEIAEGLNLHTYRDREWQIQACSAVSGEGVQDGMNWISNNIVNKK 186          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Xenopus
Match: ARL3 (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:100492073])

HSP 1 Score: 280.026 bits (715), Expect = 1.581e-95
Identity = 130/180 (72.22%), Postives = 155/180 (86.11%), Query Frame = 3
Query:  102 GLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            GLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    7 GLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKK 186          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Xenopus
Match: ARL3 (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:100492073])

HSP 1 Score: 273.863 bits (699), Expect = 4.971e-93
Identity = 128/167 (76.65%), Postives = 149/167 (89.22%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQ 599
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQ 167          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Xenopus
Match: ARL3 (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:100492073])

HSP 1 Score: 256.914 bits (655), Expect = 1.666e-86
Identity = 120/152 (78.95%), Postives = 138/152 (90.79%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQ 599
            QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ
Sbjct:    6 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQ 157          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Xenopus
Match: ARL3 (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:100492073])

HSP 1 Score: 252.292 bits (643), Expect = 6.152e-85
Identity = 118/151 (78.15%), Postives = 137/151 (90.73%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGV 596
            QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEG+
Sbjct:    6 QEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGL 156          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Xenopus
Match: septin10 (Xenopus tropicalis ADP-ribosylation factor-like 3, like 2 (arl3l2), transcript variant 2, mRNA. [Source:RefSeq mRNA;Acc:NM_001345943])

HSP 1 Score: 232.646 bits (592), Expect = 8.299e-77
Identity = 107/183 (58.47%), Postives = 145/183 (79.23%), Query Frame = 3
Query:  102 GLLDLLRKMKTKSGQE---VRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            GLL L++++KT +  +   +RI+ LGLDNAGKTT+L  LA EE++ ITPTQGFN+K+VQ++G KL VWDIGGQR IR +W+ Y  +TD+LIYV+DSAD+KRF ET +EL EL+ +  L GVPLL++ANKQDL+ AAPA+EI++GL+L + RDR WQIQ CSA +GEG+Q G++W   +I  +K
Sbjct:    9 GLLSLVQELKTLNSFDENGIRIVLLGLDNAGKTTILTRLALEEVSSITPTQGFNIKSVQSQGLKLTVWDIGGQRAIRTHWKKYLSSTDLLIYVVDSADRKRFEETGQELAELIEDDSLLGVPLLVFANKQDLLTAAPAAEIASGLNLHTYRDRTWQIQACSAISGEGIQDGMDWICKNIVAKK 191          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Mouse
Match: Arl3 (ADP-ribosylation factor-like 3 [Source:MGI Symbol;Acc:MGI:1929699])

HSP 1 Score: 261.922 bits (668), Expect = 1.237e-88
Identity = 130/181 (71.82%), Postives = 155/181 (85.64%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWR+YF+NTDILIYVIDSAD+KRF ET +EL ELL E KL+ VP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Mouse
Match: Arl3 (ADP-ribosylation factor-like 3 [Source:MGI Symbol;Acc:MGI:1929699])

HSP 1 Score: 253.447 bits (646), Expect = 3.116e-85
Identity = 127/167 (76.05%), Postives = 148/167 (88.62%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQ 599
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWR+YF+NTDILIYVIDSAD+KRF ET +EL ELL E KL+ VP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQ 167          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Mouse
Match: Arl2 (ADP-ribosylation factor-like 2 [Source:MGI Symbol;Acc:MGI:1928393])

HSP 1 Score: 207.608 bits (527), Expect = 4.068e-67
Identity = 98/180 (54.44%), Postives = 131/180 (72.78%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            MGLL +L+KMK K  +E+R+L LGLDNAGKTT+LK    E+++ I+PT GFN+KT++ +GFKLN+WD+GGQ+ +R YWRNYF++TD LI+V+DSAD++R  +   EL  LL+E +LAG  LLI+ANKQDL  A   + I   L L SIR   W+IQ CSA TGE +  G++W L  I  R
Sbjct:    1 MGLLTILKKMKQKE-RELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSR 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Mouse
Match: Arf3 (ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:MGI:99432])

HSP 1 Score: 171.014 bits (432), Expect = 8.015e-53
Identity = 83/166 (50.00%), Postives = 112/166 (67.47%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R NE  EEL  +L E +L    LL++ANKQDL NA  A+EI+  L L S+R R W IQ   A +G+G+ +GL+W  + ++ +K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Mouse
Match: Arf1 (ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:MGI:99431])

HSP 1 Score: 169.474 bits (428), Expect = 3.351e-52
Identity = 83/166 (50.00%), Postives = 111/166 (66.87%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R NE  EEL  +L E +L    LL++ANKQDL NA  A+EI+  L L S+R R W IQ   A +G+G+ +GL+W  + +  +K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. UniProt/SwissProt
Match: sp|Q8QHI3|ARL3_XENLA (ADP-ribosylation factor-like protein 3 OS=Xenopus laevis OX=8355 GN=arl3 PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 3.142e-95
Identity = 130/181 (71.82%), Postives = 156/181 (86.19%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TG+GVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGQGVQDGMNWVCKNVNAKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. UniProt/SwissProt
Match: sp|B5FYQ0|ARL3_TAEGU (ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata OX=59729 GN=ARL3 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 5.084e-95
Identity = 131/181 (72.38%), Postives = 156/181 (86.19%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTDILIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA +GEGVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSTPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALSGEGVQDGMNWVCKNVSTKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. UniProt/SwissProt
Match: sp|Q1MTE5|ARL3_DANRE (ADP-ribosylation factor-like protein 3 OS=Danio rerio OX=7955 GN=arl3 PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 8.594e-95
Identity = 129/181 (71.27%), Postives = 154/181 (85.08%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I  ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+L++ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   S+  ++
Sbjct:    1 MGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDITHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLVFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKSVNAKR 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. UniProt/SwissProt
Match: sp|Q52NJ4|ARL3_PIG (ADP-ribosylation factor-like protein 3 OS=Sus scrofa OX=9823 GN=ARL3 PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 1.643e-88
Identity = 131/181 (72.38%), Postives = 155/181 (85.64%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTDILIYVIDSAD+KRF ET +EL ELL E KL+ VP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. UniProt/SwissProt
Match: sp|Q2TBW6|ARL3_BOVIN (ADP-ribosylation factor-like protein 3 OS=Bos taurus OX=9913 GN=ARL3 PE=2 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 1.717e-88
Identity = 131/181 (72.38%), Postives = 155/181 (85.64%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTDILIYVIDSAD+KRF ET +EL ELL E KL+ VP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRFWQIQSCSALTGEGVQDGMNWVCKNVSAKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. TrEMBL
Match: T1JPQ5 (Uncharacterized protein OS=Tetranychus urticae OX=32264 GN=107368871 PE=3 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.380e-95
Identity = 134/181 (74.03%), Postives = 158/181 (87.29%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL LLRK+KT   +EVRIL LGLDNAGKTT+LK ++SE+I+ ITPTQGFN+K+VQT GFKLNVWDIGGQR+IRPYWRNYFDNTD+LIYVIDS+DKKRF ETS ELNELL E KL G+P+LIYANKQDL NA+PASEI+ GL L SIRDR WQIQ CSA +GEG+++GL+WA  +I+ +K
Sbjct:    2 MGLLSLLRKLKTTPDREVRILLLGLDNAGKTTILKKMSSEDISHITPTQGFNIKSVQTSGFKLNVWDIGGQRKIRPYWRNYFDNTDVLIYVIDSSDKKRFEETSIELNELLQEDKLNGIPILIYANKQDLFNASPASEIAEGLHLPSIRDRSWQIQACSAISGEGLKEGLDWACKNIKPKK 182          
BLAST of ADP-ribosylation factor-like protein 3 vs. TrEMBL
Match: E3TCI5 (ADP-ribosylation factor-like protein 3 OS=Ictalurus furcatus OX=66913 GN=ARL3 PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.856e-94
Identity = 132/181 (72.93%), Postives = 157/181 (86.74%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQPCSA TGEGVQ G+ W   S++ R+
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDLLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQPCSALTGEGVQDGMNWVCKSVDARR 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. TrEMBL
Match: A0A2D0S9I9 (ADP-ribosylation factor-like protein 3 OS=Ictalurus punctatus OX=7998 GN=LOC108274068 PE=3 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 4.079e-94
Identity = 132/181 (72.93%), Postives = 156/181 (86.19%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQPCSA TGEGVQ G+ W   S+  R+
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDLLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQPCSALTGEGVQDGMNWVCKSVNARR 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. TrEMBL
Match: A0A401RLT3 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0018221 PE=3 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 5.443e-94
Identity = 131/182 (71.98%), Postives = 157/182 (86.26%), Query Frame = 3
Query:   96 KMGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            KMGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+L++ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:   25 KMGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLVFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVHAKK 206          
BLAST of ADP-ribosylation factor-like protein 3 vs. TrEMBL
Match: A0A3B3YEX4 (ADP ribosylation factor like GTPase 3 OS=Poecilia mexicana OX=48701 GN=ARL3 PE=3 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 7.009e-94
Identity = 131/182 (71.98%), Postives = 157/182 (86.26%), Query Frame = 3
Query:   96 KMGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            KMGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEG+Q+G+ W   S+  +K
Sbjct:   26 KMGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRMWQIQSCSALTGEGIQEGMNWVCKSVNSKK 207          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Cavefish
Match: arl3a (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:103033567])

HSP 1 Score: 280.411 bits (716), Expect = 5.463e-96
Identity = 131/181 (72.38%), Postives = 155/181 (85.64%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTDILIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRMWQIQSCSALTGEGVQDGMNWVCKNVTAKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Cavefish
Match: arl3b (ADP-ribosylation factor-like protein 3 [Source:NCBI gene;Acc:103024595])

HSP 1 Score: 279.641 bits (714), Expect = 1.241e-95
Identity = 130/181 (71.82%), Postives = 155/181 (85.64%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   S+  ++
Sbjct:    1 MGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDLLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKSVNAKR 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Cavefish
Match: arl3b (ADP-ribosylation factor-like protein 3 [Source:NCBI gene;Acc:103024595])

HSP 1 Score: 277.33 bits (708), Expect = 9.318e-95
Identity = 131/184 (71.20%), Postives = 157/184 (85.33%), Query Frame = 3
Query:   90 LFKMGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            LF+ GLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   S+  ++
Sbjct:    2 LFQ-GLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDLLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKSVNAKR 184          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Cavefish
Match: arl3a (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:103033567])

HSP 1 Score: 263.848 bits (673), Expect = 1.202e-89
Identity = 123/166 (74.10%), Postives = 144/166 (86.75%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTDILIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    5 QEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRMWQIQSCSALTGEGVQDGMNWVCKNVTAKK 170          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Cavefish
Match: arl3l2 (ADP-ribosylation factor-like protein 3 [Source:NCBI gene;Acc:103027842])

HSP 1 Score: 256.914 bits (655), Expect = 1.378e-86
Identity = 121/180 (67.22%), Postives = 147/180 (81.67%), Query Frame = 3
Query:  102 GLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            GLL ++ K+K  S QEVRIL LGLDNAGKTT+LKSLASE+++ ITPTQGFN+K+V + G KLNVWDIGGQR+IRP+W+ Y +NTD+LIYVIDSADKKRF ET  EL+EL+ E  L GVP+LI+ANKQDL  A+PASEI+ GL+L + RDR WQIQ CSA +GEGVQ G+ W  S+I  RK
Sbjct:    7 GLLSIIEKLKGSSEQEVRILLLGLDNAGKTTILKSLASEDVSTITPTQGFNIKSVASHGMKLNVWDIGGQRKIRPFWKKYLENTDLLIYVIDSADKKRFEETGMELSELIDEENLKGVPVLIFANKQDLATASPASEIAEGLNLHTYRDRVWQIQACSAVSGEGVQDGMNWICSNIVNRK 186          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Sea Lamprey
Match: arl3b (ADP ribosylation factor like GTPase 3b [Source:NCBI gene;Acc:797451])

HSP 1 Score: 266.159 bits (679), Expect = 4.159e-91
Identity = 130/181 (71.82%), Postives = 156/181 (86.19%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDNAGKTTLLK+LASE+I  ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+L++ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEGVQ G+ W   ++  +K
Sbjct:    1 MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKTLASEDITHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLEEEKLSGVPVLVFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQACSALTGEGVQDGMNWVCKNVNAKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Sea Lamprey
Match: arl2 (ADP-ribosylation factor-like 2 [Source:ZFIN;Acc:ZDB-GENE-041010-19])

HSP 1 Score: 202.986 bits (515), Expect = 4.235e-66
Identity = 94/180 (52.22%), Postives = 128/180 (71.11%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            MGL+ +L+KMK K  +EVR+L LGLDNAGKTT+LK    E+I+ I+PT GFN+KT++ +GFKLN+WD+GGQ+ +R YWRNYF++TD L++V+DSAD++R  +  +EL  LL E +L G  LL++ANKQDL  A  A  I   L L +I+   W I  CSA TGE +  G++W L  I  R
Sbjct:    1 MGLMTILKKMKQKE-REVRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRRRLEDCGKELASLLQEERLTGATLLVFANKQDLAGALSADNIKEALDLEAIKTHHWCILGCSAVTGENLLMGIDWILDDISSR 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Sea Lamprey
Match: arf1 (ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GENE-010724-5])

HSP 1 Score: 171.785 bits (434), Expect = 4.820e-54
Identity = 84/166 (50.60%), Postives = 112/166 (67.47%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R NE  EEL  +L E +L    LL++ANKQDL NA  A+EI+  L L S+R R W IQ   A +G+G+ +GL+W  + ++ RK
Sbjct:   15 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLKNRK 180          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 169.859 bits (429), Expect = 3.314e-53
Identity = 83/166 (50.00%), Postives = 111/166 (66.87%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R NE  EEL  +L E +L    LL++ANKQDL NA  A+EI+  L L S+R R W IQ   A +G+G+ +GL+W  + ++  K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRNAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNHK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 163.31 bits (412), Expect = 1.090e-50
Identity = 82/166 (49.40%), Postives = 111/166 (66.87%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R NE  EEL  +L E +L    LL++ANKQDL NA  A+EI+  L L S+R R W IQ  +   G+G+ +GL+W  + ++ +K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQ-ATPPVGDGLYEGLDWLSNQLKNQK 180          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 167.548 bits (423), Expect = 1.691e-52
Identity = 82/165 (49.70%), Postives = 111/165 (67.27%), Query Frame = 3
Query:  138 SGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIE 632
            S +E+RIL LGLD AGKTT+L  L   E+    PT GFNV+T+  K  KLNVWD+GGQ  IRPYWR Y+ +T  +I+V+DS DK R +  S+EL+ +L E +L    LL++ANKQD   A  ASE+S  L+L+ ++DR W I   SA  GEG+ +GL+W +  I+
Sbjct:   15 SNKELRILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIK 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 160.229 bits (404), Expect = 1.122e-49
Identity = 79/163 (48.47%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIE 632
            +E+RIL +GLD AGKTT+L  L   E+    PT GFNV+TVQ K     VWD+GGQ RIR  WR+Y+ NT+ +I+V+DS D+ R  E  E +  +L E +L     L++ANKQDL  A  A+EI+  L L SIR+R W IQ   A +GEG+ +GLEW  +S++
Sbjct:   16 KEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLK 178          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 158.688 bits (400), Expect = 4.629e-49
Identity = 79/157 (50.32%), Postives = 103/157 (65.61%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEW 614
            +E+RIL +GLD AGKTT+L  L   E+    PT GFNV+TVQ K     VWD+GGQ RIR  WR+Y+ NT+ +I+VIDS D+ R  E  E +  +L E +L     L++ANKQDL  A  A+EI+  L L SIR+R W IQ   A +GEG+ +GLEW
Sbjct:   16 KEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEW 172          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 147.517 bits (371), Expect = 1.130e-44
Identity = 73/158 (46.20%), Postives = 106/158 (67.09%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSL-LSIRDREWQIQPCSAQTGEGVQQGLEW 614
            +E++IL LGLD AGKTT+L  L   +I   TPT GFNV+TV  K  K N+WD+GGQ+R+RP WR+YF  T  LI+VIDS+ + R  E  EEL  ++ E ++  V LL++ANKQDL +A    E+S  L L  +++++ W +   +A +G+G+ +GL W
Sbjct:   16 KEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSW 173          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Yeast
Match: ARL3 (ARF-like small GTPase of the RAS superfamily; required for recruitment of Arl1p, a GTPase that regulates membrane traffic, to the Golgi apparatus; NatC-catalyzed N-terminal acetylation regulates Golgi membrane association mediated by interaction with membrane receptor, Sys1p; similar to ADP-ribosylation factor and orthologous to mammalian ARFRP1 [Source:SGD;Acc:S000005972])

HSP 1 Score: 120.939 bits (302), Expect = 2.884e-34
Identity = 67/179 (37.43%), Postives = 106/179 (59.22%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLK------SLASEEINQITPTQGFNVKTVQTKGFK-LNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLS--IRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGKSK 653
            ++  IL LGLDNAGKTT L+      SLA + + +I PT G NV T+     + L  WD+GGQ  +R  W  Y+     +I+++DS+D++R +E S  L  ++M+ ++ GVP+L+ ANKQD  +     +I    + ++  I  R+ ++ P SA TGEGV+  +EW +  +E R  KS+
Sbjct:   16 EQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLE-RNKKSR 193          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Nematostella
Match: EDO32348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVC4])

HSP 1 Score: 229.18 bits (583), Expect = 3.091e-76
Identity = 117/163 (71.78%), Postives = 140/163 (85.89%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKG-FKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSI 629
            +E+RIL LGLDN+GKTT+LKSLASE++  ITPTQGFN+K+VQ+KG F+LNVWDIGGQR+IRPYW+NYF+NTDILIYVIDSAD+KR  ET  EL+ELL E KL GVPLL++ANKQDLMNAA  +EIS+ L L +IR R WQIQ CSA TGEGVQ G+EWA+  +
Sbjct:   16 REMRILLLGLDNSGKTTILKSLASEDVLHITPTQGFNIKSVQSKGGFRLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRMEETGTELDELLEEEKLIGVPLLVFANKQDLMNAATPAEISSNLGLNTIRSRGWQIQGCSALTGEGVQDGVEWAMRYV 178          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Nematostella
Match: EDO32994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STE6])

HSP 1 Score: 210.69 bits (535), Expect = 6.098e-69
Identity = 102/180 (56.67%), Postives = 131/180 (72.78%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            MGLL +L+KMK K  +EVRIL LGLDNAGKTT+LK    E+IN I PT GFN+KT++ + FKLN+WD+GGQR +R YWRNYF++TD LI+V+DSAD++R  +   EL  LL+E +LAG  LL++ANKQDL  A  A +I   L L SI+   WQIQ CSA TGE +  G++W +S I  R
Sbjct:    1 MGLLTILKKMKQKE-KEVRILMLGLDNAGKTTILKKFNGEDINTIEPTLGFNIKTLEHRDFKLNIWDVGGQRSLRSYWRNYFESTDGLIWVVDSADQRRLADCKMELQGLLVEERLAGATLLVFANKQDLPGALSAEQIKQALDLDSIKSHHWQIQWCSAVTGEKLLDGIDWIISDIASR 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Nematostella
Match: EDO42156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S214])

HSP 1 Score: 171.4 bits (433), Expect = 1.607e-53
Identity = 84/166 (50.60%), Postives = 113/166 (68.07%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R  E  EELN +L E +L    LL++ANKQDL NA  A+EI+  L L S+R+R+W IQ   A +G+G+ +GL+W  S ++  K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELNRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRNRQWYIQATCATSGDGLYEGLDWLSSQLKNAK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Nematostella
Match: EDO48359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD9])

HSP 1 Score: 170.629 bits (431), Expect = 2.653e-53
Identity = 83/157 (52.87%), Postives = 108/157 (68.79%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEW 614
            +++RIL +GLD AGKTT+L  L   EI    PT GFNV++V+ K     VWD+GGQ +IRP WR+YF NT  LIYV+DS D++R NE+ EELN++L E +L    +L+ ANKQDL NA   SEI+  L L SIRDR+W IQ   A  G G+ +GL+W
Sbjct:   16 KQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIRDRQWYIQAACATQGTGLYEGLDW 172          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Nematostella
Match: EDO48360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJE1])

HSP 1 Score: 171.4 bits (433), Expect = 3.505e-53
Identity = 83/157 (52.87%), Postives = 108/157 (68.79%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEW 614
            +++RIL +GLD AGKTT+L  L   EI    PT GFNV++V+ K     VWD+GGQ +IRP WR+YF NT  LIYV+DS D++R NE+ EELN++L E +L    +L+ ANKQDL NA   SEI+  L L SIRDR+W IQ   A  G G+ +GL+W
Sbjct:   16 KQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVESVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIYVVDSNDRERVNESKEELNKMLQEDELKDAVVLVMANKQDLPNALSVSEITEKLGLQSIRDRQWYIQAACATQGTGLYEGLDW 172          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Medaka
Match: arl3b (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:101172287])

HSP 1 Score: 281.182 bits (718), Expect = 2.581e-96
Identity = 130/181 (71.82%), Postives = 156/181 (86.19%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            MGLL +LRK+K+   QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEG+Q+G+ W   S+  +K
Sbjct:    1 MGLLSILRKLKSTPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRMWQIQSCSALTGEGIQEGMNWVCKSVNSKK 181          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Medaka
Match: arl3b (ADP ribosylation factor like GTPase 3 [Source:NCBI gene;Acc:101172287])

HSP 1 Score: 266.159 bits (679), Expect = 2.085e-90
Identity = 123/171 (71.93%), Postives = 146/171 (85.38%), Query Frame = 3
Query:  129 KTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            K    QEVRIL LGLDN GKTTLLK LASE+I+ ITPTQGFN+K+VQ++GFKLNVWDIGGQR+IRPYWRNYF+NTD+LIYVIDSAD+KRF ET +EL ELL E KL+GVP+LI+ANKQDL+ AAPASEI+ GL+L +IRDR WQIQ CSA TGEG+Q+G+ W   S+  +K
Sbjct:    3 KITPDQEVRILLLGLDNGGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRMWQIQSCSALTGEGIQEGMNWVCKSVNSKK 173          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Medaka
Match: arl3l2 (ADP-ribosylation factor-like protein 3 [Source:NCBI gene;Acc:101159275])

HSP 1 Score: 258.455 bits (659), Expect = 2.631e-87
Identity = 121/180 (67.22%), Postives = 148/180 (82.22%), Query Frame = 3
Query:  102 GLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            GLL ++ K+K  + QEVRI+ LGLDNAGKTTLLKSLASE++N ITPTQGFN+K+V + G KLNVWDIGGQR+IRP+W+ Y +NTD+LIYVIDSADKKRF ET  EL+EL+ E  L GVP+LI+ANKQDL  A+PASEI+ GL+L + RDREWQIQ CSA +GEGVQ G+ W  ++I  RK
Sbjct:    7 GLLSVIEKLKGSTEQEVRIVLLGLDNAGKTTLLKSLASEDVNTITPTQGFNIKSVASHGMKLNVWDIGGQRKIRPFWKKYLENTDLLIYVIDSADKKRFEETGLELSELIDEENLKGVPVLIFANKQDLATASPASEIAEGLNLHTYRDREWQIQACSAMSGEGVQDGMNWICNNIVNRK 186          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Medaka
Match: ENSORLT00000009074.2 (ADP-ribosylation factor-like protein 3 [Source:NCBI gene;Acc:101160749])

HSP 1 Score: 251.136 bits (640), Expect = 2.768e-84
Identity = 123/180 (68.33%), Postives = 149/180 (82.78%), Query Frame = 3
Query:  102 GLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRK 641
            GLL +LR++K     EVR+L LGLDNAGKTTLLK LA+E+I+ ITPTQGFN+K+VQ  GFKLNVWDIGGQR+IRPYWR+YFDNTD+LIYVIDS+D+KR +ETS EL +LL E KLAGVPLLI+ANKQDLM A+PAS ++  L+L +IRDR WQ+Q CSA T EGVQ G+ W   +I+ RK
Sbjct:    8 GLLSILRRLKQSPDHEVRLLLLGLDNAGKTTLLKQLAAEDISHITPTQGFNIKSVQASGFKLNVWDIGGQRKIRPYWRSYFDNTDVLIYVIDSSDRKRLDETSLELADLLEEEKLAGVPLLIFANKQDLMTASPASVLAESLNLHTIRDRMWQVQACSALTAEGVQDGMTWVCRNIKFRK 187          
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Medaka
Match: ENSORLT00000043973.1 (ADP-ribosylation factor-like protein 3 [Source:NCBI gene;Acc:101160749])

HSP 1 Score: 240.736 bits (613), Expect = 3.750e-80
Identity = 118/166 (71.08%), Postives = 141/166 (84.94%), Query Frame = 3
Query:  102 GLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQ 599
            GLL +LR++K     EVR+L LGLDNAGKTTLLK LA+E+I+ ITPTQGFN+K+VQ  GFKLNVWDIGGQR+IRPYWR+YFDNTD+LIYVIDS+D+KR +ETS EL +LL E KLAGVPLLI+ANKQDLM A+PAS ++  L+L +IRDR WQ+Q CSA T EGVQ
Sbjct:    6 GLLSILRRLKQSPDHEVRLLLLGLDNAGKTTLLKQLAAEDISHITPTQGFNIKSVQASGFKLNVWDIGGQRKIRPYWRSYFDNTDVLIYVIDSSDRKRLDETSLELADLLEEEKLAGVPLLIFANKQDLMTASPASVLAESLNLHTIRDRMWQVQACSALTAEGVQ 171          
BLAST of ADP-ribosylation factor-like protein 3 vs. Planmine SMEST
Match: SMESG000074427.1 (SMESG000074427.1)

HSP 1 Score: 375.941 bits (964), Expect = 8.264e-134
Identity = 185/185 (100.00%), Postives = 185/185 (100.00%), Query Frame = 3
Query:   99 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGKSK 653
            MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGKSK
Sbjct:    1 MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGKSK 185          
BLAST of ADP-ribosylation factor-like protein 3 vs. Planmine SMEST
Match: SMESG000074427.1 (SMESG000074427.1)

HSP 1 Score: 359.762 bits (922), Expect = 1.710e-127
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 3
Query:  126 MKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGKSK 653
            MKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGKSK
Sbjct:    1 MKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGKSK 176          
BLAST of ADP-ribosylation factor-like protein 3 vs. Planmine SMEST
Match: SMESG000034717.1 (SMESG000034717.1)

HSP 1 Score: 186.037 bits (471), Expect = 6.056e-59
Identity = 85/163 (52.15%), Postives = 118/163 (72.39%), Query Frame = 3
Query:  150 VRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGR 638
            VRIL LGLDNAGKTT++K    E+I+ I+PT GF++KT++ + FKLN+WD+GGQ+ +R YWRNYF+ TD LI+V+DS+D+ R N+  +EL+ LL+E +LAG  LL++ANKQDL  A    EI   L+L SI+   W I+ CSA TGE +  G++W +  I  R
Sbjct:   17 VRILILGLDNAGKTTIVKKFNGEDISTISPTLGFSIKTLEHRKFKLNIWDVGGQKSLRSYWRNYFEATDGLIWVVDSSDRHRMNDCVKELSNLLVEERLAGATLLVFANKQDLPGALGIEEIREALNLDSIKSHHWIIKGCSAVTGENLLDGVDWLIDDIASR 179          
BLAST of ADP-ribosylation factor-like protein 3 vs. Planmine SMEST
Match: SMESG000067743.1 (SMESG000067743.1)

HSP 1 Score: 169.859 bits (429), Expect = 1.085e-52
Identity = 83/168 (49.40%), Postives = 113/168 (67.26%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGK 647
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  LI+V+DS D++R NE  EEL  +L E +L    LL++ANKQDL NA   +EI+  L L S+R+R W IQ   A +G+G+ +GL+W  ++++ R  K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLKNRSKK 183          
BLAST of ADP-ribosylation factor-like protein 3 vs. Planmine SMEST
Match: SMESG000000945.1 (SMESG000000945.1)

HSP 1 Score: 168.318 bits (425), Expect = 5.509e-52
Identity = 82/168 (48.81%), Postives = 114/168 (67.86%), Query Frame = 3
Query:  144 QEVRILTLGLDNAGKTTLLKSLASEEINQITPTQGFNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRFNETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRDREWQIQPCSAQTGEGVQQGLEWALSSIEGRKGK 647
            +E+RIL +GLD AGKTT+L  L   EI    PT GFNV+TV+ K     VWD+GGQ +IRP WR+YF NT  +I+V+DS D++R  E  EEL+ +L E +L G  LL++ANKQDL NA  A+E++  L+L S+R R+W IQ   A +G+G+ +GL+W    ++ R  K
Sbjct:   16 KEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGVIFVVDSNDRERVQEAKEELSRMLNEDELRGAVLLVFANKQDLPNAMNAAEVTEKLALNSLRLRDWYIQSTCATSGDGLYEGLDWLSQILKNRSKK 183          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARL38.952e-8971.82ADP ribosylation factor like GTPase 3 [Source:HGNC... [more]
ARL23.203e-6655.00ADP ribosylation factor like GTPase 2 [Source:HGNC... [more]
ARL23.203e-6655.00ADP ribosylation factor like GTPase 2 [Source:HGNC... [more]
ARF31.167e-5250.00ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
ARF31.167e-5250.00ADP ribosylation factor 3 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl-31.314e-7459.78ADP-ribosylation factor-like protein 3 [Source:Un... [more]
evl-203.818e-5747.78ADP-ribosylation factor-like protein 2 [Source:Un... [more]
arf-31.958e-5150.96ADP-Ribosylation Factor related; ADP-ribosylation ... [more]
arf-1.21.106e-5048.48ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
arf-1.21.106e-5048.48ADP-ribosylation factor 1-like 2 [Source:UniProtK... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnd3.636e-7255.06gene:FBgn0038916 transcript:FBtr0084151[more]
Arl24.483e-5648.33gene:FBgn0004908 transcript:FBtr0081838[more]
Arf79F1.350e-5152.23gene:FBgn0010348 transcript:FBtr0332054[more]
Arf79F1.350e-5152.23gene:FBgn0010348 transcript:FBtr0078573[more]
Arf79F1.350e-5152.23gene:FBgn0010348 transcript:FBtr0299906[more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl3b1.138e-9571.27ADP ribosylation factor like GTPase 3b [Source:NCB... [more]
arl3a4.822e-9571.82ADP ribosylation factor like GTPase 3a [Source:ZFI... [more]
arl3b1.391e-9471.11ADP ribosylation factor like GTPase 3b [Source:NCB... [more]
arl3a2.734e-9276.19ADP ribosylation factor like GTPase 3a [Source:ZFI... [more]
arl3l14.709e-8465.56ADP ribosylation factor like GTPase 3, like 1 [Sou... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARL31.581e-9572.22ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
ARL34.971e-9376.65ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
ARL31.666e-8678.95ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
ARL36.152e-8578.15ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
septin108.299e-7758.47Xenopus tropicalis ADP-ribosylation factor-like 3,... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arl31.237e-8871.82ADP-ribosylation factor-like 3 [Source:MGI Symbol;... [more]
Arl33.116e-8576.05ADP-ribosylation factor-like 3 [Source:MGI Symbol;... [more]
Arl24.068e-6754.44ADP-ribosylation factor-like 2 [Source:MGI Symbol;... [more]
Arf38.015e-5350.00ADP-ribosylation factor 3 [Source:MGI Symbol;Acc:M... [more]
Arf13.351e-5250.00ADP-ribosylation factor 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8QHI3|ARL3_XENLA3.142e-9571.82ADP-ribosylation factor-like protein 3 OS=Xenopus ... [more]
sp|B5FYQ0|ARL3_TAEGU5.084e-9572.38ADP-ribosylation factor-like protein 3 OS=Taeniopy... [more]
sp|Q1MTE5|ARL3_DANRE8.594e-9571.27ADP-ribosylation factor-like protein 3 OS=Danio re... [more]
sp|Q52NJ4|ARL3_PIG1.643e-8872.38ADP-ribosylation factor-like protein 3 OS=Sus scro... [more]
sp|Q2TBW6|ARL3_BOVIN1.717e-8872.38ADP-ribosylation factor-like protein 3 OS=Bos taur... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1JPQ54.380e-9574.03Uncharacterized protein OS=Tetranychus urticae OX=... [more]
E3TCI51.856e-9472.93ADP-ribosylation factor-like protein 3 OS=Ictaluru... [more]
A0A2D0S9I94.079e-9472.93ADP-ribosylation factor-like protein 3 OS=Ictaluru... [more]
A0A401RLT35.443e-9471.98Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A3B3YEX47.009e-9471.98ADP ribosylation factor like GTPase 3 OS=Poecilia ... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl3a5.463e-9672.38ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
arl3b1.241e-9571.82ADP-ribosylation factor-like protein 3 [Source:NCB... [more]
arl3b9.318e-9571.20ADP-ribosylation factor-like protein 3 [Source:NCB... [more]
arl3a1.202e-8974.10ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
arl3l21.378e-8667.22ADP-ribosylation factor-like protein 3 [Source:NCB... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl3b4.159e-9171.82ADP ribosylation factor like GTPase 3b [Source:NCB... [more]
arl24.235e-6652.22ADP-ribosylation factor-like 2 [Source:ZFIN;Acc:ZD... [more]
arf14.820e-5450.60ADP-ribosylation factor 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
arf2a3.314e-5350.00ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
arf2a1.090e-5049.40ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARL11.691e-5249.70Soluble GTPase with a role in regulation of membra... [more]
ARF11.122e-4948.47ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF24.629e-4950.32ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF31.130e-4446.20Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARL32.884e-3437.43ARF-like small GTPase of the RAS superfamily; requ... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO323483.091e-7671.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329946.098e-6956.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421561.607e-5350.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483592.653e-5352.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483603.505e-5352.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl3b2.581e-9671.82ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
arl3b2.085e-9071.93ADP ribosylation factor like GTPase 3 [Source:NCBI... [more]
arl3l22.631e-8767.22ADP-ribosylation factor-like protein 3 [Source:NCB... [more]
ENSORLT00000009074.22.768e-8468.33ADP-ribosylation factor-like protein 3 [Source:NCB... [more]
ENSORLT00000043973.13.750e-8071.08ADP-ribosylation factor-like protein 3 [Source:NCB... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074427.18.264e-134100.00SMESG000074427.1[more]
SMESG000074427.11.710e-127100.00SMESG000074427.1[more]
SMESG000034717.16.056e-5952.15SMESG000034717.1[more]
SMESG000067743.11.085e-5249.40SMESG000067743.1[more]
SMESG000000945.15.509e-5248.81SMESG000000945.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017731 ID=SMED30017731|Name=ADP-ribosylation factor-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=814bp
GTTTAATAAGAATTTGTTTTAAGCTATTTTTAACTTAGCACCGAATTACT
TATTTCTACAAACAATTAGATTGTTGCATTTTCAAATAATTATTTAAAAT
GGGATTGCTAGATTTACTTAGAAAAATGAAAACTAAATCCGGCCAAGAAG
TAAGGATACTTACTTTAGGTCTTGATAATGCTGGAAAAACTACTCTTCTT
AAATCATTAGCCTCTGAAGAAATAAATCAAATAACTCCTACTCAGGGATT
CAATGTAAAAACTGTTCAAACGAAAGGATTCAAGTTAAATGTTTGGGACA
TTGGCGGTCAAAGGCGGATCAGGCCTTATTGGAGAAATTATTTTGATAAC
ACAGACATTTTAATCTACGTCATAGACAGCGCAGACAAGAAAAGGTTCAA
CGAAACATCGGAAGAGTTAAATGAGCTTCTAATGGAATCAAAGTTAGCAG
GGGTTCCTTTACTAATTTATGCCAATAAGCAAGACTTAATGAATGCCGCT
CCAGCATCGGAGATTTCTACTGGATTGAGTTTACTTTCCATTCGGGATCG
TGAATGGCAAATTCAACCTTGTTCAGCCCAAACTGGTGAGGGTGTTCAGC
AAGGTTTAGAATGGGCCCTGAGCAGCATTGAAGGTCGGAAGGGAAAATCA
AAATAATGTCAACAGCAATTTTGAATTCATCCTATTGTTACTTTTATAAT
CTCAACGATCACTTGTGATTTTTTGGTTTTTTTTGTAAATTTGCTTTATT
TTATTTTATTTGTTTAAATTAACTCTTGTAATTATTATAATACAAATCGT
TATTATTATTACAA
back to top

protein sequence of SMED30017731-orf-1

>SMED30017731-orf-1 ID=SMED30017731-orf-1|Name=SMED30017731-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MGLLDLLRKMKTKSGQEVRILTLGLDNAGKTTLLKSLASEEINQITPTQG
FNVKTVQTKGFKLNVWDIGGQRRIRPYWRNYFDNTDILIYVIDSADKKRF
NETSEELNELLMESKLAGVPLLIYANKQDLMNAAPASEISTGLSLLSIRD
REWQIQPCSAQTGEGVQQGLEWALSSIEGRKGKSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000281mitotic cytokinesis
GO:0007264small GTPase mediated signal transduction
GO:0000910cytokinesis
GO:0001822kidney development
GO:0006810transport
GO:0007049cell cycle
GO:0015031protein transport
GO:0042461photoreceptor cell development
GO:0051301cell division
GO:0060271cilium morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
IPR024156Small_GTPase_ARF
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0008017microtubule binding
GO:0019003GDP binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0000139Golgi membrane
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005876spindle microtubule
GO:0005881cytoplasmic microtubule
GO:0005929cilium
GO:0016020membrane
GO:0030496midbody
GO:0032391photoreceptor connecting cilium
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006689Small GTPase superfamily, ARF/SAR typePRINTSPR00328SAR1GTPBPcoord: 47..71
score: 25.88
coord: 74..99
score: 32.81
coord: 19..42
score: 63.48
coord: 119..140
score: 42.25
IPR006689Small GTPase superfamily, ARF/SAR typePFAMPF00025Arfcoord: 5..175
e-value: 7.9E-69
score: 230.6
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 18..180
e-value: 8.9E-4
score: -62.6
NoneNo IPR availableSMARTSM00178sar_sub_1coord: 4..177
e-value: 1.0E-19
score: 81.5
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..181
e-value: 8.9E-58
score: 207.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 18..177
e-value: 1.5E-60
score: 205.6
NoneNo IPR availablePANTHERPTHR45697:SF4ADP-RIBOSYLATION FACTOR-LIKE PROTEIN 3coord: 1..180
NoneNo IPR availablePANTHERPTHR45697FAMILY NOT NAMEDcoord: 1..180
NoneNo IPR availablePROSITEPS51417ARFcoord: 11..177
score: 22.146
NoneNo IPR availableCDDcd04155Arl3coord: 3..175
e-value: 7.14322E-104
score: 293.919
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 16..167
e-value: 6.0E-21
score: 72.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 15..180