Calpain-5

Overview
NameCalpain-5
Smed IDSMED30017727
Length (bp)2463
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calpain-5 (SMED30017727) t-SNE clustered cells

Violin plots show distribution of expression levels for Calpain-5 (SMED30017727) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calpain-5 (SMED30017727) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calpain-5 (SMED30017727) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30017727SMESG000012000.1 dd_Smed_v4_6985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30017727SMESG000012000.1 dd_Smed_v4_6985_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017727SMESG000012000.1 dd_Smed_v4_6985_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30017727SMESG000012000.1 dd_Smed_v4_6985_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calpain-5 vs. Ensembl Human
Match: CAPN5 (calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482])

HSP 1 Score: 157.532 bits (397), Expect = 1.444e-39
Identity = 168/649 (25.89%), Postives = 273/649 (42.06%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTK--ESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRDGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  L+ +  R      L+EDP FPA+ D L+ K         + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I   + E   +   T   Q    M K     G+    +   +     A+ +      H Y +T   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC V+       S +++ K    W+       W  H D PR  RG   I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP+  T++ V+GA  ++ + T    N +  I CE +   S +   T +P+++   +FYR
Sbjct:   12 NYSALRRDCRRRK---VLFEDPLFPATDDSLYYKGTP---GPAVRWKRPKGICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------NAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI--DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVI-----NTSHLSIHKT---WEEARLHGAWTLHED-PRQNRGGGCINHKDTFFQNPQYIFEVKKPE----DEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTG--ANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. Ensembl Human
Match: CAPN5 (calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482])

HSP 1 Score: 157.532 bits (397), Expect = 1.444e-39
Identity = 168/649 (25.89%), Postives = 273/649 (42.06%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTK--ESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRDGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  L+ +  R      L+EDP FPA+ D L+ K         + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I   + E   +   T   Q    M K     G+    +   +     A+ +      H Y +T   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC V+       S +++ K    W+       W  H D PR  RG   I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP+  T++ V+GA  ++ + T    N +  I CE +   S +   T +P+++   +FYR
Sbjct:   12 NYSALRRDCRRRK---VLFEDPLFPATDDSLYYKGTP---GPAVRWKRPKGICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------NAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI--DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVI-----NTSHLSIHKT---WEEARLHGAWTLHED-PRQNRGGGCINHKDTFFQNPQYIFEVKKPE----DEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTG--ANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. Ensembl Human
Match: CAPN5 (calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482])

HSP 1 Score: 157.532 bits (397), Expect = 1.444e-39
Identity = 168/649 (25.89%), Postives = 273/649 (42.06%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTK--ESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRDGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  L+ +  R      L+EDP FPA+ D L+ K         + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I   + E   +   T   Q    M K     G+    +   +     A+ +      H Y +T   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC V+       S +++ K    W+       W  H D PR  RG   I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP+  T++ V+GA  ++ + T    N +  I CE +   S +   T +P+++   +FYR
Sbjct:   12 NYSALRRDCRRRK---VLFEDPLFPATDDSLYYKGTP---GPAVRWKRPKGICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------NAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI--DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVI-----NTSHLSIHKT---WEEARLHGAWTLHED-PRQNRGGGCINHKDTFFQNPQYIFEVKKPE----DEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTG--ANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. Ensembl Human
Match: CAPN5 (calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482])

HSP 1 Score: 140.198 bits (352), Expect = 8.663e-34
Identity = 168/685 (24.53%), Postives = 277/685 (40.44%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSK---------PNKEFISNDIIWRRPG-----QLSKLP-------------------C---LMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTK--ESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRDGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  L+ +  R      L+EDP FPA+ D L+ K            ++  + +   RPG     ++  +P                   C    +  +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I   + E   +   T   Q    M K     G+    +   +     A+ +      H Y +T   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC V+       S +++ K    W+       W  H D PR  RG   I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP+  T++ V+GA  ++ + T    N +  I CE +   S +   T +P+++   +FYR
Sbjct:   12 NYSALRRDCRRRK---VLFEDPLFPATDDSLYYKGTPGPAVRWKRPKYSGHSLAPHRPGWGDARRMENVPRPGSSGCPSSSLRARDLGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------NAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI--DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVI-----NTSHLSIHKT---WEEARLHGAWTLHED-PRQNRGGGCINHKDTFFQNPQYIFEVKKPE----DEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGA--NSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYR 610          
BLAST of Calpain-5 vs. Ensembl Human
Match: CAPN6 (calpain 6 [Source:HGNC Symbol;Acc:HGNC:1483])

HSP 1 Score: 137.117 bits (344), Expect = 6.158e-33
Identity = 164/651 (25.19%), Postives = 266/651 (40.86%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLK-ERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI--CKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFN--RN-SIIALAKKQLY-----WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQP-ETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWI-AAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEV----NIQLFCENKLG 2015
            L+ DP F    D LF       +   ++W+RP  +   P L+   N  + +   G+L    +    S L  + + +   +PN   Q    Q+       +  Y G F F F   G+   V+IDD LPT     + S S++ NE F  AL+EKAYAK LG Y  L+  +    I+DFTG L E++   K    +++ E    F +     TK     C IE P Q  ++          H Y +T   +I L         L+  F   +   V ++RL +    +E       + + WQ+ T   +K  GL  ++  E W+++E       C   FH  N  RN +     +K+L      W  V  D   +R G   G       FL+N QY+  VP+      + +   +++ Y  +G        N  IG ELF+VE NR +R+H L + ++    + +   R + ++ YL++G YV++P +   G  +++ L++F S+  V+   L  D+P+                                              C      YPK  T+I+V  A D+      +  N +  I C  E   S +  +T+   +D   +FYR   D   +    N + FC+  LG
Sbjct:   26 LFCDPTFLPENDSLFYN---RLLPGKVVWKRPQDICDDPHLI-VGNISNHQLTQGRLGHKPMVSAFSCLAVQESHWTKTIPNHKEQEWDPQK-------TEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNE-FWNALLEKAYAKLLGCYEALDGLTITDIIVDFTGTLAETVDMQKGRYTELVEEKYKLFGELYKTFTKGGLICCSIESPNQEEQEVETDWGLLKGHTYTMTDIRKIRLG------ERLVEVFSAEK---VYMVRLRNPLGRQEWSGPWSEISEEWQQLTASDRKNLGLVMSDDGEFWMSLEDF-----CRN-FHKLNVCRNVNNPIFGRKELESVLGCWT-VDDDPLMNRSG---GCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGR-----PDNYIIGFELFKVEMNRKFRLHHL-YIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTSEFLLRIF-SEVPVQLRELTLDMPKMS--------------------------------------------CWNLARGYPKVVTQITVHSAEDLEKKYANETVNPYLVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLG 594          
BLAST of Calpain-5 vs. Ensembl Celegans
Match: clp-7 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:U4PMH7])

HSP 1 Score: 111.309 bits (277), Expect = 6.904e-25
Identity = 131/528 (24.81%), Postives = 217/528 (41.10%), Query Frame = 3
Query:   75 LKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFH--PGKLSPFWLPILISLLKERN--MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPY---HVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS--LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLL----DISKCS----VLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQY-------LIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAG--NTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSS 1577
            +  + E  R  D   L+EDP FPA+   L+ K   +     IIW+RPG++ + P L+     + +RF    G L   WL   ++ L  R+   + +V P+ S               + +Y G F F F R G+   V+IDDRLPT V   L  + S  N EF  AL+EKAYAK  GGY  L+  +   A+ DFTG L E    S  +K      T+    V  M   S   C I+     N K +  ++     H Y IT    +                 N+ G  VP++R+ +   +  E NG       + W +     +++ G++     E W++ +  +     +  C+    V+  +     +    K++  W   S D  W+      G       +  N QY       +  V     C +   +  +QKY       ++T G  N  IG  +++ + +    +HD++  K +     F   R + +   +  G+YV++P    A     + L++FS+
Sbjct:  295 INFQQERQRCLDQRCLFEDPQFPANDSSLYYKTRPD---EPIIWKRPGEIYENPQLIV---GEKSRFDVKQGALGDCWLLAAVANLTLRDELFYRVVPPDQS--------------FTENYAGIFHFQFWRYGQWVDVVIDDRLPT-VDGRLCYMRSQENNEFWSALLEKAYAKLYGGYENLDGGTTAEALEDFTGGLTEFFDISKGDKS-----TTLAMLVRGMQMGSLFGCSID--ADENVKEAQLTNGLVRGHAYSITAIQTV-----------------NTYGGQVPLLRIRNPWGNSKEWNGAWSDGSSE-WSQVDPQQREQMGVQFAKDGEFWMSFDDFMTNFTQMECCNLSADVMDEISEMTGVEVHDKQKHQWVEKSEDGEWNSRQGTAGGCQNNDTYCNNPQYGTYFQVPMDSVEHDGKCTVIGAV--LQKY----RRELRTKGLDNLPIGFSVYKADGSGQ-AIHDVSGQKPIARTKVFINMREVTVRFRVPPGQYVIVPCTFDAHDDASFLLRIFSN 769          
BLAST of Calpain-5 vs. Ensembl Celegans
Match: clp-7 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:U4PMH7])

HSP 1 Score: 111.309 bits (277), Expect = 6.904e-25
Identity = 131/528 (24.81%), Postives = 217/528 (41.10%), Query Frame = 3
Query:   75 LKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFH--PGKLSPFWLPILISLLKERN--MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPY---HVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS--LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLL----DISKCS----VLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQY-------LIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAG--NTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSS 1577
            +  + E  R  D   L+EDP FPA+   L+ K   +     IIW+RPG++ + P L+     + +RF    G L   WL   ++ L  R+   + +V P+ S               + +Y G F F F R G+   V+IDDRLPT V   L  + S  N EF  AL+EKAYAK  GGY  L+  +   A+ DFTG L E    S  +K      T+    V  M   S   C I+     N K +  ++     H Y IT    +                 N+ G  VP++R+ +   +  E NG       + W +     +++ G++     E W++ +  +     +  C+    V+  +     +    K++  W   S D  W+      G       +  N QY       +  V     C +   +  +QKY       ++T G  N  IG  +++ + +    +HD++  K +     F   R + +   +  G+YV++P    A     + L++FS+
Sbjct:  295 INFQQERQRCLDQRCLFEDPQFPANDSSLYYKTRPD---EPIIWKRPGEIYENPQLIV---GEKSRFDVKQGALGDCWLLAAVANLTLRDELFYRVVPPDQS--------------FTENYAGIFHFQFWRYGQWVDVVIDDRLPT-VDGRLCYMRSQENNEFWSALLEKAYAKLYGGYENLDGGTTAEALEDFTGGLTEFFDISKGDKS-----TTLAMLVRGMQMGSLFGCSID--ADENVKEAQLTNGLVRGHAYSITAIQTV-----------------NTYGGQVPLLRIRNPWGNSKEWNGAWSDGSSE-WSQVDPQQREQMGVQFAKDGEFWMSFDDFMTNFTQMECCNLSADVMDEISEMTGVEVHDKQKHQWVEKSEDGEWNSRQGTAGGCQNNDTYCNNPQYGTYFQVPMDSVEHDGKCTVIGAV--LQKY----RRELRTKGLDNLPIGFSVYKADGSGQ-AIHDVSGQKPIARTKVFINMREVTVRFRVPPGQYVIVPCTFDAHDDASFLLRIFSN 769          
BLAST of Calpain-5 vs. Ensembl Celegans
Match: clp-6 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q9N4B2])

HSP 1 Score: 95.9005 bits (237), Expect = 3.258e-20
Identity = 124/489 (25.36%), Postives = 195/489 (39.88%), Query Frame = 3
Query:  120 LYEDPNFPAS-YDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKS-SPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENG-IIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLL----DISKCS----VLFHMFNRNSIIALAKKQLYWKYVSFDHFW-HRDGPRRGPKVIGQEFLKNNQY----LIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNT-QIGIELFEVEKNRLYRVHDLNHTKQVTCQTD-FQQGRYIVITAYLERGRYVVIP 1526
            L+EDP FPA+   I + KP K    + I+W RP ++   P L+  N         G L   W     + L +R+ +F  VVP      +F +          +Y G F F F R G+   V+IDDRLPT V+  L+ +SS + +E    L+EKAYAK  G Y  L+  +   A+ DFTG L E    +  +K +   I +   K + M   S   C I+  P+  +   A      H Y +TG   +  D                    V ++R+ +   D E NG   DK  +  W++     ++K         E W+ ++  +    ++  C+    V+  +     I  + K+   W   S D  W  R G   G       F  N QY        P     C  ++    QKY     N +    +  QIG+ ++++         ++  T      T  F   R  V+   +  G YV++P
Sbjct:  157 LFEDPQFPANNSSIYYKKPPK----SHIVWLRPAKIFANPRLI-VNGKSRFDVRQGSLGNCWFLAAAATLAQRDELFYRVVPP---DQSFTE----------NYAGIFHFQFWRYGEWVDVVIDDRLPT-VNGKLIYMSSQDGDECWGPLLEKAYAKLYGTYEHLDGGTTTEALEDFTGGLTEFYDLTSTDKTM---ILAMIMKGMQMG--SLFACSIDPDPREKEAQLANGLVRGHAYSVTGVHTVETDKEK-----------------VALLRIRNPWGDTEWNGDWSDKSSL--WEQVDQEQREKMEFRIKEDGEFWMCLDDFMAQFANLDCCNLSADVMHEITEMTEIEVMEKQSKQWIQKSADGEWCSRKGTAGGCSNNENTFCTNPQYETYFRATSPSSNDKCT-VIAAVFQKYRR---NQLHRGLDMLQIGLSVYKMSGPNEKVTAEMMKTHAPIASTKLFVDYREAVVRFTVPPGYYVIVP 598          
BLAST of Calpain-5 vs. Ensembl Celegans
Match: clp-4 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q8IAA9])

HSP 1 Score: 95.5153 bits (236), Expect = 4.495e-20
Identity = 104/371 (28.03%), Postives = 153/371 (41.24%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFH--PGKLSPFW-LPILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGE--SICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPY---HVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLL----DISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWH 1196
            L+EDP FPA+   L+ +       + IIW+RPG++   P L+       +RF    G L   W L  L ++     +F  +VP   NQ+            + +Y G F F F   GK   V++DDRLPT V+  L  + S +N EF  AL+EKAYAK  GGY  L+  +   A+ DFTG L E   + KS    VL+         V  M   S   C I+    +N K +   +     H Y IT    I     D  +  L N + N +               E NG       + W K     KK+  ++     E W++ E        +  C++   +F+   I  +       + V  +H WH
Sbjct:  240 LFEDPEFPATAASLYYRTPPR---DRIIWKRPGEIIANPQLI---TQGESRFDVKQGALGDCWFLAALANITLYDALFYRIVP--PNQS-----------FTENYAGIFHFQFWHYGKWVDVVVDDRLPT-VNNQLYYLHSADNTEFWSALVEKAYAKLHGGYENLDGGTTAEALEDFTGGLTEYFDLRKSEKAAVLA-------ALVKGMEMGSLFGCSID--ADANIKEAQLRNGLVCGHAYSITAIHSITYYGEDTTLLRLRNPWGNEK---------------EWNGAWSDGSSE-WSKIDEATKKQIDVQFARDGEFWMSFEDFFSNFTQMEVCNLTAEIFDE--IAEMTGVNRATETVEEEHQWH 563          
BLAST of Calpain-5 vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 95.9005 bits (237), Expect = 4.760e-20
Identity = 129/508 (25.39%), Postives = 213/508 (41.93%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILF--SKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFH--PGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQS-NKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLL----DISKCSVLFHMFNR-NSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVP------QPETCCIKMVLTNVQKY-----------VEVGANAIQTAGNT--QIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLE 1502
            +F +L+ + L       L+EDP F A+   LF   +P K      + W RPG++++ P L+    +  +RF    G+L   WL    + L  ++ +F  VVP      +F +          +Y G F F F + GK   V+IDDRLPT+ +  LL + S +N EF  AL+EKAYAK  G Y  L+  +   A+ D TG L E I    D K    ++     +   M    FG C IE  P     K S      H Y ITG   +  D P+G              + +  IR    ++ E NG       + W+     VK+  GL+ ++  E W++ +  +     +  C++   + +    +  +    + W   + D  W R+    G +     F  N Q+ + +         E C +  +   +QKY           V +G  A+  AGN   ++  + F   K+ +     +N  +++T +     G Y+V+ +  E
Sbjct:  281 DFYELRDQCLESK---RLFEDPQFLANDSSLFFSKRPPKR-----VEWLRPGEITREPQLI---TEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPP---DQSFTE----------NYAGIFHFQFWQYGKWVDVVIDDRLPTS-NGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFI----DLKNPPRNLMQMMMRGFEMGS-LFG-CSIEADPNVWEAKMSNGLVKGHAYSITGCRIV--DGPNGQ-------------TCILRIRNPWGNEQEWNGPWSDN-SREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTV--IFAVLQKYRRNLKQDGLDNVPIGF-AVYDAGNNRGRLSKQFFAANKSAMRSAAFIN-LREMTGRFRVPPGNYVVVPSTFE 737          
BLAST of Calpain-5 vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086530)

HSP 1 Score: 102.064 bits (253), Expect = 3.878e-22
Identity = 127/496 (25.60%), Postives = 205/496 (41.33%), Query Frame = 3
Query:  117 ALYEDPNFPASYDIL-FSK-PNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARF--HPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKS-SPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS--LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLY----------WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPE--------TCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP 1526
            +L+EDP FPAS + L FS+ P++      I W RP ++++ P   +F  +  +RF    G+L   WL     +L +E N+F  V+P    + +F +          +Y G F F F + GK   VIIDDRLPT  +  L+ + S    EF  AL+EKAYAK  G Y  L+  S   A+ DFTG     + +  D K    ++ +  QK     + S   C IE  P   +  + +     H Y IT    I +  P+             R   +P+IR+ +   ++ E NG       + W+      K + GL  +   E W++ +  L+          F+R  I  L+   L           W+   ++  W       G +     F  N QY+I +  P+        T  + ++  N +    +G   + T G     +   E+E NR   ++   +   V     F   R +     L  G Y+++P
Sbjct:   87 SLFEDPLFPASNESLQFSRRPDRH-----IEWLRPHEIAENP---QFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA---EQSFEE----------NYAGIFHFRFWQYGKWVDVIIDDRLPT-YNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTG----GVSEWYDLKEAPGNLFTILQKAAE--RNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPN-------------RQGKIPMIRMRNPWGNEAEWNGPWSDSSPE-WRYIPEEQKAEIGLTFDRDGEFWMSFQDFLN---------HFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECL-TIGFAIYSLNDRELE-NRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVP 529          
BLAST of Calpain-5 vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0340532)

HSP 1 Score: 101.293 bits (251), Expect = 1.513e-21
Identity = 127/496 (25.60%), Postives = 205/496 (41.33%), Query Frame = 3
Query:  117 ALYEDPNFPASYDIL-FSK-PNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARF--HPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKS-SPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS--LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLY----------WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPE--------TCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP 1526
            +L+EDP FPAS + L FS+ P++      I W RP ++++ P   +F  +  +RF    G+L   WL     +L +E N+F  V+P    + +F +          +Y G F F F + GK   VIIDDRLPT  +  L+ + S    EF  AL+EKAYAK  G Y  L+  S   A+ DFTG     + +  D K    ++ +  QK     + S   C IE  P   +  + +     H Y IT    I +  P+             R   +P+IR+ +   ++ E NG       + W+      K + GL  +   E W++ +  L         + F+R  I  L+   L           W+   ++  W       G +     F  N QY+I +  P+        T  + ++  N +    +G   + T G     +   E+E NR   ++   +   V     F   R +     L  G Y+++P
Sbjct:  102 SLFEDPLFPASNESLQFSRRPDRH-----IEWLRPHEIAENP---QFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA---EQSFEE----------NYAGIFHFRFWQYGKWVDVIIDDRLPT-YNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTG----GVSEWYDLKEAPGNLFTILQKAAE--RNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPN-------------RQGKIPMIRMRNPWGNEAEWNGPWSDSSPE-WRYIPEEQKAEIGLTFDRDGEFWMSFQDFL---------NHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECL-TIGFAIYSLNDRELE-NRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVP 544          
BLAST of Calpain-5 vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0112869)

HSP 1 Score: 100.908 bits (250), Expect = 1.524e-21
Identity = 127/496 (25.60%), Postives = 205/496 (41.33%), Query Frame = 3
Query:  117 ALYEDPNFPASYDIL-FSK-PNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARF--HPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKS-SPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS--LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLY----------WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPE--------TCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP 1526
            +L+EDP FPAS + L FS+ P++      I W RP ++++ P   +F  +  +RF    G+L   WL     +L +E N+F  V+P    + +F +          +Y G F F F + GK   VIIDDRLPT  +  L+ + S    EF  AL+EKAYAK  G Y  L+  S   A+ DFTG     + +  D K    ++ +  QK     + S   C IE  P   +  + +     H Y IT    I +  P+             R   +P+IR+ +   ++ E NG       + W+      K + GL  +   E W++ +  L         + F+R  I  L+   L           W+   ++  W       G +     F  N QY+I +  P+        T  + ++  N +    +G   + T G     +   E+E NR   ++   +   V     F   R +     L  G Y+++P
Sbjct:   87 SLFEDPLFPASNESLQFSRRPDRH-----IEWLRPHEIAENP---QFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA---EQSFEE----------NYAGIFHFRFWQYGKWVDVIIDDRLPT-YNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTG----GVSEWYDLKEAPGNLFTILQKAAE--RNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPN-------------RQGKIPMIRMRNPWGNEAEWNGPWSDSSPE-WRYIPEEQKAEIGLTFDRDGEFWMSFQDFL---------NHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECL-TIGFAIYSLNDRELE-NRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVP 529          
BLAST of Calpain-5 vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086529)

HSP 1 Score: 100.908 bits (250), Expect = 1.524e-21
Identity = 127/496 (25.60%), Postives = 205/496 (41.33%), Query Frame = 3
Query:  117 ALYEDPNFPASYDIL-FSK-PNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARF--HPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKS-SPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS--LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLY----------WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPE--------TCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP 1526
            +L+EDP FPAS + L FS+ P++      I W RP ++++ P   +F  +  +RF    G+L   WL     +L +E N+F  V+P    + +F +          +Y G F F F + GK   VIIDDRLPT  +  L+ + S    EF  AL+EKAYAK  G Y  L+  S   A+ DFTG     + +  D K    ++ +  QK     + S   C IE  P   +  + +     H Y IT    I +  P+             R   +P+IR+ +   ++ E NG       + W+      K + GL  +   E W++ +  L         + F+R  I  L+   L           W+   ++  W       G +     F  N QY+I +  P+        T  + ++  N +    +G   + T G     +   E+E NR   ++   +   V     F   R +     L  G Y+++P
Sbjct:   87 SLFEDPLFPASNESLQFSRRPDRH-----IEWLRPHEIAENP---QFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA---EQSFEE----------NYAGIFHFRFWQYGKWVDVIIDDRLPT-YNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTG----GVSEWYDLKEAPGNLFTILQKAAE--RNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPN-------------RQGKIPMIRMRNPWGNEAEWNGPWSDSSPE-WRYIPEEQKAEIGLTFDRDGEFWMSFQDFL---------NHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECL-TIGFAIYSLNDRELE-NRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVP 529          
BLAST of Calpain-5 vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0076343)

HSP 1 Score: 93.2041 bits (230), Expect = 4.634e-19
Identity = 125/536 (23.32%), Postives = 220/536 (41.04%), Query Frame = 3
Query:   30 KMSDAVESQMSSPNFLKLKSELLRHPDGVALYEDPNFPAS-YDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARF--HPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKS-SPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSL--SDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLY----------WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPE--------TCCIKMVLTNVQKYVEVGANAIQ--------TAGNTQI---GIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYL---ERGRYVV 1520
            K + A ++ +S  +F  L+   L +     ++EDP+FPA+   +++S+    +      W RPG ++  P   +F  +  +RF    G+L   WL     +L ++  +F  V+P       F +          +Y G F F F + GK   V+IDDRLPT  +  L+ + S    EF  AL+EKAYAK  G Y  L+  +   A+ DFTG     + +  D K    ++ S   K     + S   C +E  P   +  + +     H Y IT    + +  P            N +G L P+IR+ +   +D E +G       + W+      K++ GL  +   E W++ +  L+          F+R  I  L+   L           W+   F+  W       G +   + F  N QY+I +  P+        T  + ++  N +    VG + +         T  + Q+   G+  F+   +     H +N T++V  +     G Y+++ +     E G +++
Sbjct:  232 KATSARQNSVSKGDFQSLRDSCLAN---GTMFEDPDFPATNASLMYSRRPDRYYE----WLRPGDIADDP---QFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPP---DQDFQE----------NYAGIFHFKFWQYGKWVEVVIDDRLPT-YNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTG----GVTEWYDIKEAPPNLFSIMMKAAE--RGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTP------------NRQGKL-PMIRMRNPWGNDAEWSGPWSDSSPE-WRFIPEHTKEEIGLNFDRDGEFWMSFQDFLN---------HFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFIN-TREVCARFKLPPGHYLIVPSTFDPNEEGEFII 713          
BLAST of Calpain-5 vs. Ensembl Zebrafish
Match: BX324225.2 (calpain 5b [Source:NCBI gene;Acc:100006332])

HSP 1 Score: 144.05 bits (362), Expect = 2.800e-35
Identity = 159/628 (25.32%), Postives = 262/628 (41.72%), Query Frame = 3
Query:  117 ALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITS---FYQKVVNM-TKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW-HRDGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            AL+EDP FPA  D LF + N+      + W+RP +L   P L  F +  SA   H G+L   W     S L  R ++++ V+P+   Q    ++       + SY G F F F R G+   V+IDDRLPT V   L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +   + E   ++  T+    +++V+ +  ++    C I      + ++         H Y +T   ++ L       + LL YF + +   + +IR+ +    +E         + W+K +   ++K G+   +  E W+  E         +L  + N  S +++ K    W+       W HRD P   R    I  +  FL+N QY+  V + E      VL  +Q+             N  IG ++  VE NR YR+H     +Q    + +   R + +   L+ GRYV+IP     G   ++ L+VF+            D+P    C    + +                                P  C      YP+  T++ V+ A  ++        + +  I+CE E   S +   T  P +D   +FYR
Sbjct:   25 ALFEDPLFPAVDDSLFYQGNR---IGRVHWKRPEELCDDPHL--FVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEK-------ADSYAGIFHFRFWRFGEWVDVVIDDRLPT-VDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPM--DLLEGQFAQDETARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRLG------HGLLAYFKSEK---LHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFEDFCHYFTDLILCRLIN-TSYLSIHKT---WEEEVMRGLWLHRDEPLRNRAGGCINHKTTFLQNPQYVFDVRKVE----DEVLICLQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHS---AQQKVAGSIYINSRCVFLRKELKEGRYVIIPTTFDPGQQGEFLLRVFT------------DVPSD--CKELTLDEP-------------------------------PQTCWTGMCGYPQLVTQVHVLSAEGLQGQDANGASDPYVIITCEGEKVRSPVHKDTRCPNFDIKGIFYR 572          
BLAST of Calpain-5 vs. Ensembl Zebrafish
Match: capn5b (calpain 5b [Source:ZFIN;Acc:ZDB-GENE-091116-29])

HSP 1 Score: 143.665 bits (361), Expect = 3.041e-35
Identity = 159/628 (25.32%), Postives = 262/628 (41.72%), Query Frame = 3
Query:  117 ALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITS---FYQKVVNM-TKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW-HRDGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            AL+EDP FPA  D LF + N+      + W+RP +L   P L  F +  SA   H G+L   W     S L  R ++++ V+P+   Q    ++       + SY G F F F R G+   V+IDDRLPT V   L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +   + E   ++  T+    +++V+ +  ++    C I      + ++         H Y +T   ++ L       + LL YF + +   + +IR+ +    +E         + W+K +   ++K G+   +  E W+  E         +L  + N  S +++ K    W+       W HRD P   R    I  +  FL+N QY+  V + E      VL  +Q+             N  IG ++  VE NR YR+H     +Q    + +   R + +   L+ GRYV+IP     G   ++ L+VF+            D+P    C    + +                                P  C      YP+  T++ V+ A  ++        + +  I+CE E   S +   T  P +D   +FYR
Sbjct:   25 ALFEDPLFPAVDDSLFYQGNR---IGRVHWKRPEELCDDPHL--FVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEK-------ADSYAGIFHFRFWRFGEWVDVVIDDRLPT-VDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPM--DLLEGQFAQDETARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRLG------HGLLAYFKSEK---LHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFEDFCHYFTDLILCRLIN-TSYLSIHKT---WEEEVMRGLWLHRDEPLRNRAGGCINHKTTFLQNPQYVFDVRKVE----DEVLICLQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHS---AQQKVAGSIYINSRCVFLRKELKEGRYVIIPTTFDPGQQGEFLLRVFT------------DVPSD--CKELTLDEP-------------------------------PQTCWTGMCGYPQLVTQVHVLSAEGLQGQDANGASDPYVIITCEGEKVRSPVHKDTRCPNFDIKGIFYR 572          
BLAST of Calpain-5 vs. Ensembl Zebrafish
Match: capn5a (calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214])

HSP 1 Score: 136.346 bits (342), Expect = 8.289e-33
Identity = 165/646 (25.54%), Postives = 265/646 (41.02%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI----CKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEVNIQLFCENKL 2012
            L+EDP F A    LF + N+      + W+RP  L + P L  F N  SA   + G+L   W     S L  R  +++ V+P+  +Q     +P        SY G F F F R G    V+IDDRLPT  +  L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +     K   ++     +     KV N  +     C I    Q++ ++         H Y +T   ++ L       + LL +F + + S+   IR+ +     E NG       + W++ +   +++ G+   +  E W+  +         +L  + N  S +++ K    W+       W R D P   R    I  +  FL+N QY+  V + E      VL  +Q+       A     N  IG ++  VE NR+YR+H +   ++    + +   R + +   L+ GRYV++P     G    + L++F +D   +   L  D P Q   T C                                       C      YPK  T++ VI A  ++        + +  ISCE E   S +   T SP +D   +FYR       + IQ++ +N L
Sbjct:   26 LFEDPVFRAEDQSLFLQGNR---LGKVTWKRPKDLCEDPHL--FVNGISAHDLNQGQLGNCWFVAACSSLASREALWQKVIPDWKDQEWDKNKP-------ESYAGIFHFRFWRFGDWVDVVIDDRLPT-ANGKLIYCHSNDSNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPMDLLEGKFAQDEEARHQLFDRVLKVHN--RGGLISCSIRATTQADMEARLDCGLVKGHAYAVTDVRKVRLG------SGLLAFFKSEKLSM---IRMRNPWGQREWNGAWSDS-SEEWKRVSKGERERLGVTVEDDGEFWMDFDDFCKHFTDLILCRLIN-TSYLSIHKT---WEEEVMRGCWSRHDDPLRNRSGGCINHKTTFLQNPQYVFDVTKAE----DEVLICLQQQ---DKRARAKGENMAIGFDIQRVELNRIYRMHSI---QKSVGSSIYINSRSVFLRKDLKEGRYVIVPSTFDPGMPGDFLLRIF-TDVPSDCKELTVDEPPQTCWTSC---------------------------------------CG-----YPKLVTQVHVIRADGLKALDGDGSSDPYIIISCEGEKVCSPVHKDTQSPDFDVKAVFYR-KKPKQPIRIQIYNKNLL 586          
BLAST of Calpain-5 vs. Ensembl Zebrafish
Match: capn5a (calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214])

HSP 1 Score: 136.346 bits (342), Expect = 8.289e-33
Identity = 165/646 (25.54%), Postives = 265/646 (41.02%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI----CKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEVNIQLFCENKL 2012
            L+EDP F A    LF + N+      + W+RP  L + P L  F N  SA   + G+L   W     S L  R  +++ V+P+  +Q     +P        SY G F F F R G    V+IDDRLPT  +  L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +     K   ++     +     KV N  +     C I    Q++ ++         H Y +T   ++ L       + LL +F + + S+   IR+ +     E NG       + W++ +   +++ G+   +  E W+  +         +L  + N  S +++ K    W+       W R D P   R    I  +  FL+N QY+  V + E      VL  +Q+       A     N  IG ++  VE NR+YR+H +   ++    + +   R + +   L+ GRYV++P     G    + L++F +D   +   L  D P Q   T C                                       C      YPK  T++ VI A  ++        + +  ISCE E   S +   T SP +D   +FYR       + IQ++ +N L
Sbjct:   26 LFEDPVFRAEDQSLFLQGNR---LGKVTWKRPKDLCEDPHL--FVNGISAHDLNQGQLGNCWFVAACSSLASREALWQKVIPDWKDQEWDKNKP-------ESYAGIFHFRFWRFGDWVDVVIDDRLPT-ANGKLIYCHSNDSNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPMDLLEGKFAQDEEARHQLFDRVLKVHN--RGGLISCSIRATTQADMEARLDCGLVKGHAYAVTDVRKVRLG------SGLLAFFKSEKLSM---IRMRNPWGQREWNGAWSDS-SEEWKRVSKGERERLGVTVEDDGEFWMDFDDFCKHFTDLILCRLIN-TSYLSIHKT---WEEEVMRGCWSRHDDPLRNRSGGCINHKTTFLQNPQYVFDVTKAE----DEVLICLQQQ---DKRARAKGENMAIGFDIQRVELNRIYRMHSI---QKSVGSSIYINSRSVFLRKDLKEGRYVIVPSTFDPGMPGDFLLRIF-TDVPSDCKELTVDEPPQTCWTSC---------------------------------------CG-----YPKLVTQVHVIRADGLKALDGDGSSDPYIIISCEGEKVCSPVHKDTQSPDFDVKAVFYR-KKPKQPIRIQIYNKNLL 586          
BLAST of Calpain-5 vs. Ensembl Zebrafish
Match: BX324225.2 (calpain 5b [Source:NCBI gene;Acc:100006332])

HSP 1 Score: 132.88 bits (333), Expect = 1.072e-31
Identity = 156/653 (23.89%), Postives = 261/653 (39.97%), Query Frame = 3
Query:  117 ALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQ--------------------------SARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITS---FYQKVVNM-TKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW-HRDGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            AL+EDP FPA  D LF + N+      + W+RP   S +P    +N  +                          +   H G+L   W     S L  R ++++ V+P+   Q    ++       + SY G F F F R G+   V+IDDRLPT V   L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +   + E   ++  T+    +++V+ +  ++    C I      + ++         H Y +T   ++ L       + LL YF + +   + +IR+ +    +E         + W+K +   ++K G+   +  E W+  E         +L  + N  S +++ K    W+       W HRD P   R    I  +  FL+N QY+  V + E      VL  +Q+             N  IG ++  VE NR YR+H     +Q    + +   R + +   L+ GRYV+IP     G   ++ L+VF+            D+P    C    + +                                P  C      YP+  T++ V+ A  ++        + +  I+CE E   S +   T  P +D   +FYR
Sbjct:   25 ALFEDPLFPAVDDSLFYQGNR---IGRVHWKRPEVSSIMPFSRSWNEARRRISFTDKHTSAELCDDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEK-------ADSYAGIFHFRFWRFGEWVDVVIDDRLPT-VDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPM--DLLEGQFAQDETARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRLG------HGLLAYFKSEK---LHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFEDFCHYFTDLILCRLIN-TSYLSIHKT---WEEEVMRGLWLHRDEPLRNRAGGCINHKTTFLQNPQYVFDVRKVE----DEVLICLQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHS---AQQKVAGSIYINSRCVFLRKELKEGRYVIIPTTFDPGQQGEFLLRVFT------------DVPSD--CKELTLDEP-------------------------------PQTCWTGMCGYPQLVTQVHVLSAEGLQGQDANGASDPYVIITCEGEKVRSPVHKDTRCPNFDIKGIFYR 599          
BLAST of Calpain-5 vs. Ensembl Xenopus
Match: ppa2 (pyrophosphatase (inorganic) 2 [Source:Xenbase;Acc:XB-GENE-961143])

HSP 1 Score: 139.428 bits (350), Expect = 5.523e-34
Identity = 142/527 (26.94%), Postives = 228/527 (43.26%), Query Frame = 3
Query:   48 ESQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLK-ERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI-CKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVE----KLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGP----RRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDN 1583
            + Q+ + N+ +LK E +++     L+EDP FPAS + LF     +     I W+RP +L + P L   +   S   H G+L   W     S L  ++ ++  V+ N   Q    + P         Y G F F F   G    V+IDDRLP+ V  +L+   SN   EF  AL+EKAYAK  G Y  L+  +   AI+DFTG + ES      D +      T  +Q+++ + +   G+    + P S+    A +S      H Y +T   ++P       V   +  F NS  + + +IR+ +     E         + W K +   K   GL   +  E W+T E           C +L       S ++  K    WK       W ++      R G       F +N QY+  V + E      VL ++Q+  +          N  IG E+F+VE NR YR+H ++  ++ T ++ +   R I +   L  GRYV+IP     G  + + L++F+ ++
Sbjct:    5 DKQLKTQNYHELKKECIKNG---KLFEDPEFPASDESLFYSKAPDL---RIEWKRPKELCEDPHLF-VDGISSHDLHQGRLGNCWFVAACSCLALKKALWTKVISNWKKQEWDPKRP-------HRYAGIFHFKFWCLGDWVDVVIDDRLPS-VDGNLVYCHSNVKNEFWSALLEKAYAKLAGSYEALDGGNTADAIVDFTGAVTESFELDKGDYRTSLMEQTKLFQELLKVYRAG-GLISCYIKPVSSNDMEAVTSYGLVKGHAYSVTAIKKMP-------VGQRILCFGNS--NKLFMIRMRNPWGKREWKGAWSDESEEWNKVSRSEKATLGLTVADDGEFWMTFEDWCLSFTHADVCRIL-----NTSYLSCYKT---WKQEEVHGAWSKNTDPLLNRSGGCFNETTFFQNPQYIFEVRKKED----EVLISLQQKDQRIHKKDGKGNNFIIGFEIFKVELNREYRIHKIS-GQEKTLRSSYINLRAIFLRKVLTHGRYVIIPTTFHPGISSSFILRLFTDES 493          
BLAST of Calpain-5 vs. Ensembl Xenopus
Match: ppa2 (pyrophosphatase (inorganic) 2 [Source:Xenbase;Acc:XB-GENE-961143])

HSP 1 Score: 135.576 bits (340), Expect = 1.450e-32
Identity = 136/527 (25.81%), Postives = 220/527 (41.75%), Query Frame = 3
Query:   48 ESQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLK-ERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI-CKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVE----KLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGP----RRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDN 1583
            + Q+ + N+ +LK E +++     L+EDP FPAS + LF     +     I W+RP +L + P L   +   S   H G+L   W     S L  ++ ++  V+ N   Q    + P         Y G F F F   G    V+IDDRLP+ V  +L+   SN   EF  AL+EKAYAK  G Y  L+  +   AI+DFTG + ES      D +      T  +Q+++ + +   G+    + P S+    A +S      H Y +T   ++P+                         R++               + +W K +   K   GL   +  E W+T E           C +L       S ++  K    WK       W ++      R G       F +N QY+  V + E      VL ++Q+  +          N  IG E+F+VE NR YR+H ++  ++ T ++ +   R I +   L  GRYV+IP     G  + + L++F+ ++
Sbjct:    5 DKQLKTQNYHELKKECIKNG---KLFEDPEFPASDESLFYSKAPDL---RIEWKRPKELCEDPHLF-VDGISSHDLHQGRLGNCWFVAACSCLALKKALWTKVISNWKKQEWDPKRPH-------RYAGIFHFKFWCLGDWVDVVIDDRLPS-VDGNLVYCHSNVKNEFWSALLEKAYAKLAGSYEALDGGNTADAIVDFTGAVTESFELDKGDYRTSLMEQTKLFQELLKVYRAG-GLISCYIKPVSSNDMEAVTSYGLVKGHAYSVTAIKKMPVGQ-----------------------RILCFG------------MTSWNKVSRSEKATLGLTVADDGEFWMTFEDWCLSFTHADVCRIL-----NTSYLSCYKT---WKQEEVHGAWSKNTDPLLNRSGGCFNETTFFQNPQYIFEVRKKE----DEVLISLQQKDQRIHKKDGKGNNFIIGFEIFKVELNREYRIHKIS-GQEKTLRSSYINLRAIFLRKVLTHGRYVIIPTTFHPGISSSFILRLFTDES 467          
BLAST of Calpain-5 vs. Ensembl Xenopus
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:Xenbase;Acc:XB-GENE-976857])

HSP 1 Score: 115.161 bits (287), Expect = 4.037e-26
Identity = 134/550 (24.36%), Postives = 230/550 (41.82%), Query Frame = 3
Query:  342 FELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLS-EHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRD---GPRRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            F +V+P+   Q  +  +P I       Y G F F F + G+   V+IDDRLPT ++  L+   SN   E   AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +    V   E     +++V+ +      I C I     S+ ++         H Y +T   ++ L       + LL +F + +   + +IR+ +   + E NG       + WQK +   ++K G+   +  E W+T E         ++  + N  S +++ K    W+       W  H+D       G       +L+N Q++  V +PE      VL  +Q+  +        A N  IG E+ +VE NR +R+H L   +     + +   R + +   L+ GRYV+IP     G   ++ L+VF+            D+P    C  C++K              D  T            T    +C      YP+  +++ V+ A  ++   +    + +  ISCE     S ++   L P+++   +FYR
Sbjct:   10 FIVVIPDWKEQEWYADKPQI-------YAGIFHFHFWKFGEWVDVVIDDRLPT-INNQLIYCHSNEKNELWCALVEKAYAKLAGCYEALDGGNTADALVDFTGGVSEPIELTEGHFVTDVEKRNDLFERVLKVHNRGGLISCSIRATSASDMEARMACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LEMIRMRNPWGEREWNGPWSDSS-EEWQKVSKSEREKLGVTVEDDGEFWMTFEDFCKYYTDIIMCRLIN-TSYLSIHKT---WEEAVLRSSWVQHQDPLQNRSGGCLNFKATYLQNPQFVFDVKKPE----DEVLVCLQQKTKRTTRQEGKAENLAIGFEIHQVELNRRFRMHTL---QPKVASSIYINSRCVFLRTDLKEGRYVIIPTTFDPGHTGEFLLRVFT------------DLPSN--C--CELK-------------LDEPT-----------KTCWSGLCG-----YPQLVSQVHVVSAQGLKQQDSNGGADPYVIISCEGNKVQSPVIKDCLDPKFNVKGVFYR 485          
BLAST of Calpain-5 vs. Ensembl Xenopus
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:Xenbase;Acc:XB-GENE-976857])

HSP 1 Score: 111.694 bits (278), Expect = 8.628e-25
Identity = 133/547 (24.31%), Postives = 228/547 (41.68%), Query Frame = 3
Query:  351 VVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLS-EHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRDGPRR---GPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            V+P+   Q  +  +P I       Y G F F F + G+   V+IDDRLPT ++  L+   SN   E   AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +    V   E     +++V+ +      I C I     S+ ++         H Y +T   ++ L       + LL +F + +   + +IR+ +   + E NG       + WQK +   ++K G+   +  E W+T E         ++  + N  S +++ K    W+       W  H+D  +    G       +L+N Q++  V +PE      VL  +Q+  +        A N  IG E+ +VE NR +R+H L   +     + +   R + +   L+ GRYV+IP     G   ++ L+VF+            D+P    C  C++K              D  T            T    +C      YP+  +++ V+ A  ++   +     +   ISCE     S ++   L P+++   +FYR
Sbjct:   70 VIPDWKEQEWYADKPQI-------YAGIFHFHFWKFGEWVDVVIDDRLPT-INNQLIYCHSNEKNELWCALVEKAYAKLAGCYEALDGGNTADALVDFTGGVSEPIELTEGHFVTDVEKRNDLFERVLKVHNRGGLISCSIRATSASDMEARMACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LEMIRMRNPWGEREWNGPWSDSS-EEWQKVSKSEREKLGVTVEDDGEFWMTFEDFCKYYTDIIMCRLIN-TSYLSIHKT---WEEAVLRSSWVQHQDPLQNRSGGCLNFKATYLQNPQFVFDVKKPE----DEVLVCLQQKTKRTTRQEGKAENLAIGFEIHQVELNRRFRMHTL---QPKVASSIYINSRCVFLRTDLKEGRYVIIPTTFDPGHTGEFLLRVFT------------DLPSN--C--CELK-------------LDEPT-----------KTCWSGLCG-----YPQLVSQVHVVSAQGLKQQDSNGADPYVI-ISCEGNKVQSPVIKDCLDPKFNVKGVFYR 541          
BLAST of Calpain-5 vs. Ensembl Xenopus
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:Xenbase;Acc:XB-GENE-976857])

HSP 1 Score: 110.923 bits (276), Expect = 1.045e-24
Identity = 133/547 (24.31%), Postives = 227/547 (41.50%), Query Frame = 3
Query:  351 VVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLS-EHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRD---GPRRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            V+P+   Q  +  +P I       Y G F F F + G+   V+IDDRLPT ++  L+   SN   E   AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +    V   E     +++V+ +      I C I     S+ ++         H Y +T   ++ L       + LL +F + +   + +IR+ +   + E NG       + WQK +   ++K G+   +  E W+T E         ++  + N  S +++ K    W+       W  H+D       G       +L+N Q++  V +PE      VL  +Q+  +        A N  IG E+ +VE NR +R+H L   +     + +   R + +   L+ GRYV+IP     G   ++ L+VF+            D+P    C  C++K              D  T            T    +C      YP+  +++ V+ A  ++   +     +   ISCE     S ++   L P+++   +FYR
Sbjct:   38 VIPDWKEQEWYADKPQI-------YAGIFHFHFWKFGEWVDVVIDDRLPT-INNQLIYCHSNEKNELWCALVEKAYAKLAGCYEALDGGNTADALVDFTGGVSEPIELTEGHFVTDVEKRNDLFERVLKVHNRGGLISCSIRATSASDMEARMACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LEMIRMRNPWGEREWNGPWSDSS-EEWQKVSKSEREKLGVTVEDDGEFWMTFEDFCKYYTDIIMCRLIN-TSYLSIHKT---WEEAVLRSSWVQHQDPLQNRSGGCLNFKATYLQNPQFVFDVKKPE----DEVLVCLQQKTKRTTRQEGKAENLAIGFEIHQVELNRRFRMHTL---QPKVASSIYINSRCVFLRTDLKEGRYVIIPTTFDPGHTGEFLLRVFT------------DLPSN--C--CELK-------------LDEPT-----------KTCWSGLCG-----YPQLVSQVHVVSAQGLKQQDSNGADPYVI-ISCEGNKVQSPVIKDCLDPKFNVKGVFYR 509          
BLAST of Calpain-5 vs. Ensembl Mouse
Match: Capn5 (calpain 5 [Source:MGI Symbol;Acc:MGI:1100859])

HSP 1 Score: 160.614 bits (405), Expect = 9.380e-41
Identity = 163/646 (25.23%), Postives = 272/646 (42.11%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSE-HITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  LK   LR      L+EDP FPA+ D L+ K         + W+RP  +   P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        SY G F F F R G+   VI+DDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +  +    E      +++V+ +     G+    +   +     A+ +      H Y +T   ++ L       + LL +F + +   + +IRL +     E         + WQK +   ++K G+   +  E W+T E +     DI KC ++       S +++ K    W+       W R + P+  R    I  +  F +N QY+  V +PE      VL ++Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +   L  GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP++  ++ V+GA  ++ + T    N +  I CE E   S +   T +P+++   +FYR
Sbjct:   12 NYSALKRACLRKK---VLFEDPLFPATDDSLYYKGTP---GPTVRWKRPKDICDDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKP-------DSYAGIFHFNFWRFGEWVDVIVDDRLPT-VNNQLIYCHSNSKNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVHSRG-GLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLI-----NTSYLSIHKT---WEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPE----DEVLISIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTELPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRTCWSSLCGYPQQVAQVHVLGAAGLKDSPTG--ANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. Ensembl Mouse
Match: Capn5 (calpain 5 [Source:MGI Symbol;Acc:MGI:1100859])

HSP 1 Score: 160.614 bits (405), Expect = 9.380e-41
Identity = 163/646 (25.23%), Postives = 272/646 (42.11%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSE-HITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  LK   LR      L+EDP FPA+ D L+ K         + W+RP  +   P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        SY G F F F R G+   VI+DDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +  +    E      +++V+ +     G+    +   +     A+ +      H Y +T   ++ L       + LL +F + +   + +IRL +     E         + WQK +   ++K G+   +  E W+T E +     DI KC ++       S +++ K    W+       W R + P+  R    I  +  F +N QY+  V +PE      VL ++Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +   L  GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP++  ++ V+GA  ++ + T    N +  I CE E   S +   T +P+++   +FYR
Sbjct:   12 NYSALKRACLRKK---VLFEDPLFPATDDSLYYKGTP---GPTVRWKRPKDICDDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKP-------DSYAGIFHFNFWRFGEWVDVIVDDRLPT-VNNQLIYCHSNSKNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVHSRG-GLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLI-----NTSYLSIHKT---WEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPE----DEVLISIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTELPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRTCWSSLCGYPQQVAQVHVLGAAGLKDSPTG--ANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. Ensembl Mouse
Match: Capn6 (calpain 6 [Source:MGI Symbol;Acc:MGI:1100850])

HSP 1 Score: 138.658 bits (348), Expect = 1.690e-33
Identity = 168/665 (25.26%), Postives = 275/665 (41.35%), Query Frame = 3
Query:   72 FLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLK-ERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI--CKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFN--RN-SIIALAKKQLY-----WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQP-ETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWI-AAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEV----NIQLFCENKLG 2015
            + +LK E ++  DG  L+ DP F    D LF       +   ++W+RP  +S  P L+   N  + +   G+L    +    S L  + + +   +PN  +Q    ++P         Y G F F F   G+   V+IDD LPT     + S S++ NE F  AL+EKAYAK LG Y  L+  +    IMDFTG L E I   K     ++ E    F +     TK     C IE P Q  ++           L+ G+T    D     + + L   +++    + ++RL +    +E       + + WQ+ T   +K  GL  ++  E W+++E       C   FH  N  RN +     +K+L      W  V  D   +R G   G       FL+N QY+  VP+      + +   +++ Y  +G        N  IG ELF+VE NR +R+H L + ++    + +   R + ++ YL++G YV++P +   G  +++ L++F S+  V+   L  D+P+                                              C      YPK  T+I+V  A  +      +  N +  I C  E   S +  +T+   +D   +FYR   D   +    N + FC+  LG
Sbjct:   13 YQELKQECMK--DG-RLFCDPTFLPENDSLFFN---RLLPGKVVWKRPQDISDDPHLI-VGNISNHQLIQGRLGNKAMISAFSCLAVQESHWTKAIPNHKDQEWDPRKP-------EKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNE-FWNALLEKAYAKLLGCYEALDGLTITDIIMDFTGTLAEIIDMQKGRYTDLVEEKYKLFGELYKTFTKGGLICCSIESPSQEEQEVETDWG-----LLKGYTYTMTDIRKLRLGERLVEVFSTEK--LYMVRLRNPLGRQEWSGPWSEISEEWQQLTVTDRKNLGLVMSDDGEFWMSLEDF-----CHN-FHKLNVCRNVNNPVFGRKELESVVGCWT-VDDDPLMNRSG---GCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGR-----PDNYIIGFELFKVEMNRRFRLHHL-YIQERAGTSTYIDTRTVFLSKYLKKGSYVLVPTMFQHGRTSEFLLRIF-SEVPVQLRELTLDMPKMS--------------------------------------------CWNLARGYPKVVTQITVHSAEGLEKKYANETVNPYLIIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIIQVWNSRKFCDQFLG 594          
BLAST of Calpain-5 vs. Ensembl Mouse
Match: Capn9 (calpain 9 [Source:MGI Symbol;Acc:MGI:1920897])

HSP 1 Score: 85.1149 bits (209), Expect = 1.921e-16
Identity = 78/278 (28.06%), Postives = 118/278 (42.45%), Query Frame = 3
Query:   36 SDAVESQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILF--SKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKE-SFGICQIEL--PPQSNKKSSAKSSPYHVYLITGFTEI 851
             DA     S  +F +L+   L+      L+ED +FPAS   LF   +P   F+     W+RPG++ + P  +            G+L   WL   + SL   +     VVP                     Y G F F F +  +   V+IDDRLPT     L+ + S ++ EF  AL+EKAYAK  G Y  L+  S + A+ DFTG + E+         + E    F++ +    K  S   C I+     +S  ++S      H Y +TG  ++
Sbjct:   17 GDARTIHSSGQSFEQLRQGCLQSG---TLFEDADFPASNVSLFYSERPQVPFV-----WKRPGEIVEKPEFI-LGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQG-------------FGSGYAGIFHFQFWQHSEWLDVVIDDRLPT-FKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENF-------QIREAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQV 264          
BLAST of Calpain-5 vs. Ensembl Mouse
Match: Capn2 (calpain 2 [Source:MGI Symbol;Acc:MGI:88264])

HSP 1 Score: 83.9593 bits (206), Expect = 3.506e-16
Identity = 107/427 (25.06%), Postives = 161/427 (37.70%), Query Frame = 3
Query:   30 KMSDAVESQMSSPNFLKLKSELLRHP--DGVALYEDPNFPASYDILFSKPNKEFIS--NDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILIS--LLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSA--KSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLY------WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLI 1265
            + ++ + S   +  +L    E LR+   +  AL++DP+FPA    L  K    + S    I W+RP ++   P  +            G L   WL   I+   L E  +  +V P+ S Q               +Y G F F F + G+   V++DDRLPT     LL + S    EF  AL+EKAYAK  G Y  L   +      DFTG     I +  + +    ++    QK   + K S   C I++   ++ ++    K    H Y +TG  E+                  S GSL  +IR+ +     E  G  +     +W      V+        +G E W++    L           ++R  I  L    L       WK    D  W R     G +     F  N QYLI
Sbjct:   13 EAAEGLGSHERAIKYLNQDYETLRNECLEAGALFQDPSFPALPSSLGYKELGPYSSKTRGIEWKRPTEICADPQFI-IGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPPDQSFQE--------------NYAGIFHFQFWQYGEWVEVVVDDRLPTK-DGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTG----GIAEWYELRKPPPNLFKIIQKA--LEKGSLLGCSIDITSAADSEAVTYQKLVKGHAYSVTGAEEV-----------------ESSGSLQKLIRIRNPWGQVEWTGKWNDN-CPSWNTVDPEVRANLTERQEDG-EFWMSFSDFL---------RHYSRLEICNLTPDTLTCDSYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLI 389          
BLAST of Calpain-5 vs. UniProt/SwissProt
Match: sp|O08688|CAN5_MOUSE (Calpain-5 OS=Mus musculus OX=10090 GN=Capn5 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 6.561e-40
Identity = 163/646 (25.23%), Postives = 272/646 (42.11%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSE-HITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  LK   LR      L+EDP FPA+ D L+ K         + W+RP  +   P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        SY G F F F R G+   VI+DDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +  +    E      +++V+ +     G+    +   +     A+ +      H Y +T   ++ L       + LL +F + +   + +IRL +     E         + WQK +   ++K G+   +  E W+T E +     DI KC ++       S +++ K    W+       W R + P+  R    I  +  F +N QY+  V +PE      VL ++Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +   L  GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP++  ++ V+GA  ++ + T    N +  I CE E   S +   T +P+++   +FYR
Sbjct:   12 NYSALKRACLRKK---VLFEDPLFPATDDSLYYKGTP---GPTVRWKRPKDICDDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKP-------DSYAGIFHFNFWRFGEWVDVIVDDRLPT-VNNQLIYCHSNSKNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVHSRG-GLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLI-----NTSYLSIHKT---WEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPE----DEVLISIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTELPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRTCWSSLCGYPQQVAQVHVLGAAGLKDSPTG--ANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. UniProt/SwissProt
Match: sp|O15484|CAN5_HUMAN (Calpain-5 OS=Homo sapiens OX=9606 GN=CAPN5 PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 6.933e-39
Identity = 168/649 (25.89%), Postives = 273/649 (42.06%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTK--ESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRDGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  L+ +  R      L+EDP FPA+ D L+ K         + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I   + E   +   T   Q    M K     G+    +   +     A+ +      H Y +T   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC V+       S +++ K    W+       W  H D PR  RG   I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP+  T++ V+GA  ++ + T    N +  I CE +   S +   T +P+++   +FYR
Sbjct:   12 NYSALRRDCRRRK---VLFEDPLFPATDDSLYYKGTP---GPAVRWKRPKGICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------NAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI--DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVI-----NTSHLSIHKT---WEEARLHGAWTLHED-PRQNRGGGCINHKDTFFQNPQYIFEVKKPE----DEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTG--ANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. UniProt/SwissProt
Match: sp|Q8R4C0|CAN5_RAT (Calpain-5 OS=Rattus norvegicus OX=10116 GN=Capn5 PE=1 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.652e-39
Identity = 165/656 (25.15%), Postives = 273/656 (41.62%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITS-FYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS----------LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  LK   LR      L+EDP+FPAS D L+ K         + W+RP  +   P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        SY G F F F R G+   V++DDRLPT V+  L+   SN+  EF  A +EKAYAK  G Y  L+  +   A++DFTG + E I  +  +    E   S  +++V+ +     G+    +   +      + +      H Y +T   ++ L       + LL +F + +   + +IRL +           SD  E           WQK +   ++K G+   +  E W+T E +     DI KC ++       S +++ K    W+       W R + P+  R    I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +   L  GRYV+IP     G   +  L+VF+            D+P    C   ++ +                                P  C      YP++ T++ V+GA  ++ ++T    N +  I CE E   S +   T +P+++   +FYR
Sbjct:   12 NYSALKRACLRRK---VLFEDPHFPASDDSLYYKGTP---GPTVRWKRPFDICDDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKP-------DSYAGIFHFNFWRFGEWVDVVVDDRLPT-VNNQLIYCHSNSKNEFWCAPVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRSQLFERVLKVHSRG-GLISASIKAMTAADMETRLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGERVWTGPWSDTSEE----------WQKVSKSEREKMGVTVQDDGEFWMTYEDMCRYFTDIIKCRLI-----NTSYLSIHKT---WEEARLRGAWTRHEDPQQNRSGGCINHKDTFFQNPQYIFEVKKPE----DEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---AASSIYINSRSVFLRTELPEGRYVIIPTTFEPGHTGELLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRTCWSSLCGYPQQVTQVHVLGAAGLKDSSTG--ANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. UniProt/SwissProt
Match: sp|O35646|CAN6_MOUSE (Calpain-6 OS=Mus musculus OX=10090 GN=Capn6 PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 1.182e-32
Identity = 168/665 (25.26%), Postives = 275/665 (41.35%), Query Frame = 3
Query:   72 FLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLK-ERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI--CKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFN--RN-SIIALAKKQLY-----WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQP-ETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWI-AAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEV----NIQLFCENKLG 2015
            + +LK E ++  DG  L+ DP F    D LF       +   ++W+RP  +S  P L+   N  + +   G+L    +    S L  + + +   +PN  +Q    ++P         Y G F F F   G+   V+IDD LPT     + S S++ NE F  AL+EKAYAK LG Y  L+  +    IMDFTG L E I   K     ++ E    F +     TK     C IE P Q  ++           L+ G+T    D     + + L   +++    + ++RL +    +E       + + WQ+ T   +K  GL  ++  E W+++E       C   FH  N  RN +     +K+L      W  V  D   +R G   G       FL+N QY+  VP+      + +   +++ Y  +G        N  IG ELF+VE NR +R+H L + ++    + +   R + ++ YL++G YV++P +   G  +++ L++F S+  V+   L  D+P+                                              C      YPK  T+I+V  A  +      +  N +  I C  E   S +  +T+   +D   +FYR   D   +    N + FC+  LG
Sbjct:   13 YQELKQECMK--DG-RLFCDPTFLPENDSLFFN---RLLPGKVVWKRPQDISDDPHLI-VGNISNHQLIQGRLGNKAMISAFSCLAVQESHWTKAIPNHKDQEWDPRKP-------EKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNE-FWNALLEKAYAKLLGCYEALDGLTITDIIMDFTGTLAEIIDMQKGRYTDLVEEKYKLFGELYKTFTKGGLICCSIESPSQEEQEVETDWG-----LLKGYTYTMTDIRKLRLGERLVEVFSTEK--LYMVRLRNPLGRQEWSGPWSEISEEWQQLTVTDRKNLGLVMSDDGEFWMSLEDF-----CHN-FHKLNVCRNVNNPVFGRKELESVVGCWT-VDDDPLMNRSG---GCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGR-----PDNYIIGFELFKVEMNRRFRLHHL-YIQERAGTSTYIDTRTVFLSKYLKKGSYVLVPTMFQHGRTSEFLLRIF-SEVPVQLRELTLDMPKMS--------------------------------------------CWNLARGYPKVVTQITVHSAEGLEKKYANETVNPYLIIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIIQVWNSRKFCDQFLG 594          
BLAST of Calpain-5 vs. UniProt/SwissProt
Match: sp|O88501|CAN6_RAT (Calpain-6 OS=Rattus norvegicus OX=10116 GN=Capn6 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 2.539e-32
Identity = 167/665 (25.11%), Postives = 275/665 (41.35%), Query Frame = 3
Query:   72 FLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLK-ERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI--CKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFN--RN-SIIALAKKQLY-----WKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQP-ETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWI-AAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEV----NIQLFCENKLG 2015
            + +LK + ++  DG  L+ DP F    D LF       +   ++W+RP  +S  P L+   N  + +   G+L    +    S L  + + +   +PN   Q    ++P         Y G F+F F   G+   V+IDD LPT     + S S++ NE F  AL+EKAYAK LG Y  L+  +    IMDFTG L E I   K     ++ E    F +     TK     C IE P Q  ++           L+ G+T    D     + + L   +++    + ++RL +    +E       + + WQ+ T   +K  GL  ++  E W+++E       C   FH  N  RN +     +K+L      W  V  D   +R G   G       FL+N QY+  VP+      + +   +++ Y  +G        N  IG ELF+VE NR +R+H L + ++    + +   R + ++ YL++G YV++P +   G  +++ L++F S+  V+   L  D+P+                                              C      YPK  T+I+V  A  +      +  N +  I C  E   S +  +T+   +D   +FYR   D   +    N + FC+  LG
Sbjct:   13 YQELKQDCMK--DG-RLFCDPTFLPENDSLFFN---RLLPGKVVWKRPQDISDDPHLI-VGNISNHQLIQGRLGNKAMISAFSCLAVQESHWTKAIPNHKEQEWDPRKP-------EKYAGIFRFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNE-FWNALLEKAYAKLLGCYEALDGLTITDIIMDFTGTLAEIIDMQKGRYTDLVEEKYKLFGELYKTFTKGGLISCSIESPSQEEQEVETDWG-----LLKGYTYTMTDIRKLRLGERLVEVFSTEK--LYMVRLRNPLGRQEWSGPWSEISEEWQQLTVTDRKNLGLVMSDDGEFWMSLEDF-----CHN-FHKLNVCRNVNNPVFGRKELESVVGCWT-VDDDPLMNRSG---GCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGR-----PDNYIIGFELFKVEMNRRFRLHHL-YIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTSEFLLRIF-SEVPVQLRELTLDMPKMS--------------------------------------------CWNLARGYPKVVTQITVHSAEGLEKKYANETVNPYLTIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIIQVWNSRKFCDQFLG 594          
BLAST of Calpain-5 vs. TrEMBL
Match: A0A091E4X5 (Calpain-5 OS=Fukomys damarensis OX=885580 GN=H920_00185 PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 6.504e-39
Identity = 169/647 (26.12%), Postives = 276/647 (42.66%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSE-HITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  LK   LR      L+EDP+FPA+ D L+ K         + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P I       Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +  +    E      +++V+ +     G+    +   +     A+        H Y +T   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC +L       S +++ K    W+       W R + PR  R    I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YPK+ T++ V+GA  ++ + T   PN +  I CE E   S++   T  P+++   +FYR
Sbjct:  128 NYSALKRACLRRK---VLFEDPHFPATDDSLYYK---GIPGPAVRWKRPKDICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPDI-------YAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDFANDEAKRNQLFERVLKVHSRG-GLISASIKAVTAADMEARLGCGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLL-----NTSYLSIHKT---WEEARLRGAWTRHEDPRQNRSGGCINHKDTFFQNPQYIFEVKKPE----DEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHK---VASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRTCWSSLCGYPKQVTQVHVLGAAGLKDSTTG--PNSYVIIKCEGEKVHSSVQKGTSMPEYNVKGIFYR 686          
BLAST of Calpain-5 vs. TrEMBL
Match: A0A485NT48 (Calpain-5-like OS=Lynx pardinus OX=191816 GN=LYPA_23C014118 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 8.214e-39
Identity = 167/647 (25.81%), Postives = 277/647 (42.81%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSE-HITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  LK   LR      L+EDPNFPA+ D L+ K         + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +       E      +++V+ +     G+    +   +     A+ +      H Y IT   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC V+       S +++ K    W+       W R + PR  R    I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP++ T++ ++GAT ++ ++T    N +  I CE +   S +   T +P+++   +FYR
Sbjct:   12 NYSALKRACLRRK---VLFEDPNFPATDDSLYYKGTP---GPTVRWKRPKDICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------SAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRSEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGGFANDEAKRNQLFERVLKVHSRG-GLISASIKAVTAADMEARLACGLVKGHAYAITDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVI-----NTSYLSIHKT---WEEARLRGAWTRHEDPRKNRSGGCINHKDTFFQNPQYIFDVKKPE----DEVLICIQQRPKQSTRRDGKGENLAIGFDIYKVEENREYRMHGLQHR---AASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRSCWSSLCGYPQQVTQVHILGATGLKDSSTG--ANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. TrEMBL
Match: A0A337SKD2 (Calpain 5 OS=Felis catus OX=9685 GN=CAPN5 PE=3 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 8.214e-39
Identity = 167/647 (25.81%), Postives = 277/647 (42.81%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSE-HITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGPR--RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  LK   LR      L+EDPNFPA+ D L+ K         + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +       E      +++V+ +     G+    +   +     A+ +      H Y IT   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC V+       S +++ K    W+       W R + PR  R    I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP++ T++ ++GAT ++ ++T    N +  I CE +   S +   T +P+++   +FYR
Sbjct:   12 NYSALKRACLRRK---VLFEDPNFPATDDSLYYKGTP---GPTVRWKRPKDICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------SAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRSEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGGFANDEAKRNQLFERVLKVHSRG-GLISASIKAVTAADMEARLACGLVKGHAYAITDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVI-----NTSYLSIHKT---WEEARLRGAWTRHEDPRKNRSGGCINHKDTFFQNPQYIFDVKKPE----DEVLICIQQRPKQSTRRDGKGENLAIGFDIYKVEENREYRMHGLQHR---AASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRSCWSSLCGYPQQVTQVHILGATGLKDSSTG--ANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. TrEMBL
Match: A0A1L5BWZ9 (Calpain-5 OS=Castor fiber OX=10185 GN=CAPN5 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 2.194e-38
Identity = 164/647 (25.35%), Postives = 278/647 (42.97%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITS-FYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW--HRDGPR-RGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+L LK   LR      L+EDP+FPA+ D L+ K         + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +  + +  E   S  +++V+ +     G+    +   +      + +      H Y +T   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E +     DI KC ++       S +++ K    W+       W  H D  + R    I  +  F +N QY+  V +PE      VL  +Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP++ T++ V+ AT ++ ++T    N +  I CE +   S +   T +P+++   +FYR
Sbjct:   12 NYLSLKRACLRRK---VLFEDPHFPATDDSLYYKGAP---GPTVRWKRPKDICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------DAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLINDETKRSQLFERVLKVHSRG-GLISASIKAMTAADMETRLACGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRLI-----NTSYLSIHKT---WEEARLHGAWTQHEDPQKNRSGGCINHKDTFFQNPQYIFEVKKPE----DEVLICIQQRPKRSTRQEGKGENLAIGFDIYKVEENRQYRMHSLQHK---VASSIYINSRSVFLRTEQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRTCWSSLCGYPRQVTQVHVLAATGLKDSSTG--ANSYVIIKCEGDKVCSAVQKGTSTPEYNVKGIFYR 570          
BLAST of Calpain-5 vs. TrEMBL
Match: L8IUH0 (Calpain-5 (Fragment) OS=Bos mutus OX=72004 GN=M91_05035 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 2.404e-38
Identity = 166/647 (25.66%), Postives = 279/647 (43.12%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSE-HITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL----LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGP---RRGPKVIGQE-FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            N+  LK   LR      L+EDPNFPA+ D L+ K +       + W+RP  + + P L   +   S   H G++   W     S L  R ++++ V+P+   Q    ++P        +Y G F F F R G+   V+IDDRLPT V+  L+   S++  EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I  +  +    E      +++V+ +     G+    +   +     A+ +      H Y IT   ++ L       + LL +F + +   + +IRL +   + E NG       + WQK +   ++K G+   +  E W+T E L     DI KC ++       S +++ K    W+       W R + P   R G  +  ++ F +N QY+  V +PE      VL ++Q+  +          N  IG ++++VE+NR YR+H L H       + +   R + +      GRYV+IP     G   ++ L+VF+            D+P    C   ++ +                                P  C      YP++ T++ V+GA  ++ + T    N +  I CE +   S +   T +P++D   +FYR
Sbjct:   18 NYSALKRACLRRK---VLFEDPNFPATDDSLYYKGSP---GPTVRWKRPKDICEDPRLF-VDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKP-------NAYAGIFHFHFWRFGEWVDVVIDDRLPT-VNNQLIYCHSSSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDFANDEAKRNQLFERVLKVHSRG-GLISASIKAVTAADMEARLACGLVKGHAYAITDVRKVRLG------HGLLAFFKSEK---LDMIRLRNPWGEREWNGPWSD-TSEEWQKVSKSEREKLGVTVQDDGEFWMTFEDLCRYFTDIIKCRLI-----NTSYLSIHKT---WEEARLRGAWTRHEDPLQNRSGGCINHKDSFFQNPQYIFDVKKPE----DEVLISIQQRPKQSTRRDGKGENLAIGFDIYKVEENRQYRMHSLQHR---AASSIYINSRSVFLRTEQPEGRYVIIPTTFEPGHTGEFLLRVFT------------DVPSN--CRELRLDEP-------------------------------PRTCWSSLCGYPQQVTQVHVLGAAGLKDSPTGA--NSYVIIKCEGDKVRSAVQKGTSTPEYDVKGVFYR 576          
BLAST of Calpain-5 vs. Ensembl Cavefish
Match: capn5a (calpain 5 [Source:NCBI gene;Acc:103038917])

HSP 1 Score: 144.821 bits (364), Expect = 1.101e-35
Identity = 167/646 (25.85%), Postives = 269/646 (41.64%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLS---EHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEVNIQLFCENKL 2012
            L+EDP FP   + LF + N+      + W+RP +L   P L  F N  SA   H G+L   W     S L  R  +++ V+P+  +Q   +  P        SY G F F F   G+   V+IDDRLPT  + +L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +   + E       E     + +V+ +      I C I    Q++ ++         H Y +T    + L       + LL YF + +   + +IR+ +   + E NG       + WQK +   ++K G+   +  E W+  E         +L  + N  S +++ K    W+       W R D P   R    I  +  +L+N QY+  V +PE      VL  +Q+             N  IG +L  VE NR+YR+H    ++Q  C + +   R + +   L+ GRYV+IP     G    + L+VF+            D+P    C    + +                                P  C      YP+  T++ V+    ++   +    + +  ISCE     S    S LSP++D   LFYR       ++I+++ +N L
Sbjct:   26 LFEDPLFPPVDESLFYQTNQ---IGKVTWKRPKELCSDPHL--FVNGISAHDLHQGRLGNCWFVAACSSLASREALWQKVIPDWKDQEWDSNHP-------DSYAGIFHFRFWLFGEWVDVVIDDRLPT-ANGNLIYCHSNDSNEFWSALVEKAYAKIHGCYEALDGGNTADALVDFTGGVSEPV--DLLEGRFGQEEEARNQLFDRVLKVHNRGGLISCSIRATTQADMEARLDCGLVKGHAYAVTDVRRVRLG------HGLLAYFKSEK---LMMIRMRNPWGEREWNGPWSD-SSEEWQKVSKGEREKLGVTVQDDGEFWMMFEDFSKHFTDLILCRLIN-TSYLSIHKT---WEEAVMMGSWSRHDDPLSNRSGGCINNKTTYLQNPQYVFDVKKPE----DEVLICLQQKDRRARPKEGKGENLAIGFDLQRVELNRVYRMHT---SQQKLCSSVYINSRSVFVRKDLKEGRYVIIPTTFNPGLQGDFLLRVFT------------DVPSD--CKELTLDEP-------------------------------PQTCWTGLCGYPQLVTQVHVMKGVGLQGQDSDGSSDPYIIISCEGVKVKSPAHKSNLSPEFDVKALFYR-KKPGQGIHIEVYNKNVL 589          
BLAST of Calpain-5 vs. Ensembl Cavefish
Match: capn5b (calpain-5-like [Source:NCBI gene;Acc:103035636])

HSP 1 Score: 135.191 bits (339), Expect = 1.822e-32
Identity = 154/627 (24.56%), Postives = 261/627 (41.63%), Query Frame = 3
Query:  117 ALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHIT--SFYQKVVNM-TKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW-HRDGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
             L+EDP FPA  D LF + N+      + W+RP +L   P L  F +  SA   H G+L   W     S L  R ++++ V+P+   Q    ++         SY G F F F R G+   V+IDDRLPT V   L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +   ++ ++  + +     +++V+ +  ++    C I      + ++         H Y +T   ++ L       + LL +F + +   + +IR+ +    +E         + W+K +   ++K G+   +  E W+  +         +L  + N  S +++ K    W+       W +RD P   R    I  +  FL+N QY+  V + E      VL  +Q+  +          N  IG ++  VE NR YR+H     +Q    + +   R + +   L+ GRYV+IP     G   ++ L+VF        T +  D  E  L  P                                     P  C      YP+  T++ V+ A  ++   +    + +  I+CE E   S +   T  P +D   +F+R
Sbjct:   25 TLFEDPLFPAVDDSLFYQGNR---IGRVHWKRPRELCDDPHL--FVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWREQEWDPEK-------DESYVGIFHFRFWRFGEWVDVVIDDRLPT-VDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPM-DLLEGQMAQDEVARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVKKVRLG------HGLLAFFKSEK---LHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFDDFCQYFTDLILCRLIN-TSYLSIHKT---WEEEVMRGTWVYRDDPLRNRSGGCINHKATFLQNPQYVFDVRKVE----DEVLICLQQKEKRATPKEGKGENLAIGFDIHRVELNRKYRMHS---AQQKVAGSIYINSRCVFLRKELKEGRYVIIPTTFDPGQQGEFLLRVF--------TDVPSDCKELTLDDP-------------------------------------PQTCWTGMCGYPQLVTQVHVLSAEGLQGQDSNGASDPYVIITCEGEKVRSPVHKDTRCPNFDVKGVFFR 572          
BLAST of Calpain-5 vs. Ensembl Cavefish
Match: capn5b (calpain-5-like [Source:NCBI gene;Acc:103035636])

HSP 1 Score: 134.42 bits (337), Expect = 2.299e-32
Identity = 154/626 (24.60%), Postives = 261/626 (41.69%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHIT--SFYQKVVNM-TKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW-HRDGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            L+EDP FPA  D LF + N+      + W+RP +L   P L  F +  SA   H G+L   W     S L  R ++++ V+P+   Q    ++         SY G F F F R G+   V+IDDRLPT V   L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +   ++ ++  + +     +++V+ +  ++    C I      + ++         H Y +T   ++ L       + LL +F + +   + +IR+ +    +E         + W+K +   ++K G+   +  E W+  +         +L  + N  S +++ K    W+       W +RD P   R    I  +  FL+N QY+  V + E      VL  +Q+  +          N  IG ++  VE NR YR+H     +Q    + +   R + +   L+ GRYV+IP     G   ++ L+VF        T +  D  E  L  P                                     P  C      YP+  T++ V+ A  ++   +    + +  I+CE E   S +   T  P +D   +F+R
Sbjct:   26 LFEDPLFPAVDDSLFYQGNR---IGRVHWKRPRELCDDPHL--FVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWREQEWDPEK-------DESYVGIFHFRFWRFGEWVDVVIDDRLPT-VDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPM-DLLEGQMAQDEVARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVKKVRLG------HGLLAFFKSEK---LHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFDDFCQYFTDLILCRLIN-TSYLSIHKT---WEEEVMRGTWVYRDDPLRNRSGGCINHKATFLQNPQYVFDVRKVE----DEVLICLQQKEKRATPKEGKGENLAIGFDIHRVELNRKYRMHS---AQQKVAGSIYINSRCVFLRKELKEGRYVIIPTTFDPGQQGEFLLRVF--------TDVPSDCKELTLDDP-------------------------------------PQTCWTGMCGYPQLVTQVHVLSAEGLQGQDSNGASDPYVIITCEGEKVRSPVHKDTRCPNFDVKGVFFR 572          
BLAST of Calpain-5 vs. Ensembl Cavefish
Match: ENSAMXT00000048279.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000063.1:113453:132090:1 gene:ENSAMXG00000038709.1 transcript:ENSAMXT00000048279.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 1.061e-29
Identity = 151/641 (23.56%), Postives = 257/641 (40.09%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDE-KVLSEHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEE--NGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRR----GPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            ++ +LK E L+      L+EDP F  S   LF +         + W+RPG++ + P L  F    SA   + G++   W     S L  +  +++ V+PN   Q      P         Y G F F F   G+   V++DDRLPT ++  L+   S +N EF  AL+EKAYAK  G Y  L   +   A++DF+G + E +       +  S+     +  ++N+  +   I C I  P +   + +      H Y +TG   + L       + LL YF N     V +IR+ +     E      D++          L K  +   C N            D+  C ++       S+++L K+  + + V F  +     P R    G     Q FL+N QY++ +   +   + +   +++ +   G        N  IG  +F+VE NR YR+HD+  T+Q    + +   R + +   L +GRY++IP     G    + L+V+++ + +              C    + + + R  + F                                 YP+  T++ V GA  +    +    + +  ISCE     S +   T  PQ+D   +FYR
Sbjct:   10 HYSELKRECLQQK---KLFEDPEFLCSNRSLFYRTPP---PGPVQWKRPGEMCEAPRL--FVEGISAHDLNQGEVGNCWFVAACSCLALKPQLWQKVIPNWKEQEWDPDRP-------DRYTGIFHFQFWIFGEWTDVVVDDRLPT-INGKLIYCHSKSNNEFWSALLEKAYAKLSGCYESLNGGNTGDAVVDFSGAVNEPVSLETGSFRTDSKTREKLFSDLLNVNDQGGIISCSIASPHERELRLANGLVKGHAYSVTGVRRVRLG------HGLLAYFKND---TVDLIRMRNPWGKHEWRGAWSDRWGEFLSDDFKLLKKMSFDDWCQN----------FTDVDVCRLM-----NTSVLSLQKR--WREVVHFGSWIKHSEPLRNRSGGCMNHRQTFLQNPQYILDLQDEDELLVSLQQRDMKIHRAHGQGE-----NLTIGFAIFKVELNRKYRMHDI-ITQQNVATSSYINARSVFLRKLLPKGRYIIIPSTFTPGILGDFMLRVYANQDLI--------------CRELDVDKPSVRCWSSFMG-------------------------------YPQVVTQVYVHGAEGLENQDS---ADPYVIISCEKNSIQSEVQKDTRDPQFDIRAIFYR 554          
BLAST of Calpain-5 vs. Ensembl Cavefish
Match: ENSAMXT00000050823.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000063.1:117226:132090:1 gene:ENSAMXG00000038709.1 transcript:ENSAMXT00000050823.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 1.444e-28
Identity = 152/648 (23.46%), Postives = 260/648 (40.12%), Query Frame = 3
Query:   51 SQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDE-KVLSEHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKS-SPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTW-QKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRR----GPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            S   + ++ +LK E L+      L+EDP F  S   LF +         + W+RPG + + P L  F    SA   + G++   W     S L  +  +++ V+PN   Q      P         Y G F F F   G+   V++DDRLPT ++  L+   S +N EF  AL+EKAYAK  G Y  L   +   A++DF+G + E +       +  S+     +  ++N+  +   I C I   P   +   A      H Y +TG   + L       + LL YF N     V +IR+ +     E  G         W  +   +++    + C    + W   +   D+  C ++       S+++L K+  + + V F  +     P R    G     Q FL+N QY++ +   +   + +   +++ +   G        N  IG  +F+VE NR YR+HD+  T+Q    + +   R + +   L +GRY++IP     G    + L+V+++ + +              C    + + + R  + F                                 YP+  T++ V GA  +    +    + +  ISCE     S +   T  PQ+D   +FYR
Sbjct:    6 SAYKNQHYSELKRECLQQK---KLFEDPEFLCSNRSLFYRTPP---PGPVQWKRPG-MCEAPRL--FVEGISAHDLNQGEVGNCWFVAACSCLALKPQLWQKVIPNWKEQEWDPDRP-------DRYTGIFHFQFWIFGEWTDVVVDDRLPT-INGKLIYCHSKSNNEFWSALLEKAYAKLSGCYESLNGGNTGDAVVDFSGAVNEPVSLETGSFRTDSKTREKLFSDLLNVNDQGGIISCSIAASPHERELRLANGLVKGHAYSVTGVRRVRLG------HGLLAYFKND---TVDLIRMRNPWGKHEWRG--------AWSDRWGNVLRTFLCVFCRMSFDDW--CQNFTDVDVCRLM-----NTSVLSLQKR--WREVVHFGSWIKHSEPLRNRSGGCMNHRQTFLQNPQYILDLQDEDELLVSLQQRDMKIHRAHGQGE-----NLTIGFAIFKVELNRKYRMHDI-ITQQNVATSSYINARSVFLRKLLPKGRYIIIPSTFTPGILGDFMLRVYANQDLI--------------CRELDVDKPSVRCWSSFMG-------------------------------YPQVVTQVYVHGAEGLENQDSSGGADPYVIISCEKNSIQSEVQKDTRDPQFDIRAIFYR 559          
BLAST of Calpain-5 vs. Ensembl Sea Lamprey
Match: capn1a (calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-1263])

HSP 1 Score: 82.4185 bits (202), Expect = 1.787e-16
Identity = 81/275 (29.45%), Postives = 122/275 (44.36%), Query Frame = 3
Query:   54 QMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFIS---NDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPY-----HVYLITGFTEI 851
            +  S  F ++K E L+      L+EDP+FPAS   L  +     I+   N I W+RP +L + P  +  +    A  + G L   WL   + SL    ++   VVP      +F+++          Y G F F F + G+   V +DDRLPT     L+ + S    EF  AL+EKAYAK  G Y  L     + A+ DFTG +GE+   +   +   + I+        + K +   C IE    S +    K +P      H Y ITG  ++
Sbjct:   24 KTKSKTFQEIKKECLQRK---ILFEDPDFPASLSSLHIRVQPTVITQSNNFIEWKRPWELVRHPEFI-VSGATRADINQGTLPDCWLLSAIASLTLYPDLLAKVVPM---GQSFHED----------YAGIFLFRFCQYGEWVDVHVDDRLPTK-KGELVFVQSGTGNEFWSALLEKAYAKLNGCYEALAYGFPVEALCDFTGGVGETFTMNNAPRDYWDGISR------AIKKGAIICCGIETLAASGR--GEKVTPMGLVEGHAYSITGVIKL 272          
BLAST of Calpain-5 vs. Ensembl Sea Lamprey
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 73.9442 bits (180), Expect = 9.811e-14
Identity = 60/200 (30.00%), Postives = 93/200 (46.50%), Query Frame = 3
Query:   69 NFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFH--PGKLSPFWLPILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGE 662
            +F +L++  L H     L+EDP+FPA  + ++   N         W RP +L    C+ +    ++   H   G L   W+   I+ +      EL+   +    +F +          +Y G F F F R G+   V++DDRLPT  +  L+ + S    EF  AL+EKAYAK  G Y  L+  +   A+ DFTG + E
Sbjct:   52 SFEELRTLCLSHD---VLFEDPDFPAHNNSIYFSQNAPM---QFQWMRPKEL----CVPRSIVIEANHTHICEGDLGDCWVLAAIACMTMNE--ELLARVIPAGQSFEE----------NYAGIFHFQFWRFGEWVDVVVDDRLPT-FNNQLVFVQSAERNEFWSALLEKAYAKVHGSYEALKGGNTTEAMEDFTGGVTE 228          
BLAST of Calpain-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000152.1 (pep scaffold:Pmarinus_7.0:GL488881:291:5685:-1 gene:ENSPMAG00000000135.1 transcript:ENSPMAT00000000152.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 8.267e-13
Identity = 36/81 (44.44%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  420 SYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGE 662
            +Y G F F F R G+   V++DDRLPT +   L  + S  + EF  AL+EKAYAK  G Y  L    F  A++DFTG + E
Sbjct:   34 AYAGIFHFKFWRYGEWVDVVVDDRLPT-LKGKLAFVRSCESNEFWGALLEKAYAKVCGSYEALRSGRFTEALVDFTGGVKE 113          
BLAST of Calpain-5 vs. Ensembl Sea Lamprey
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 63.1586 bits (152), Expect = 1.434e-10
Identity = 71/294 (24.15%), Postives = 112/294 (38.10%), Query Frame = 3
Query:  420 SYCGTFQFT--FRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIEL--PPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQL-------YWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLI 1265
             Y G F F   F   G+   V IDDRLPT  +  L+ + S +  EF  AL+EKAY+K  G Y  L+  S   A+ DFTG     + + +D K     +     K     K S   C I++    +S  ++S      H Y ITG  E+                 N RG  V ++R+ +   + E NG    +  + W+      + +         E W++ +  +           F +  I  L   ++       YW     D  W +     G +   + F  N Q+ +
Sbjct:   63 GYAGIFHFQQKFWHFGEWMDVFIDDRLPTK-NGQLVFVHSADKREFWSALLEKAYSKLNGSYEALKGGSIAEAMEDFTG----GVYELLDLKTAPPDLFRIMCKA--RQKGSMMGCSIDVTNASESEARTSNGLVKGHAYSITGVDEV-----------------NYRGQKVKLLRIRNPWGEVEWNGAWSDHAPE-WKALDQGERNRLQQVMAEDGEFWMSFDDFM---------RHFTKMEICNLTPDRVEREGDPRYWTVTVHDGRWLKGCTAGGCRNFPETFWTNPQFRL 322          
BLAST of Calpain-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003998.1 (pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 gene:ENSPMAG00000003440.1 transcript:ENSPMAT00000003998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.770e-9
Identity = 35/79 (44.30%), Postives = 44/79 (55.70%), Query Frame = 3
Query:  414 SMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTG 650
            S  Y G F F F + G+   V+IDD LPT  +  L  + S +  EF  AL+EKAYAK  G Y  L+  S   A+ DFTG
Sbjct:   57 SDGYAGIFHFQFWQFGEWVDVVIDDLLPTQ-NNKLAFLHSTDRNEFWSALLEKAYAKLNGSYEALKGGSIAEAMEDFTG 134          
BLAST of Calpain-5 vs. Ensembl Nematostella
Match: EDO34860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN59])

HSP 1 Score: 110.153 bits (274), Expect = 6.374e-25
Identity = 154/618 (24.92%), Postives = 249/618 (40.29%), Query Frame = 3
Query:  198 IIWRRPGQLS--KLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLS-EHITSFYQKVVNMTKE-SFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLN--YFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLL-DISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQE-FLKNNQYLIMVP--QPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLP-NFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEVNIQLFCEN 2006
            + W+RP ++    +P L     D S     GKL   W     S L  R  +   V+P+   Q    ++P        +Y G F+F F R G+   V++DD LPT V+  L+ I S    EF  ALIEKAYAK  G Y  L   S   A++DFTG + E+I  S        E     ++ +    KE S     I++  ++  +    +     H Y +T   ++ +   +GL++ L N  +FY        +IRL +   + E NG       + W+K     +KK G+   N  E W+  +    + + C+ L H+ N+  I  + K+   W     ++ W + G   G  V  Q+ FLKN QY   +   + E   + ++  + +K      +  +  GN  IG  + +VE+NR YRVH +         + F   R ++   +L  GRY+V+P         + +    +  R    FL+ D                                    S   K+    P     CR   P+    + V  A  ++ T    L  + +  I CE     + +   TL P WD   LFY      S++ +Q++  N
Sbjct:   49 VEWKRPSEICHPAVPHLFVDGAD-SHDVTQGKLGNCWFVAACSSLALRPFLLYKVIPDKDKQEWDPKKP-------ENYQGIFRFRFYRQGEWTEVVVDDLLPT-VNGKLVYIHSKEKNEFWSALIEKAYAKLAGTYEALAAGSTADALVDFTGGVAEAISLSNGGYAEDQEKRLQLFKTLERGHKEKSLMSASIKINNRNEMEQRLDTGLIKGHAYGVTMVKKVTVG--EGLLS-LFNKKHFY--------MIRLRNPWGEKEWNGRWSDE-SEEWKKLKPGDRKKMGIVFENDGEFWMEFDDFCREFTDCT-LCHVINKAMIHKVFKQ---WHIYKHNYNWTQ-GQNAGGCVQNQDTFLKNPQYAFSITDNEGEDAMVSLMQEDRRK------DKSKGVGNLTIGFYIMKVEENRKYRVHSMFPK---AGDSIFINAREVMNRFFLAAGRYLVVPSTYEPHTPGHFMMRIFTRKRSNAMFLDQD-----------------------------------HSVGSKIWCCLP----RCRA--PQCVVSVYVTSAAGLQKTGKMSLTCDPYALIICEGRKIKTPIKYDTLIPSWDAGALFYVRQPQKSQIVVQIWDSN 590          
BLAST of Calpain-5 vs. Ensembl Nematostella
Match: EDO48633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ83])

HSP 1 Score: 85.8853 bits (211), Expect = 2.923e-17
Identity = 90/346 (26.01%), Postives = 147/346 (42.49%), Query Frame = 3
Query:   72 FLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFW-LPILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSS----PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS--LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLD 1088
            F  L+ +LL   +   L+ED +FPAS  +LF++      S  +IW+RP ++SK P  +      S+    G++   W +  L  L    ++   V P      +F  EP        SYCG F+F F + G+   +I+DD LPT  +  L    S++ +EF  AL+EKAYAK  G Y  +       A+ D TG + E++        L   +   Y+      ++S   C IE+   S+ +            H Y ITG  +  L    G                V +IRL +   +  E  G       + W   ++  K++  L  ++  E W++ +  L+
Sbjct:   12 FASLQRQLL---NSKRLFEDRDFPASNRVLFTRRR----SVQLIWKRPHEISKSPQFIA-RGFSSSDVAQGRIRNCWFVAALADLTTNIDLLHHVCPP---DQSF--EP-------GSYCGMFRFNFWQFGEWVEIIVDDYLPT-YNGRLYFTKSDDPDEFWSALLEKAYAKLCGSYEAMSLGRISEALQDMTGGMIENVDLQNPPHGLFNVMMKAYE------RQSLMGCSIEVKKYSSDQYEGTLENGLITRHAYSITGLRKATLSSLRGRPE-------------VDLIRLRNPHANSSEWRGAWSDRSPE-WNMLSSQEKRELNLTFDDDGEFWMSFDDFLN 316          
BLAST of Calpain-5 vs. Ensembl Nematostella
Match: EDO40193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W7])

HSP 1 Score: 76.6406 bits (187), Expect = 1.994e-14
Identity = 91/387 (23.51%), Postives = 152/387 (39.28%), Query Frame = 3
Query:  123 YEDPNFPA-SYDILFSK-PNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPY---HVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLI 1265
            +ED  F A    I FSK P + F      W+RP  + + P +             G L   WL   I+ L + + +   VVP          + ++  P   +Y G  +F   + G+ + VIIDDRLPT  +  L+ + S+   EF  AL+EKAYAK  G Y  L+      A+ DFTG L ES         L++++      ++   ++   +    +  ++N+  +  ++     H Y +TG  ++      G ++  L    N  G+             E            WQ  +   KK  GL   +  E W++ +   D  K      +    +  A+    + ++  S    W R     G +   + F KN Q+ I
Sbjct:   20 FEDDEFLAIDSSIFFSKRPPRPFE-----WKRPSDICEDPHMF-VGGASRLDIQQGMLGDCWLLAAIAALTQHSALMNKVVP----------QDYVANPNDRNYTGALKFCIWQYGEWKDVIIDDRLPT-YNGKLVFVHSSERNEFWSALLEKAYAKLNGSYESLKGGQTGEALEDFTGGLAESFD-------LNKNVPKDLFCIMQTAEKRHALMGCSIAAKANEIEAKLNNGLVKGHAYTVTGCRQVKAKTRRGDLDVELVRVRNPWGNEREWKGAWGDGSSE------------WQLLSDYEKKSIGLTFEDDGEFWMSFD---DFKKHFTTLEICMLGADSAMEGSSVGFESRSEHGMWRRGLTAGGCRNFIKTFHKNPQFRI 367          
BLAST of Calpain-5 vs. Ensembl Nematostella
Match: EDO48536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ84])

HSP 1 Score: 55.4546 bits (132), Expect = 7.402e-8
Identity = 47/142 (33.10%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  246 KFNNDQSARF--HPGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGE 662
            +F  D ++R     G L   WL   +S+L +   + + ++P    +  +  + F     S  Y G   F   + G+   VIIDDRLPT     L+ + S    EF  AL+EKAYAK  G Y  L+      A+ DFTG L E
Sbjct:   18 RFYVDGASRLDIKQGVLGNCWLLAAMSVLAQHKPLVDRIMP----EGVYEADRF-----SPRYTGKVVFKLWQYGEWVTVIIDDRLPT-YKGKLVFVHSPEKNEFWCALLEKAYAKIHGSYEALKGGLTGEALEDFTGGLSE 149          
BLAST of Calpain-5 vs. Ensembl Medaka
Match: ENSORLT00000002598.2 (calpain-5 [Source:NCBI gene;Acc:101166153])

HSP 1 Score: 156.377 bits (394), Expect = 1.831e-39
Identity = 167/632 (26.42%), Postives = 269/632 (42.56%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKERN-MFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI------CKSVDEKVLSEHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHR-DGPRR----GPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQP-DICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            L+EDP FP S   LF + N+      ++W+RPG+LS  P L  F +  SA   H G+L   W     S L  R  +++ V+P+   Q    ++P        SY G F F F R G+   V+IDD LPT VS  LL   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E I       K  DEK         +++V+ +      I C I     ++ ++         H Y +T    + L       + LL +F + + S+   IR+ +     E NG       + W+K +   ++K G+  ++  E W+T +  L      +L  + N  S ++L K    W+ V     W R D P R    G         +N QY+  V +PE      V+  +Q+             N  IG ++ +VE NR+YR+H     +Q    + +   R + +   L++GRYV++P    AG   ++ L++F+                                                PS+ R+++  +P   C      YP   T++ V  A  +    + ++ + +  I CE +   S++  +T SP +D   LFYR
Sbjct:   23 LFEDPLFPPSDKSLFYEGNR---VGQVVWKRPGELSSDPHL--FVDGISAHDLHQGQLGNCWFVAACSSLASREALWQKVIPDWKEQEWDKEKP-------QSYAGIFHFRFWRFGEWVDVVIDDLLPT-VSGQLLYGHSNDHNEFWSALVEKAYAKMFGCYEALDGGNTADALVDFTGGVSEPIDLIQNGYKEDDEKR-----DELFERVLKVHNRGGLISCSIRATSAADMEARLGCGLVKGHAYAVTDVRRVRLG------HGLLAFFKSDKLSM---IRMRNPWGQKEWNGPWSD-SSEEWKKVSKSEREKMGVTVDDDGEFWMTFDDFLTNFTDLILCRLIN-TSYLSLHKT---WEEVVVRGSWRRHDEPLRNRAGGCSNNKHSHFQNPQYVFDVTKPE----DEVMVCLQQKDRRATLKEGRGENLPIGFDIQKVELNRVYRMH---AAQQKVGGSIYINSRAVFLRIDLKKGRYVIVPTTFEAGLEGEFLLRIFTD----------------------------------------------VPSNCRELTLDEPRRSCWSGLRGYPSLVTQVYVQQANGLAGQDSDRVSDPYVIIRCEGQEVRSDVHKNTCSPVFDTKALFYR 569          
BLAST of Calpain-5 vs. Ensembl Medaka
Match: capn5b (calpain 5 [Source:NCBI gene;Acc:101155135])

HSP 1 Score: 145.206 bits (365), Expect = 1.537e-35
Identity = 156/625 (24.96%), Postives = 258/625 (41.28%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHI-TSFYQKVVNM-TKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW-HRDGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            L+EDP FPA  D LF   N+      ++W+RP +L + P L  F +  SA   H G+L   W     S L  R ++++ V+P+   Q    ++P        SY G F F F R G+   V+IDDRLPT V   L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +     +    E      +++V+ +  ++    C I      + ++         H Y +T   ++ L       + LL +F + +   + +IR+ +    +E         + W K +   ++K G+   +  E W+T +         +L  + N  S +++ K    W+       W HR  P   R    I  +  FL+N QY+  V + E      VL  +Q+             N  IG ++  VE NR YR+H     +Q    + +   R + +   ++ GRYV+IP     G   ++ L+VF+            D+P    C    + +                                P  C      YP+  T++ V+ A  ++   +    + +  I+CE E   S +   T  P +D   LFYR
Sbjct:   98 LFEDPRFPAIDDSLFYLGNR---IGRVVWKRPRELCEDPHL--FVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDTEKP-------DSYTGIFHFRFWRFGEWVDVVIDDRLPT-VDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPVDLLEGQMATDEAARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LQMIRMRNPWGEKEWSGPWSDSSEEWNKVSKSEREKLGVTVQDDGEFWMTFDDFCQYFTDLILCRLIN-TSYLSIHKT---WEEEVIRGLWVHRQDPLRNRAGGCINHKSTFLQNPQYVFDVKKLE----DEVLICLQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHT---AQQKVAGSIYINSRCVFLRKEMKEGRYVIIPTTFDPGQQGEFLLRVFT------------DVPSD--CKELTLDEP-------------------------------PQTCWTGMCGYPQLVTQVHVLNAEGLQGQDSNGAVDSYVVITCEGERVRSPVQKDTRCPNFDFKGLFYR 644          
BLAST of Calpain-5 vs. Ensembl Medaka
Match: capn5b (calpain 5 [Source:NCBI gene;Acc:101155135])

HSP 1 Score: 141.739 bits (356), Expect = 1.948e-34
Identity = 159/642 (24.77%), Postives = 259/642 (40.34%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSAR-FHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHI-TSFYQKVVNM-TKESFGICQIELPPQSNKKSSAKSS--PYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFW-HRDGP--RRGPKVIGQE--FLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDI-----------------RLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            L+EDP FPA  D LF   N+      ++W+RP +L + P L  F +  SA   H G+L   W     S L  R ++++ V+P+   Q    ++P        SY G F F F R G+   V+IDDRLPT V   L+   SN++ EF  AL+EKAYAK  G Y  L+  +   A++DFTG + E +     +    E      +++V+ +  ++    C I      + ++         H Y +T   ++ L       + LL +F + +   + +IR+ +    +E         + W K +   ++K G+   +  E W+T +         +L  + N  S +++ K    W+       W HR  P   R    I  +  FL+N QY+  V + E      VL  +Q+             N  IG ++  VE NR YR+H     +Q    + +   R + +   ++ GRYV+IP     G   ++ L+VF+            D+P    C    + +                                P  C      YP+  T++ V+ A  +                 RL    Q  + +  I+CE E   S +   T  P +D   LFYR
Sbjct:   98 LFEDPRFPAIDDSLFYLGNR---IGRVVWKRPRELCEDPHL--FVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDTEKP-------DSYTGIFHFRFWRFGEWVDVVIDDRLPT-VDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPVDLLEGQMATDEAARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRLG------HGLLAFFKSEK---LQMIRMRNPWGEKEWSGPWSDSSEEWNKVSKSEREKLGVTVQDDGEFWMTFDDFCQYFTDLILCRLIN-TSYLSIHKT---WEEEVIRGLWVHRQDPLRNRAGGCINHKSTFLQNPQYVFDVKKLE----DEVLICLQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHT---AQQKVAGSIYINSRCVFLRKEMKEGRYVIIPTTFDPGQQGEFLLRVFT------------DVPSD--CKELTLDEP-------------------------------PQTCWTGMCGYPQLVTQVHVLNAEGLQGQDSNGELHCLNPQKKRLLGKAQAVDSYVVITCEGERVRSPVQKDTRCPNFDFKGLFYR 661          
BLAST of Calpain-5 vs. Ensembl Medaka
Match: ENSORLT00000034978.1 (calpain-5 [Source:NCBI gene;Acc:101158220])

HSP 1 Score: 137.117 bits (344), Expect = 4.048e-33
Identity = 167/659 (25.34%), Postives = 271/659 (41.12%), Query Frame = 3
Query:   33 MSDAVESQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVL---SEHITSFYQKVVNMTKESFGI--CQIELPPQSNK-KSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVE----KLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGP----RRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            M  +VE+   + ++  LK + L++     L+EDP FPA+   +F +   E     + W+RPG++S  P L       S   + G +   W     S L  + ++++ V+P+   Q    + P        +Y G F F F   G+   V++DDRLPT ++  L+   SN+  EF  AL+EKAYAK  G Y  L+  +   A++DF+G + E I  ++ E       E   + ++ ++ +  E  GI  C I+  P   + K +      H Y +T    I L       + L+ YF N     +P+IR+ +     E NG       +   K     +   GL   +  E W++ E    K  D   CS++       S++++ K    W  V     W + G     R G       FL+N QY+  V    T  I+ VL  +Q+             N  IG  + +VE NR YR+H L   K +     F   R + +   L +GRY++IP    AG   ++ L++F+  +       E D P+ +  TP                L+                             YP+  T + V  A  +         + +  ISCE +   S +   TL+PQ+D   +FYR
Sbjct:    1 MFSSVEA-FKNQHYADLKRDCLQNK---KLFEDPEFPANNSSVFYR---EPPPGTVQWKRPGEISSDPHLF-VEGINSHDLNQGNVGNCWFVAASSCLALKPHLWKKVIPDWQEQEWDPKHP-------ENYAGIFHFQFWVFGQWTDVVVDDRLPT-INGELIYCQSNSKNEFWSALLEKAYAKLYGCYESLKGGNTGDAVVDFSGAVYEPI--NLQEGAFYKDPEKQNTLFENLLKVY-ERGGIISCSIKAEPHELEFKMANGLVKGHAYSVTAVKRIRLG------HGLVAYFKN---ETIPMIRMRNPWGRMEWNGSWSDSSEEW-SKIGDTERHNLGLTVEDDGEFWMSFEDWCKKFTDADVCSII-----NTSLVSIHKT---WSEVLHFGSWTKHGDPLLNRCGGCGNNNTFLQNPQYMFDV----TKEIEEVLITLQQKDRRTFKKTGQGENLSIGFSVLKVELNRKYRIHRLLSQKSMESSV-FINARSVFVRCILPQGRYIIIPSTFQAGELGEFMLRIFTDVDSGCRELTE-DKPKVKCWTP----------------LFG----------------------------YPQAVTHVFVEKAERLENQDRTAGADPYVIISCEGKSVKSIVHKDTLNPQFDTSAVFYR 572          
BLAST of Calpain-5 vs. Ensembl Medaka
Match: ENSORLT00000039414.1 (calpain-5 [Source:NCBI gene;Acc:101158220])

HSP 1 Score: 134.035 bits (336), Expect = 3.329e-32
Identity = 158/627 (25.20%), Postives = 250/627 (39.87%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKER-NMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGI--CQIELPPQSNK-KSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVE----KLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGP----RRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP-WIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYR 1958
            L+ DP FPA    LF K   E     + W+RP ++S  P L       S   + G++   W     S L    ++++ V+P+   Q    + P        +Y G F F F   G+   V++DDRLPT ++  L+   SN+ +EF  AL+EKAYAK  G Y  L       A++DFTG + E I    +     +    +  + +    E  GI  C I+  P   + K +      H Y +T    I       L ++L+ +F   +   +P+IR+ +     E NG       + W K     +   GL   +  E W++ E    K  D   CS++       S++++ K    W  V     W + G     R G       FL+N QY+  V +     I+ VL  +Q+             N  IG  + +VE NR YR+H L   K +     F   R + +   L +GRY++IP    AG   ++ L++F+  +       E D P+ +  TP                L+                             YP+  T + V  A  +         + +  ISCE +   S +   TL+PQ+D   +FYR
Sbjct:   26 LFRDPEFPADDSSLFYK---EPPPGKVEWKRPWKISSDPHLF-VEGINSHDLYQGEIGNCWFVAASSCLAMMPHLWQKVIPDWQEQEWDPKHP-------ENYAGIFHFQFWVFGQWTDVVVDDRLPT-INGKLIYCHSNSKKEFWSALLEKAYAKLYGCYESLSGGFAGDAVVDFTGAVYERIDLEREAFYKDQRNQDYLFENLLKVYEHGGIISCSIKAKPDELEFKMANGLVKGHAYSVTAVKRI------HLCHELVAHF---KTETLPMIRMRNPWGKMEWNGAWSD-SSEEWSKIGDTERHNLGLTVEDDGEFWMSFEDWCKKFTDADVCSII-----NTSLVSIHKT---WSEVLHFGSWTKHGDPLLNRCGGCGNNNTFLQNPQYMFDVTKE----IEEVLITLQQKDRRTFKKTGQGENLSIGFSVLKVELNRKYRIHRLLSQKSMESSV-FINARSVFVRCILPQGRYIIIPSTFQAGELGEFMLRIFTDVDSGCRELTE-DKPKVKCWTP----------------LFG----------------------------YPQAVTHVFVEKAERLENQDRTAGADPYVIISCEGKSVKSIVHKDTLNPQFDTSAVFYR 572          
BLAST of Calpain-5 vs. Planmine SMEST
Match: SMESG000012000.1 (SMESG000012000.1)

HSP 1 Score: 1442.17 bits (3732), Expect = 0.000e+0
Identity = 714/716 (99.72%), Postives = 715/716 (99.86%), Query Frame = 3
Query:   33 MSDAVESQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEVNIQLFCENKLGLKSRIFDYTFSEKELRDKCRVSLPIQDDXXXXXXXXXXXXXXXXXXYFLSEFNRA 2180
            MSDAVESQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKS PYHVY+ITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEVNIQLFCENKLGLKSRIFDYTFSEKELRDKCRVSLPIQDDISPENESEENRIIIEIENYFLSEFNRA
Sbjct:    1 MSDAVESQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQSNKKSSAKSPPYHVYIITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEVNIQLFCENKLGLKSRIFDYTFSEKELRDKCRVSLPIQDDISPENESEENRIIIEIENYFLSEFNRA 716          
BLAST of Calpain-5 vs. Planmine SMEST
Match: SMESG000078391.1 (SMESG000078391.1)

HSP 1 Score: 242.276 bits (617), Expect = 4.316e-69
Identity = 192/657 (29.22%), Postives = 312/657 (47.49%), Query Frame = 3
Query:  195 DIIWRRPGQLSKLPCLMK-FNNDQSARFHPGKLSPFWLPILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCH-LLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESI--------CKSVDEKVLSEHITSFYQKVV-----NMTKESFGICQIELPPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMSLSDCEENGIID-KYVVKT--WQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLT--NVQKYVEVGANAIQTAGNTQIGIELFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWIAAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRFKSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIRLTATYQLP----NFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEVNIQLFCENKLGLKSRIFDYTFSEKEL-RDKCRVSLPI 2090
            +IIW+RP  L   PCL++ ++ +       G  +P W PI+I+LLK +N+  LVV ++  Q+ FN+          SY G F+F+F        ++IDD+LP     +  L   S+N EEFLP+L+EKAYA+FLGGY  L+   FL  +M+FTG + ES+            ++K+L + + S    V+     N  +E     + + P  +N    A     H YLI+GFTEIPL     LV  +++ F +        I L+ L +   NG  +  + V +  W+     V++ + L+ N+  E WIT++  +   K  +L H+ + + +    K    W     +  +    P    K +  EFLKN+QYLI V       +K VLT  N+ K +           +T   + L +VE NRLYR+HDL +++    +   + G    ++  L +G+Y++IPW    S  +Y L+++SS   +  + L  + P    C  C +  T     NR + L + S +  +P+      +     C  C    P+ A RI+++ A  +       L     N +F I   N  Y SN    +  PQW+E F+ YR      +++I+LF E ++G       + FSE +L +D+    L I
Sbjct:   41 EIIWKRPIDLVDDPCLLETYDQEIDGYIICGSQTPAWFPIVITLLKTKNILHLVVKDIKKQDNFNKS---------SYIGCFEFSFFGKNMWTTILIDDKLPHIAGENKSLYCVSSNKEEFLPSLLEKAYARFLGGYGKLQTVDFLDVLMNFTGGIVESVDLKRNISLLTYQEQKILFKKLRSSVSDVMVIGLTNSNQEE----KTDFPEDNNNFVLAHD---HYYLISGFTEIPLQSNLNLVGTVISSFLDIHNH--ECINLLRLHNPVLNGDWNGAFSVGSPEWEGINESVRRVFNLKFNHEFEFWITMKDFIRNMKNIILCHIPSYSYVDRFLKGVKVWSSFHHNGIYSSLIPGGSIKSLDDEFLKNDQYLIEVYNQNLIEMKFVLTMNNIDKSLRY---------DTGCCLTLLKVESNRLYRLHDLQNSEISNLRLLSESGSMYSVSTTLCKGKYILIPWRKEISEVEYYLRIYSSQKSINISLLLLNQPPFVQCLKCSLVNTIL---NRKEFLNNVSGNCESPN-----DSFTKHRCSSCFSVNPQSAVRITIVSAYGLESNEDNILNTRSVNSYFVIKYPNFTYRSNTKYLSNKPQWNESFIVYRNAKQRDDISIELFAEQRIGFDKSFGIHYFSETDLCKDEIVAGLRI 662          
BLAST of Calpain-5 vs. Planmine SMEST
Match: SMESG000017238.1 (SMESG000017238.1)

HSP 1 Score: 111.309 bits (277), Expect = 7.494e-25
Identity = 122/482 (25.31%), Postives = 203/482 (42.12%), Query Frame = 3
Query:  120 LYEDPNFPASYDILFSKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARFH--PGKLSPFWLPILISLLKERNM-FELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVV-NMTKESFGICQIELPPQ-SNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVIRLMS-LSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKLLDISKCSVLFHMFNRNSIIALAK--KQLYWKYVSFDHFWHRDGPRRGPKVIGQEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNT--QIGIELFEVEKNR---LYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIP 1526
            LYED +FPA+ + ++   NK     +  W+RP ++   P   +F    ++RF    G+L   WL   ++ L  + M F  V PN         + F        YCG F F F   G+ + +IIDDRLPT  +  L+ + S ++ EF  AL+EKAYAK  G Y  L+  S   A+ DFTG + E I    D +  +E     +Q ++ + +K S   C I+  P+ +  K        H Y IT   +I    P           YN  G ++ ++R+ +     E NG        +W   +   +   GL  +N  E W++    ++  +   + H+  ++   +L K   +  W+       W +     G     + F  N Q+ I+V  P+      + T +   ++    +I+  GN    IG  L+++       L +V      ++V     F   R +     L  G Y +IP
Sbjct:  105 LYEDEDFPANGESIYFTSNK---GGNFQWKRPHEICSDP---QFFVGGASRFDVCQGELGDCWLLAAVASLSMQTMLFSQVAPN--------DQSF----AKGKYCGAFHFNFWHYGEWKEIIIDDRLPTR-NNRLVFMHSRDSNEFWSALLEKAYAKLCGSYELLKGGSSSEAMEDFTGGITEIIDLKGDNRKNNESKEKLFQIMIQSHSKMSLMGCSIDANPKVTEAKLGNGLIMGHAYSITAVKQISAKVPG----------YN--GDIIKLVRIRNPWGQSEWNGEWGDS-SDSWHHISDKERGVLGLNFDNDGEFWMSFNDFVNNFEKLEICHLGPQSVGESLLKNSNKRTWESSVQQGAWKKGASAGGCLNFQETFWSNPQFRIVVTDPDKDDTDNMGTVIIGLLQKNMRSIKNRGNDLFPIGYVLYKLPSTDCGPLDKVF-FRTNRKVAMSPAFINMREVCGRHRLPPGSYAIIP 553          
BLAST of Calpain-5 vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.650e-22
Identity = 93/274 (33.94%), Postives = 135/274 (49.27%), Query Frame = 3
Query:   87 SELLRHPDGVA-LYEDPNFPASYDILF-SKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARF--HPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLL 890
            S++L H  G   L+EDP+FPA    +F SK +K +   +  W+RP  + K P L     D  +RF    G L   WL  ++ SL     +F+ VVP  ++Q+              +Y G F+F F R GK   V++DDRLPT     L+ + S +N EF  AL+EKAYAK  G Y  L   S + A+ DFTG L E+I   ++EK   E     Y +++   K+S  + C IE        ++   S  H Y IT   ++     DG V +L+
Sbjct:   53 SDILEHLKGTGKLWEDPDFPADTSSVFVSKASKGY--REFEWKRPKDICKNPQLFA---DGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVP--TDQD-----------FDKNYIGAFRFRFWRFGKWVEVVVDDRLPT-YRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETI--KLNEK---ERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISG-HAYSITDVQKVK--QTDGTVVELV 299          
BLAST of Calpain-5 vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.783e-22
Identity = 93/274 (33.94%), Postives = 135/274 (49.27%), Query Frame = 3
Query:   87 SELLRHPDGVA-LYEDPNFPASYDILF-SKPNKEFISNDIIWRRPGQLSKLPCLMKFNNDQSARF--HPGKLSPFWL-PILISLLKERNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVIIDDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTAIMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGI-CQIELPPQSNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLL 890
            S++L H  G   L+EDP+FPA    +F SK +K +   +  W+RP  + K P L     D  +RF    G L   WL  ++ SL     +F+ VVP  ++Q+              +Y G F+F F R GK   V++DDRLPT     L+ + S +N EF  AL+EKAYAK  G Y  L   S + A+ DFTG L E+I   ++EK   E     Y +++   K+S  + C IE        ++   S  H Y IT   ++     DG V +L+
Sbjct:   53 SDILEHLKGTGKLWEDPDFPADTSSVFVSKASKGY--REFEWKRPKDICKNPQLFA---DGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVP--TDQD-----------FDKNYIGAFRFRFWRFGKWVEVVVDDRLPT-YRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETI--KLNEK---ERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISG-HAYSITDVQKVK--QTDGTVVELV 299          
The following BLAST results are available for this feature:
BLAST of Calpain-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN51.444e-3925.89calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482][more]
CAPN51.444e-3925.89calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482][more]
CAPN51.444e-3925.89calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482][more]
CAPN58.663e-3424.53calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482][more]
CAPN66.158e-3325.19calpain 6 [Source:HGNC Symbol;Acc:HGNC:1483][more]
back to top
BLAST of Calpain-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clp-76.904e-2524.81CaLPain family [Source:UniProtKB/TrEMBL;Acc:U4PMH... [more]
clp-76.904e-2524.81CaLPain family [Source:UniProtKB/TrEMBL;Acc:U4PMH... [more]
clp-63.258e-2025.36CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q9N4B... [more]
clp-44.495e-2028.03CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q8IAA... [more]
clp-14.760e-2025.39Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
back to top
BLAST of Calpain-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CalpA3.878e-2225.60gene:FBgn0012051 transcript:FBtr0086530[more]
CalpA1.513e-2125.60gene:FBgn0012051 transcript:FBtr0340532[more]
CalpA1.524e-2125.60gene:FBgn0012051 transcript:FBtr0112869[more]
CalpA1.524e-2125.60gene:FBgn0012051 transcript:FBtr0086529[more]
CalpB4.634e-1923.32gene:FBgn0025866 transcript:FBtr0076343[more]
back to top
BLAST of Calpain-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX324225.22.800e-3525.32calpain 5b [Source:NCBI gene;Acc:100006332][more]
capn5b3.041e-3525.32calpain 5b [Source:ZFIN;Acc:ZDB-GENE-091116-29][more]
capn5a8.289e-3325.54calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214][more]
capn5a8.289e-3325.54calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214][more]
BX324225.21.072e-3123.89calpain 5b [Source:NCBI gene;Acc:100006332][more]
back to top
BLAST of Calpain-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppa25.523e-3426.94pyrophosphatase (inorganic) 2 [Source:Xenbase;Acc:... [more]
ppa21.450e-3225.81pyrophosphatase (inorganic) 2 [Source:Xenbase;Acc:... [more]
icmt4.037e-2624.36isoprenylcysteine carboxyl methyltransferase [Sour... [more]
icmt8.628e-2524.31isoprenylcysteine carboxyl methyltransferase [Sour... [more]
icmt1.045e-2424.31isoprenylcysteine carboxyl methyltransferase [Sour... [more]
back to top
BLAST of Calpain-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capn59.380e-4125.23calpain 5 [Source:MGI Symbol;Acc:MGI:1100859][more]
Capn59.380e-4125.23calpain 5 [Source:MGI Symbol;Acc:MGI:1100859][more]
Capn61.690e-3325.26calpain 6 [Source:MGI Symbol;Acc:MGI:1100850][more]
Capn91.921e-1628.06calpain 9 [Source:MGI Symbol;Acc:MGI:1920897][more]
Capn23.506e-1625.06calpain 2 [Source:MGI Symbol;Acc:MGI:88264][more]
back to top
BLAST of Calpain-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O08688|CAN5_MOUSE6.561e-4025.23Calpain-5 OS=Mus musculus OX=10090 GN=Capn5 PE=1 S... [more]
sp|O15484|CAN5_HUMAN6.933e-3925.89Calpain-5 OS=Homo sapiens OX=9606 GN=CAPN5 PE=1 SV... [more]
sp|Q8R4C0|CAN5_RAT9.652e-3925.15Calpain-5 OS=Rattus norvegicus OX=10116 GN=Capn5 P... [more]
sp|O35646|CAN6_MOUSE1.182e-3225.26Calpain-6 OS=Mus musculus OX=10090 GN=Capn6 PE=1 S... [more]
sp|O88501|CAN6_RAT2.539e-3225.11Calpain-6 OS=Rattus norvegicus OX=10116 GN=Capn6 P... [more]
back to top
BLAST of Calpain-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A091E4X56.504e-3926.12Calpain-5 OS=Fukomys damarensis OX=885580 GN=H920_... [more]
A0A485NT488.214e-3925.81Calpain-5-like OS=Lynx pardinus OX=191816 GN=LYPA_... [more]
A0A337SKD28.214e-3925.81Calpain 5 OS=Felis catus OX=9685 GN=CAPN5 PE=3 SV=... [more]
A0A1L5BWZ92.194e-3825.35Calpain-5 OS=Castor fiber OX=10185 GN=CAPN5 PE=2 S... [more]
L8IUH02.404e-3825.66Calpain-5 (Fragment) OS=Bos mutus OX=72004 GN=M91_... [more]
back to top
BLAST of Calpain-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn5a1.101e-3525.85calpain 5 [Source:NCBI gene;Acc:103038917][more]
capn5b1.822e-3224.56calpain-5-like [Source:NCBI gene;Acc:103035636][more]
capn5b2.299e-3224.60calpain-5-like [Source:NCBI gene;Acc:103035636][more]
ENSAMXT00000048279.11.061e-2923.56pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050823.11.444e-2823.46pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Calpain-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn1a1.787e-1629.45calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc... [more]
capn3a9.811e-1430.00calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
ENSPMAT00000000152.18.267e-1344.44pep scaffold:Pmarinus_7.0:GL488881:291:5685:-1 gen... [more]
capn91.434e-1024.15calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
ENSPMAT00000003998.11.770e-944.30pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 g... [more]
back to top
BLAST of Calpain-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calpain-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO348606.374e-2524.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486332.923e-1726.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401931.994e-1423.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485367.402e-833.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calpain-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002598.21.831e-3926.42calpain-5 [Source:NCBI gene;Acc:101166153][more]
capn5b1.537e-3524.96calpain 5 [Source:NCBI gene;Acc:101155135][more]
capn5b1.948e-3424.77calpain 5 [Source:NCBI gene;Acc:101155135][more]
ENSORLT00000034978.14.048e-3325.34calpain-5 [Source:NCBI gene;Acc:101158220][more]
ENSORLT00000039414.13.329e-3225.20calpain-5 [Source:NCBI gene;Acc:101158220][more]
back to top
BLAST of Calpain-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012000.10.000e+099.72SMESG000012000.1[more]
SMESG000078391.14.316e-6929.22SMESG000078391.1[more]
SMESG000017238.17.494e-2525.31SMESG000017238.1[more]
SMESG000062904.12.650e-2233.94SMESG000062904.1[more]
SMESG000062904.12.783e-2233.94SMESG000062904.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017727 ID=SMED30017727|Name=Calpain-5|organism=Schmidtea mediterranea sexual|type=transcript|length=2463bp
TAATTTTCAGAAAATTAATTTATTAAATTAAAATGAGTGATGCTGTTGAA
TCTCAGATGAGTTCACCAAATTTTTTAAAATTAAAATCAGAATTACTGAG
ACATCCAGATGGAGTGGCACTTTATGAAGATCCTAATTTCCCAGCAAGCT
ATGATATTCTCTTTAGCAAACCAAATAAAGAGTTTATTAGCAATGACATA
ATCTGGCGAAGACCGGGACAACTGAGCAAGCTTCCTTGTTTGATGAAATT
CAACAACGATCAATCAGCAAGATTTCATCCGGGTAAATTATCGCCATTTT
GGCTCCCAATTCTCATTTCTCTACTGAAAGAAAGGAACATGTTTGAATTA
GTGGTTCCAAATCTATCCAATCAAAACACGTTCAACCAGGAGCCATTCAT
TATAACCCCTGTGAGCATGAGCTATTGTGGAACTTTTCAATTCACGTTTC
GGCGTGGCGGAAAATTGGAGCATGTGATCATTGATGACCGACTACCAACC
ACAGTCAGCTGCCATTTACTATCGATATCTTCAAATAACAACGAAGAATT
CTTGCCGGCTCTCATTGAAAAGGCTTATGCCAAATTTCTTGGAGGATATT
ACTGTTTGGAAAAGGAAAGCTTCTTGACTGCAATTATGGATTTCACAGGA
GTTTTAGGAGAATCTATATGTAAAAGTGTTGATGAAAAAGTTCTTTCTGA
ACATATCACTAGTTTTTATCAGAAAGTTGTAAATATGACTAAAGAGTCTT
TTGGAATCTGTCAAATAGAATTGCCACCCCAATCAAATAAAAAATCATCT
GCAAAAAGTTCACCTTATCATGTATATTTAATCACAGGCTTCACAGAAAT
TCCTCTAGATCCTCCGGACGGGCTTGTTAATGATTTATTAAACTATTTCT
ATAATTCACGAGGCTCCCTTGTTCCAGTGATACGTTTAATGTCTCTGTCT
GATTGTGAGGAAAATGGGATCATAGATAAATATGTTGTGAAAACATGGCA
AAAGTGCACAACTTTGGTTAAAAAAAAGTACGGCTTAGAATGTAATAATG
GAAAGGAGCATTGGATAACTGTGGAAAAATTGCTTGATATAAGCAAATGT
TCTGTTCTTTTTCACATGTTTAATCGCAATTCGATTATTGCACTCGCCAA
AAAGCAATTATATTGGAAGTATGTCTCCTTTGATCATTTTTGGCATAGAG
ACGGTCCAAGGAGGGGTCCAAAAGTTATTGGCCAAGAGTTTCTAAAAAAT
AACCAATATCTGATAATGGTGCCCCAGCCAGAGACGTGCTGTATAAAAAT
GGTACTCACAAATGTGCAGAAATATGTTGAAGTAGGTGCAAACGCGATTC
AGACAGCCGGTAATACACAAATAGGAATCGAGTTGTTTGAAGTTGAGAAA
AATAGATTGTATAGAGTTCATGATTTGAACCATACGAAACAAGTGACATG
TCAAACTGATTTCCAACAAGGACGATATATAGTAATAACTGCATATTTAG
AAAGAGGTCGCTATGTTGTTATACCTTGGATTGCAGCAGGCAGCGGAACA
AAATATACGTTACAAGTGTTTTCATCTGACAATCGTGTAGAAACTACATT
TCTCGAATTTGACATTCCAGAACAGCAGCTGTGCACGCCTTGCCAAATTA
AACAAACGGCCTACCGCACCCAAAACAGATTTAAATCGCTTTATGATCGT
TCTACTTCGGAATATACGCCTTCATCTCAGAGAAAAGTTTCAACAATCCA
GCCAGATATATGCCAGGAATGTCGGGAATATTATCCGAAACGCGCAACGA
GAATATCAGTGATTGGTGCCACAGATATTCGTTTGACCGCTACTTATCAA
CTACCGAATTTCTTTTTCAAAATATCCTGTGAAAATGAGCTTTACATTTC
AAATTTGGTAAGTTCTACCTTGAGCCCTCAATGGGACGAACATTTTCTTT
TCTATCGCATCAACAACGATTTCTCCGAAGTGAATATTCAGCTATTCTGC
GAGAACAAACTGGGACTGAAATCAAGAATTTTTGATTATACATTCTCGGA
GAAAGAACTGCGAGATAAATGCCGAGTTAGTCTTCCAATTCAGGACGACA
TAAGTCCCGAAAATGAATCCGAAGAGAATAGAATTATAATTGAAATAGAA
AACTATTTTCTCTCTGAATTTAATAGAGCATAACATTTGGATTTGTGTTT
GATTGGTTATTAGACGATTATAGCTTGACTATTTCATTAAACTCTTCATG
ACAATGGTTTGCCATTTTACATGTGGTTTCAAGGATTGTTGACTTTATGA
GTATATATTCCGTGATGGTGATTTCACATACAAATAAACATTAACTATTT
GCGCTTATTGTCAAACGGTTGAATTTATTTTTTACATAGAGAGCTGCTTT
TAAATATAACCAAGACTTATTTTTACTTTTTAGACACTGTTAGTCATTTC
TAGATGAATAAAG
back to top

protein sequence of SMED30017727-orf-1

>SMED30017727-orf-1 ID=SMED30017727-orf-1|Name=SMED30017727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=717bp
MSDAVESQMSSPNFLKLKSELLRHPDGVALYEDPNFPASYDILFSKPNKE
FISNDIIWRRPGQLSKLPCLMKFNNDQSARFHPGKLSPFWLPILISLLKE
RNMFELVVPNLSNQNTFNQEPFIITPVSMSYCGTFQFTFRRGGKLEHVII
DDRLPTTVSCHLLSISSNNNEEFLPALIEKAYAKFLGGYYCLEKESFLTA
IMDFTGVLGESICKSVDEKVLSEHITSFYQKVVNMTKESFGICQIELPPQ
SNKKSSAKSSPYHVYLITGFTEIPLDPPDGLVNDLLNYFYNSRGSLVPVI
RLMSLSDCEENGIIDKYVVKTWQKCTTLVKKKYGLECNNGKEHWITVEKL
LDISKCSVLFHMFNRNSIIALAKKQLYWKYVSFDHFWHRDGPRRGPKVIG
QEFLKNNQYLIMVPQPETCCIKMVLTNVQKYVEVGANAIQTAGNTQIGIE
LFEVEKNRLYRVHDLNHTKQVTCQTDFQQGRYIVITAYLERGRYVVIPWI
AAGSGTKYTLQVFSSDNRVETTFLEFDIPEQQLCTPCQIKQTAYRTQNRF
KSLYDRSTSEYTPSSQRKVSTIQPDICQECREYYPKRATRISVIGATDIR
LTATYQLPNFFFKISCENELYISNLVSSTLSPQWDEHFLFYRINNDFSEV
NIQLFCENKLGLKSRIFDYTFSEKELRDKCRVSLPIQDDISPENESEENR
IIIEIENYFLSEFNRA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR038765Papain-like_cys_pep_sf
IPR036213Calpain_III_sf
IPR022684Calpain_cysteine_protease
IPR001300Peptidase_C2_calpain_cat
IPR022682Calpain_domain_III
IPR000008C2_dom
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004198calcium-dependent cysteine-type endopeptidase activity
GO:0005515protein binding
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
GO:0005925focal adhesion
GO:0009986cell surface
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022684Peptidase C2, calpain familyPRINTSPR00704CALPAINcoord: 58..80
score: 20.43
coord: 187..214
score: 32.62
coord: 162..185
score: 52.92
IPR001300Peptidase C2, calpain, catalytic domainSMARTSM00230cys_prot_2coord: 9..290
e-value: 2.7E-7
score: -72.0
IPR001300Peptidase C2, calpain, catalytic domainPFAMPF00648Peptidase_C2coord: 31..350
e-value: 5.3E-32
score: 111.0
IPR001300Peptidase C2, calpain, catalytic domainPROSITEPS50203CALPAIN_CATcoord: 30..352
score: 24.909
NoneNo IPR availableGENE3DG3DSA:2.60.120.380coord: 377..521
e-value: 1.4E-11
score: 46.6
NoneNo IPR availablePANTHERPTHR10183:SF381CALPAIN-6coord: 14..537
NoneNo IPR availablePANTHERPTHR10183CALPAINcoord: 14..537
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 590..684
IPR022682Peptidase C2, calpain, large subunit, domain IIIPFAMPF01067Calpain_IIIcoord: 400..516
e-value: 6.1E-11
score: 42.8
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 573..695
e-value: 2.2E-6
score: 29.5
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 20..351
IPR036213Calpain large subunit, domain III superfamilySUPERFAMILYSSF49758Calpain large subunit, middle domain (domain III)coord: 378..515