Kinesin-like protein KIF1A

Overview
NameKinesin-like protein KIF1A
Smed IDSMED30017722
Length (bp)5846
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin-like protein KIF1A (SMED30017722) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin-like protein KIF1A (SMED30017722) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin-like protein KIF1A (SMED30017722) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin-like protein KIF1A (SMED30017722) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017722

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017722SMESG000071414.1 SmedASXL_017647SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30017722SMESG000071414.1 dd_Smed_v4_7108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017722SMESG000071414.1 dd_Smed_v4_7108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017722SMESG000071414.1 dd_Smed_v6_7108_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30017722SMESG000071414.1 OX_Smed_1.0.22462ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin-like protein KIF1A vs. Ensembl Human
Match: KIF1A (kinesin family member 1A [Source:HGNC Symbol;Acc:HGNC:888])

HSP 1 Score: 1289.63 bits (3336), Expect = 0.000e+0
Identity = 737/1509 (48.84%), Postives = 958/1509 (63.49%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HCVF  +        VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  +I      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P          +         D  + +   G  D  L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + YI    D+R  ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  +TKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL  A R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGRED--GERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVIEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEVNNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLTRPCPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDESLIDPNILSLNILSSGYIHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVVTKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRASESNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETAQR 1406          

HSP 2 Score: 123.25 bits (308), Expect = 3.111e-27
Identity = 66/149 (44.30%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    + W +R+VVVRRP+ Y+Y  +KD VER ++NLATAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1563 LVPDIQEIRVSPIVSKKGYLHFLEPHT-SGWARRFVVVRRPYAYMYNSDKDTVERFVLNLATAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQAASD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1686          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Human
Match: KIF1A (kinesin family member 1A [Source:HGNC Symbol;Acc:HGNC:888])

HSP 1 Score: 1289.63 bits (3336), Expect = 0.000e+0
Identity = 737/1509 (48.84%), Postives = 958/1509 (63.49%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HCVF  +        VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  +I      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P          +         D  + +   G  D  L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + YI    D+R  ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  +TKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL  A R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGRED--GERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVIEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEVNNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLTRPCPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDESLIDPNILSLNILSSGYIHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVVTKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRASESNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETAQR 1406          

HSP 2 Score: 123.25 bits (308), Expect = 3.111e-27
Identity = 66/149 (44.30%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    + W +R+VVVRRP+ Y+Y  +KD VER ++NLATAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1563 LVPDIQEIRVSPIVSKKGYLHFLEPHT-SGWARRFVVVRRPYAYMYNSDKDTVERFVLNLATAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQAASD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1686          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Human
Match: KIF1A (kinesin family member 1A [Source:HGNC Symbol;Acc:HGNC:888])

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 737/1517 (48.58%), Postives = 959/1517 (63.22%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERI--------MFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HCVF  +        VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  +I      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P          +         D  + +   G  D  L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + YI    D+R+         ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  +TKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL  A R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGRED--GERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVIEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEVNNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLTRPCPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDESLIDPNILSLNILSSGYIHPAQDDRVSLGNDTRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVVTKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRASESNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETAQR 1414          

HSP 2 Score: 123.635 bits (309), Expect = 2.939e-27
Identity = 66/149 (44.30%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    + W +R+VVVRRP+ Y+Y  +KD VER ++NLATAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1571 LVPDIQEIRVSPIVSKKGYLHFLEPHT-SGWARRFVVVRRPYAYMYNSDKDTVERFVLNLATAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQAASD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1694          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Human
Match: KIF1A (kinesin family member 1A [Source:HGNC Symbol;Acc:HGNC:888])

HSP 1 Score: 1282.32 bits (3317), Expect = 0.000e+0
Identity = 737/1518 (48.55%), Postives = 958/1518 (63.11%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDE---------RIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HCVF  +        VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  +I      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P          +         D  + +   G  D  L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + YI    D+         R  ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  +TKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL  A R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGRED--GERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVIEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEVNNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLTRPCPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDESLIDPNILSLNILSSGYIHPAQDDRQFLDSDIPRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVVTKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRASESNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETAQR 1415          

HSP 2 Score: 123.635 bits (309), Expect = 2.990e-27
Identity = 66/149 (44.30%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    + W +R+VVVRRP+ Y+Y  +KD VER ++NLATAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1572 LVPDIQEIRVSPIVSKKGYLHFLEPHT-SGWARRFVVVRRPYAYMYNSDKDTVERFVLNLATAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQAASD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1695          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Human
Match: KIF1A (kinesin family member 1A [Source:HGNC Symbol;Acc:HGNC:888])

HSP 1 Score: 1280.39 bits (3312), Expect = 0.000e+0
Identity = 734/1539 (47.69%), Postives = 956/1539 (62.12%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAEL----------NETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEP------------ITDNGEAEN------------------SSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L          NETWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HCVF  +        VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  +I      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P          +         D  + +   G  D  L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE             +   G  ++                  S +          GR+R+ PE  +      +LSLN+L + YI    D+R  ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  +TKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL  A R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGRED--GERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVIEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEVNNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLTRPCPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHETGSHIRWKEVRELVVAPGGGQHLGRPWPADASLHFRRLLLSCVFLWPFLLRTPGRIRNTPETDESLIDPNILSLNILSSGYIHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVVTKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRASESNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETAQR 1444          

HSP 2 Score: 122.865 bits (307), Expect = 4.153e-27
Identity = 66/149 (44.30%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    + W +R+VVVRRP+ Y+Y  +KD VER ++NLATAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1601 LVPDIQEIRVSPIVSKKGYLHFLEPHT-SGWARRFVVVRRPYAYMYNSDKDTVERFVLNLATAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQAASD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1724          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 880.937 bits (2275), Expect = 0.000e+0
Identity = 489/947 (51.64%), Postives = 645/947 (68.11%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK-KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQV-VKASMISADDYLSDDENY---------EPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            MSSVKVAVRVRPFN REIS  +KC++ + G+TT I   S  +   SF FD+SY S    D +F+ Q++VY +LG + LEHA EGYNVCI AYGQTG+GKSY+MMGK  D D+ GIIP+LC  LF R+D+    N+D+   +Q+++EVSYMEIYCERV+DLLNP +  NLRVREHPLLGPYV+DL+K  V S+ DI  L+D GNK+RTVAATNMN TSSRSHAVFTI+L+Q+    D  L  EK SKISLVDLAGSERA+STGA+G RLKEGANINKSLTTLG VIS LAE S    + KKK     IP+RDSVLTWLLRENLGGNSKTAML A+SPADIN++ETLS+LRYADRAKQIVC+AV+NEDPN +L+REL EEV+KLR ILK + I+V +          ++E         ++    ++  +EKL+ SEKL+AE+ +TWE KL  TE++RKQR+ EL ++G+    DG   GVFS KK P+LVNLNED LM+ECL+YYLK+G T VG+PE     + DI LSG+ I+ +HC F  E  +VTLT   +A CY+NGK++   T L +  R+I G++HVFR+N+P  A+ SR     + E P   +DW +A  ELL+KQG+DL+ +ME +++ +E Q+++EK E ++    Q +EYE  I+ L++QV +  S IS    + + E           E   W+  Q ++   A  KW++HQ+TS+R             DDLW N +F+KEANA+S EL KKV FQFALLT+T YSP+      +     ++++   P                                   KT + I+V+D+KNGA HYW + K ++RL+ +R++Y+ +AEM  A  D M    ++++ G DPFYDRFPWF++VGR+FV+L+NLL+NVPLIH+VAVVNEKGEVKG L+VAI+P+
Sbjct:    1 MSSVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWSFARNDPHFITQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDN----NNDKD--VQYSVEVSYMEIYCERVKDLLNPNSGGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEES----TKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTD----------VQETPGKHKKGPKLPAHVHEQ-LEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGRPEA--EHRPDILLSGEAILELHCEFINEDGNVTLTMKPNASCYINGKQVTTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQP---IDWKYAQQELLDKQGIDLKADMEKKMLEMESQYRREKVELEQKMYHQTREYESMIENLQKQVDLAQSYISGGGSIWEGERMLTSSLLEFPEELKWTSDQKRVVLKAAIKWRYHQFTSVR-------------DDLWGNAIFVKEANAISVELKKKVQFQFALLTDTMYSPLPP---DLLPPGEDLTLRPYP-----------------------------------KTVVAIQVQDLKNGATHYWSIEKLKQRLEAMRDMYETDAEMSPADGDPM----MDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPV 866          

HSP 2 Score: 306.605 bits (784), Expect = 5.832e-84
Identity = 174/415 (41.93%), Postives = 255/415 (61.45%), Query Frame = 2
Query: 3257 FCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSS---KRAKSFLHTNQP---LPTPVPSQKEEIYNNPLE---GTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVE 4465
            FCFRV +LQ   ++  Y+D FCQ++FL++ ++ +STEP+KN    +P+ F H QN  + +++ F+ Y+ ++ I FE+F H +P+       + E Q+S   +R  + L   QP   + TPV S+K    N P++    ++  ++DLLVWFEI EL+ NGEYV   VDH+   P HG+F++HQ +QRR  +TI HE     GE     L +   +E+VVGR+R  PE+   DD   VLSL L P  ++    D+R  F+FEAAWDSSLH S LLN ++   + I++T+S Y++++ C +P  +TKD CL++  RDS++S   R         RS +G   K+ ++NRV G+Y L LK      S    RR +R  + +S YVRGEEN+  WRPR DSLI +HQW+LEKLT+LQ VE
Sbjct:  918 FCFRVVVLQAIDVADTYSDVFCQFNFLHRHDEAFSTEPMKN--SKSPLTFEHTQNLHIKMSKTFLHYLHHFPIIFEVFGHFQPK---SEQFNFERQNSALGRRLSTKLTFQQPSLVISTPVKSKKA---NAPIQNNNASVKSKHDLLVWFEICELANNGEYVPTIVDHAQGLPTHGIFLLHQGIQRRIKITICHE----KGE-----LKWKDCQELVVGRIRAGPEWAGGDDVD-VLSLGLFPGTFMEFSMDDRTFFQFEAAWDSSLHNSPLLNRVSNYGDQIYMTLSAYMELDGCAQPAVVTKDLCLLIYARDSKISAASR-------FCRSLVGGISKSPEMNRVPGVYQLCLKDGSDSGSPGAIRRQRRVLDTSSAYVRGEENLGQWRPRGDSLIFEHQWELEKLTRLQQVE 1307          

HSP 3 Score: 97.8265 bits (242), Expect = 6.902e-20
Identity = 54/140 (38.57%), Postives = 81/140 (57.86%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIR 5485
            LV E  E R+  V+S+KGY+N LEE K   W +RWV+VRRP++ ++  ++D V RGIINLA A+I+++                 +  A    P +      FS+    R +L+Q +  D  E++DWLYA NPL+AGQ++
Sbjct: 1448 LVPEVLEERVGVVVSKKGYMNFLEE-KTQGWTRRWVIVRRPYILLFRDDRDLVIRGIINLANARIEHSE----------------DQQAMVKVPNT------FSVCTNQRGFLMQMMPGD--EMYDWLYAINPLMAGQMK 1562          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 880.937 bits (2275), Expect = 0.000e+0
Identity = 489/947 (51.64%), Postives = 645/947 (68.11%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK-KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQV-VKASMISADDYLSDDENY---------EPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            MSSVKVAVRVRPFN REIS  +KC++ + G+TT I   S  +   SF FD+SY S    D +F+ Q++VY +LG + LEHA EGYNVCI AYGQTG+GKSY+MMGK  D D+ GIIP+LC  LF R+D+    N+D+   +Q+++EVSYMEIYCERV+DLLNP +  NLRVREHPLLGPYV+DL+K  V S+ DI  L+D GNK+RTVAATNMN TSSRSHAVFTI+L+Q+    D  L  EK SKISLVDLAGSERA+STGA+G RLKEGANINKSLTTLG VIS LAE S    + KKK     IP+RDSVLTWLLRENLGGNSKTAML A+SPADIN++ETLS+LRYADRAKQIVC+AV+NEDPN +L+REL EEV+KLR ILK + I+V +          ++E         ++    ++  +EKL+ SEKL+AE+ +TWE KL  TE++RKQR+ EL ++G+    DG   GVFS KK P+LVNLNED LM+ECL+YYLK+G T VG+PE     + DI LSG+ I+ +HC F  E  +VTLT   +A CY+NGK++   T L +  R+I G++HVFR+N+P  A+ SR     + E P   +DW +A  ELL+KQG+DL+ +ME +++ +E Q+++EK E ++    Q +EYE  I+ L++QV +  S IS    + + E           E   W+  Q ++   A  KW++HQ+TS+R             DDLW N +F+KEANA+S EL KKV FQFALLT+T YSP+      +     ++++   P                                   KT + I+V+D+KNGA HYW + K ++RL+ +R++Y+ +AEM  A  D M    ++++ G DPFYDRFPWF++VGR+FV+L+NLL+NVPLIH+VAVVNEKGEVKG L+VAI+P+
Sbjct:    1 MSSVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWSFARNDPHFITQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDN----NNDKD--VQYSVEVSYMEIYCERVKDLLNPNSGGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEES----TKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTD----------VQETPGKHKKGPKLPAHVHEQ-LEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGRPEA--EHRPDILLSGEAILELHCEFINEDGNVTLTMKPNASCYINGKQVTTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQP---IDWKYAQQELLDKQGIDLKADMEKKMLEMESQYRREKVELEQKMYHQTREYESMIENLQKQVDLAQSYISGGGSIWEGERMLTSSLLEFPEELKWTSDQKRVVLKAAIKWRYHQFTSVR-------------DDLWGNAIFVKEANAISVELKKKVQFQFALLTDTMYSPLPP---DLLPPGEDLTLRPYP-----------------------------------KTVVAIQVQDLKNGATHYWSIEKLKQRLEAMRDMYETDAEMSPADGDPM----MDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPV 866          

HSP 2 Score: 306.605 bits (784), Expect = 5.832e-84
Identity = 174/415 (41.93%), Postives = 255/415 (61.45%), Query Frame = 2
Query: 3257 FCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSS---KRAKSFLHTNQP---LPTPVPSQKEEIYNNPLE---GTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVE 4465
            FCFRV +LQ   ++  Y+D FCQ++FL++ ++ +STEP+KN    +P+ F H QN  + +++ F+ Y+ ++ I FE+F H +P+       + E Q+S   +R  + L   QP   + TPV S+K    N P++    ++  ++DLLVWFEI EL+ NGEYV   VDH+   P HG+F++HQ +QRR  +TI HE     GE     L +   +E+VVGR+R  PE+   DD   VLSL L P  ++    D+R  F+FEAAWDSSLH S LLN ++   + I++T+S Y++++ C +P  +TKD CL++  RDS++S   R         RS +G   K+ ++NRV G+Y L LK      S    RR +R  + +S YVRGEEN+  WRPR DSLI +HQW+LEKLT+LQ VE
Sbjct:  918 FCFRVVVLQAIDVADTYSDVFCQFNFLHRHDEAFSTEPMKN--SKSPLTFEHTQNLHIKMSKTFLHYLHHFPIIFEVFGHFQPK---SEQFNFERQNSALGRRLSTKLTFQQPSLVISTPVKSKKA---NAPIQNNNASVKSKHDLLVWFEICELANNGEYVPTIVDHAQGLPTHGIFLLHQGIQRRIKITICHE----KGE-----LKWKDCQELVVGRIRAGPEWAGGDDVD-VLSLGLFPGTFMEFSMDDRTFFQFEAAWDSSLHNSPLLNRVSNYGDQIYMTLSAYMELDGCAQPAVVTKDLCLLIYARDSKISAASR-------FCRSLVGGISKSPEMNRVPGVYQLCLKDGSDSGSPGAIRRQRRVLDTSSAYVRGEENLGQWRPRGDSLIFEHQWELEKLTRLQQVE 1307          

HSP 3 Score: 97.8265 bits (242), Expect = 6.902e-20
Identity = 54/140 (38.57%), Postives = 81/140 (57.86%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIR 5485
            LV E  E R+  V+S+KGY+N LEE K   W +RWV+VRRP++ ++  ++D V RGIINLA A+I+++                 +  A    P +      FS+    R +L+Q +  D  E++DWLYA NPL+AGQ++
Sbjct: 1448 LVPEVLEERVGVVVSKKGYMNFLEE-KTQGWTRRWVIVRRPYILLFRDDRDLVIRGIINLANARIEHSE----------------DQQAMVKVPNT------FSVCTNQRGFLMQMMPGD--EMYDWLYAINPLMAGQMK 1562          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 490/994 (49.30%), Postives = 645/994 (64.89%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK-KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQV-VKASMISADDYLSDDENY---------EPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKF-----------------------------------------------RERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            MSSVKVAVRVRPFN REIS  +KC++ + G+TT I   S  +   SF FD+SY S    D +F+ Q++VY +LG + LEHA EGYNVCI AYGQTG+GKSY+MMGK  D D+ GIIP+LC  LF R+D+    N+D+   +Q+++EVSYMEIYCERV+DLLNP +  NLRVREHPLLGPYV+DL+K  V S+ DI  L+D GNK+RTVAATNMN TSSRSHAVFTI+L+Q+    D  L  EK SKISLVDLAGSERA+STGA+G RLKEGANINKSLTTLG VIS LAE S    + KKK     IP+RDSVLTWLLRENLGGNSKTAML A+SPADIN++ETLS+LRYADRAKQIVC+AV+NEDPN +L+REL EEV+KLR ILK + I+V +          ++E         ++    ++  +EKL+ SEKL+AE+ +TWE KL  TE++RKQR+ EL ++G+    DG   GVFS KK P+LVNLNED LM+ECL+YYLK+G T VG+PE     + DI LSG+ I+ +HC F  E  +VTLT   +A CY+NGK++   T L +  R+I G++HVFR+N+P  A+ SR     + E P   +DW +A  ELL+KQG+DL+ +ME +++ +E Q+++EK E ++    Q +EYE  I+ L++QV +  S IS    + + E           E   W+  Q ++   A  KW++HQ+TS+R             DDLW N +F+KEANA+S EL KKV FQFALLT+T YSP+      +     ++++   P                                   KT + I+V+D+KNGA HYW + K                                                R+RL+ +R++Y+ +AEM  A  D M    ++++ G DPFYDRFPWF++VGR+FV+L+NLL+NVPLIH+VAVVNEKGEVKG L+VAI+P+
Sbjct:    1 MSSVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWSFARNDPHFITQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDN----NNDKD--VQYSVEVSYMEIYCERVKDLLNPNSGGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEES----TKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTD----------VQETPGKHKKGPKLPAHVHEQ-LEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGRPEA--EHRPDILLSGEAILELHCEFINEDGNVTLTMKPNASCYINGKQVTTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQP---IDWKYAQQELLDKQGIDLKADMEKKMLEMESQYRREKVELEQKMYHQTREYESMIENLQKQVDLAQSYISGGGSIWEGERMLTSSLLEFPEELKWTSDQKRVVLKAAIKWRYHQFTSVR-------------DDLWGNAIFVKEANAISVELKKKVQFQFALLTDTMYSPLPP---DLLPPGEDLTLRPYP-----------------------------------KTVVAIQVQDLKNGATHYWSIEKLKQRLEDMRIFYNSELSVAGTPVDVPYPPVAEGWLAALNRNSARLIPDRQRLEAMRDMYETDAEMSPADGDPM----MDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPV 913          

HSP 2 Score: 310.457 bits (794), Expect = 4.073e-85
Identity = 173/412 (41.99%), Postives = 254/412 (61.65%), Query Frame = 2
Query: 3257 FCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSS---KRAKSFLHTNQP---LPTPVPSQKEEIYNNPLE---GTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVE 4465
            FCFRV +LQ   ++  Y+D FCQ++FL++ ++ +STEP+KN    +P+ F H QN  + +++ F+ Y+ ++ I FE+F H +P+       + E Q+S   +R  + L   QP   + TPV S+K    N P++    ++  ++DLLVWFEI EL+ NGEYV   VDH+   P HG+F++HQ +QRR  +TI HE     GE     L +   +E+VVGR+R  PE+   DD   VLSL L P  ++    D+R  F+FEAAWDSSLH S LLN ++   + I++T+S Y++++ C +P  +TKD CL++  RDS++S   R         RS +G   K+ ++NRV G+Y L LK        RR +R  + +S YVRGEEN+  WRPR DSLI +HQW+LEKLT+LQ VE
Sbjct:  965 FCFRVVVLQAIDVADTYSDVFCQFNFLHRHDEAFSTEPMKN--SKSPLTFEHTQNLHIKMSKTFLHYLHHFPIIFEVFGHFQPK---SEQFNFERQNSALGRRLSTKLTFQQPSLVISTPVKSKKA---NAPIQNNNASVKSKHDLLVWFEICELANNGEYVPTIVDHAQGLPTHGIFLLHQGIQRRIKITICHE----KGE-----LKWKDCQELVVGRIRAGPEWAGGDDVD-VLSLGLFPGTFMEFSMDDRTFFQFEAAWDSSLHNSPLLNRVSNYGDQIYMTLSAYMELDGCAQPAVVTKDLCLLIYARDSKISAASR-------FCRSLVGGISKSPEMNRVPGVYQLCLKDGSDSGAIRRQRRVLDTSSAYVRGEENLGQWRPRGDSLIFEHQWELEKLTRLQQVE 1351          

HSP 3 Score: 97.8265 bits (242), Expect = 7.911e-20
Identity = 54/140 (38.57%), Postives = 81/140 (57.86%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIR 5485
            LV E  E R+  V+S+KGY+N LEE K   W +RWV+VRRP++ ++  ++D V RGIINLA A+I+++                 +  A    P +      FS+    R +L+Q +  D  E++DWLYA NPL+AGQ++
Sbjct: 1492 LVPEVLEERVGVVVSKKGYMNFLEE-KTQGWTRRWVIVRRPYILLFRDDRDLVIRGIINLANARIEHSE----------------DQQAMVKVPNT------FSVCTNQRGFLMQMMPGD--EMYDWLYAINPLMAGQMK 1606          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Celegans
Match: unc-104 (Kinesin-like protein unc-104 [Source:UniProtKB/Swiss-Prot;Acc:P23678])

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 490/994 (49.30%), Postives = 645/994 (64.89%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK-KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQV-VKASMISADDYLSDDENY---------EPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKF-----------------------------------------------RERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            MSSVKVAVRVRPFN REIS  +KC++ + G+TT I   S  +   SF FD+SY S    D +F+ Q++VY +LG + LEHA EGYNVCI AYGQTG+GKSY+MMGK  D D+ GIIP+LC  LF R+D+    N+D+   +Q+++EVSYMEIYCERV+DLLNP +  NLRVREHPLLGPYV+DL+K  V S+ DI  L+D GNK+RTVAATNMN TSSRSHAVFTI+L+Q+    D  L  EK SKISLVDLAGSERA+STGA+G RLKEGANINKSLTTLG VIS LAE S    + KKK     IP+RDSVLTWLLRENLGGNSKTAML A+SPADIN++ETLS+LRYADRAKQIVC+AV+NEDPN +L+REL EEV+KLR ILK + I+V +          ++E         ++    ++  +EKL+ SEKL+AE+ +TWE KL  TE++RKQR+ EL ++G+    DG   GVFS KK P+LVNLNED LM+ECL+YYLK+G T VG+PE     + DI LSG+ I+ +HC F  E  +VTLT   +A CY+NGK++   T L +  R+I G++HVFR+N+P  A+ SR     + E P   +DW +A  ELL+KQG+DL+ +ME +++ +E Q+++EK E ++    Q +EYE  I+ L++QV +  S IS    + + E           E   W+  Q ++   A  KW++HQ+TS+R             DDLW N +F+KEANA+S EL KKV FQFALLT+T YSP+      +     ++++   P                                   KT + I+V+D+KNGA HYW + K                                                R+RL+ +R++Y+ +AEM  A  D M    ++++ G DPFYDRFPWF++VGR+FV+L+NLL+NVPLIH+VAVVNEKGEVKG L+VAI+P+
Sbjct:    1 MSSVKVAVRVRPFNQREISNTSKCVLQVNGNTTTINGHSINKENFSFNFDHSYWSFARNDPHFITQKQVYEELGVEMLEHAFEGYNVCIFAYGQTGSGKSYTMMGKANDPDEMGIIPRLCNDLFARIDN----NNDKD--VQYSVEVSYMEIYCERVKDLLNPNSGGNLRVREHPLLGPYVDDLTKMAVCSYHDICNLMDEGNKARTVAATNMNSTSSRSHAVFTIVLTQKRHCADSNLDTEKHSKISLVDLAGSERANSTGAEGQRLKEGANINKSLTTLGLVISKLAEES----TKKKKSNKGVIPYRDSVLTWLLRENLGGNSKTAMLAALSPADINFDETLSTLRYADRAKQIVCQAVVNEDPNAKLIRELNEEVIKLRHILKDKGIDVTD----------VQETPGKHKKGPKLPAHVHEQ-LEKLQESEKLMAEIGKTWEQKLIHTEEIRKQREEELRDMGLACAEDGTTLGVFSPKKLPHLVNLNEDPLMSECLIYYLKEGVTSVGRPEA--EHRPDILLSGEAILELHCEFINEDGNVTLTMKPNASCYINGKQVTTPTVLHTGSRVILGEHHVFRYNDPQEARQSRHNLAAIAEQP---IDWKYAQQELLDKQGIDLKADMEKKMLEMESQYRREKVELEQKMYHQTREYESMIENLQKQVDLAQSYISGGGSIWEGERMLTSSLLEFPEELKWTSDQKRVVLKAAIKWRYHQFTSVR-------------DDLWGNAIFVKEANAISVELKKKVQFQFALLTDTMYSPLPP---DLLPPGEDLTLRPYP-----------------------------------KTVVAIQVQDLKNGATHYWSIEKLKQRLEDMRIFYNSELSVAGTPVDVPYPPVAEGWLAALNRNSARLIPDRQRLEAMRDMYETDAEMSPADGDPM----MDALMGTDPFYDRFPWFRMVGRAFVYLNNLLHNVPLIHKVAVVNEKGEVKGYLKVAIEPV 913          

HSP 2 Score: 310.457 bits (794), Expect = 4.073e-85
Identity = 173/412 (41.99%), Postives = 254/412 (61.65%), Query Frame = 2
Query: 3257 FCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSS---KRAKSFLHTNQP---LPTPVPSQKEEIYNNPLE---GTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVE 4465
            FCFRV +LQ   ++  Y+D FCQ++FL++ ++ +STEP+KN    +P+ F H QN  + +++ F+ Y+ ++ I FE+F H +P+       + E Q+S   +R  + L   QP   + TPV S+K    N P++    ++  ++DLLVWFEI EL+ NGEYV   VDH+   P HG+F++HQ +QRR  +TI HE     GE     L +   +E+VVGR+R  PE+   DD   VLSL L P  ++    D+R  F+FEAAWDSSLH S LLN ++   + I++T+S Y++++ C +P  +TKD CL++  RDS++S   R         RS +G   K+ ++NRV G+Y L LK        RR +R  + +S YVRGEEN+  WRPR DSLI +HQW+LEKLT+LQ VE
Sbjct:  965 FCFRVVVLQAIDVADTYSDVFCQFNFLHRHDEAFSTEPMKN--SKSPLTFEHTQNLHIKMSKTFLHYLHHFPIIFEVFGHFQPK---SEQFNFERQNSALGRRLSTKLTFQQPSLVISTPVKSKKA---NAPIQNNNASVKSKHDLLVWFEICELANNGEYVPTIVDHAQGLPTHGIFLLHQGIQRRIKITICHE----KGE-----LKWKDCQELVVGRIRAGPEWAGGDDVD-VLSLGLFPGTFMEFSMDDRTFFQFEAAWDSSLHNSPLLNRVSNYGDQIYMTLSAYMELDGCAQPAVVTKDLCLLIYARDSKISAASR-------FCRSLVGGISKSPEMNRVPGVYQLCLKDGSDSGAIRRQRRVLDTSSAYVRGEENLGQWRPRGDSLIFEHQWELEKLTRLQQVE 1351          

HSP 3 Score: 97.8265 bits (242), Expect = 7.911e-20
Identity = 54/140 (38.57%), Postives = 81/140 (57.86%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIR 5485
            LV E  E R+  V+S+KGY+N LEE K   W +RWV+VRRP++ ++  ++D V RGIINLA A+I+++                 +  A    P +      FS+    R +L+Q +  D  E++DWLYA NPL+AGQ++
Sbjct: 1492 LVPEVLEERVGVVVSKKGYMNFLEE-KTQGWTRRWVIVRRPYILLFRDDRDLVIRGIINLANARIEHSE----------------DQQAMVKVPNT------FSVCTNQRGFLMQMMPGD--EMYDWLYAINPLMAGQMK 1606          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Celegans
Match: klp-4 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:Q8IG10])

HSP 1 Score: 478.019 bits (1229), Expect = 2.834e-140
Identity = 348/1016 (34.25%), Postives = 510/1016 (50.20%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNN-LRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINK----------------------------------SLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRX------XXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSS--------------------KMDIHLSGDCIMPMHCVFNCE---GEHVTLTAIGDAECY--VNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDY-----LSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIES---VTG----------GDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAI 2899
            S+VKVA+RVRPFN RE+    K ++ ++     +  P  ++  K+F FD+S+ S  P   +F +Q+ V + LG   +E+A  GYN CI AYGQTG+GKSY+MMG P   DQ GIIP++C  +F R+ +         + +   +EVSYMEIY ERVRDLL+PK  +  L+VREH +LGP V+ LS   V SF+ I+ L++ GNKSRTVAATNMN  SSRSHAVF++I++Q + D +   +GEKV+KISLVDLAGSERA  TGA G RL+EG NINK                                  SLTTLG VISALAE +S        +K  FIP+RDSVLTWLL+++LGGNS+T M+  +SPA  NYEETLS+LRYADRAK+IV  A+INEDPN R                                  VIRE R         +  ++    + +++ E+L  SE+L+A++N++WE++L++T+ L K+R  +L E+GI+I++     G+   K R  LVN+N D  + E LVYY+ +G   +G  E + +S                    +  I L G  IM  H     E   G      A   +EC   VNGK+I E T L++ +RL+ G NH F+ N P    +  E+  +E+      D+N A  E+ +   +    +     V L+ Q     E+     E+Q + +E  IQ+L       S      +     ++      P  +     Q     F  W   +      F+ S++   ++K D+      ++EAN +S+ELNKK           P    T D+ T+++  SN+    +P IK                          I +     + VI VR      + +W + +   RL  +R+ Y +    F    + +  +   S   + G           DPF++      LVG + VFL  L +++ L ++V +++++GEV G L V I
Sbjct:    8 SAVKVAIRVRPFNKRELDLKTKSVVRIQKEQCVLHHPIEEKNSKTFTFDHSFCSTDPHSYDFASQETVSYHLGSGVVENAFSGYNACIFAYGQTGSGKSYTMMGTP---DQPGIIPRVCNDIFTRIQETS------NSSLSFKVEVSYMEIYNERVRDLLDPKKSSKALKVREHKILGPMVDGLSILAVNSFEQISNLLEEGNKSRTVAATNMNAESSRSHAVFSLIVTQTLHDLENGFSGEKVAKISLVDLAGSERAGKTGAVGKRLEEGGNINKNLVSIFLRNDLEKKIDFKFSADVYVFINQKLDFRSLTTLGMVISALAERNS--------KKDKFIPYRDSVLTWLLKDSLGGNSRTVMIATLSPAADNYEETLSTLRYADRAKKIVNHAIINEDPNAR----------------------------------VIRELREEVETLRMQITQTKKEHAETEELRERLAESERLVAQMNKSWEERLKETDTLNKERQKDLTEIGISIESS----GIKVEKDRFYLVNMNADPSLNELLVYYI-NGSAIIGNSEELETSRDSGLSMTCSDSSRRDDDKERTSIVLRGLGIMRRHAKMTVEEYGGRLRLFVAPMSSECRICVNGKQITERTLLRNGNRLLVGMNHFFKVNCPKVMDM--EQSIMED--STMFDYNDAWHEVNDANPISSAVDQYMESVTLKHQ-----EDKKAALEQQYEAFEKYIQSLTAGGFTPSTPMTPGFCLPTPITTPTGLPPFPFPANPKQSVKSKFFYWAQRKEEM---FAESLK---RLKADVIHANALVREANMISKELNKK-----------PKRQTTYDV-TLQIPASNL----RP-IK--------------------------IKAGQFVCEPVIVVRREGMSGSQFWTVSQLESRLVDMRDTYNDMLNGFTRTSESLNGTPHASPMKIAGIPMNECSSLVIDPFFESQEHHNLVGVANVFLEVLFHDLRLDYQVPIISQQGEVAGRLHVQI 909          

HSP 2 Score: 73.9442 bits (180), Expect = 1.410e-12
Identity = 52/191 (27.23%), Postives = 86/191 (45.03%), Query Frame = 2
Query: 3245 LGQTFCFRVTILQVSGLSSDYTD-TFCQYSFLNKPNDCY---STEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTI 3805
            LG+T   RV I + SGL    ++  FCQYSF N         + E   +    T + F H ++F V+VT  F++Y+++ A+  E++ H+      E  LDT+ +S      ++   + L T                          W E+ EL+ NG++ SV V H+ +    G++ + Q  QRR  V +
Sbjct:  930 LGKTITCRVRIKRASGLPEKLSNFVFCQYSFFNISELLVVAPANEAANHSSCPTTVIFEHQRDFNVMVTEEFMEYVRDDALSIEVWGHRICGHPEERILDTDEKSKSLQNRWMEVTRRLET--------------------------WSEVRELNDNGDWTSVEVRHADDVSTGGIYQLKQGQQRRLVVGV 1094          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0304680)

HSP 1 Score: 1288.09 bits (3332), Expect = 0.000e+0
Identity = 723/1493 (48.43%), Postives = 954/1493 (63.90%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP------KSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXX-------------XXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK--------KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMI-------SADDYLSDDENYE----PTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLD-LDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMV 4462
            MSSVKVAVRVRPFN REI+R++KCII M G+TT I  P  K PP      K F FDYSY S    D++F  Q  VY D+GE+ L+H+ +GYNVCI AYGQTGAGKSY+MMG+  +  QEGIIP +C+ LF R+ D + D+      +++++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V  +QDI++LID GNK+RTVAATNMNETSSRSHAVFTI  +QR  D    LT EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++S  K+TK   K DFIP+RDS LTWLLRENLGGNSKTAM+ AISPADINY+ETLS+LRYADRAKQIVCKAV+NED N +L+RELKEE+ KLR++LK E IEV EG    P+  V+ E R  +                        +  +++L+ASEKLIAELNETWE+KL++TE++R QR++  AE+G+ +K DG   GVFS KK P+LVNLNED  ++ECL+YY+K+G T++G  E   +   DI LSG  I+  HC F  +   VTL    DA  YVNG+++ E   LK+  R+I GKNHVFRF NP  A+  R+K          VE+   + +DWNFA  ELLEKQG+DL+ EM+ RL  LEEQ+K+EK +AD+ FE+Q++ YE +I  L++QV + SM        S +D+  +++ Y      + W+ R+  LAAWAF KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+  ++ +             P +                                +KT + +EV D KNGA H+W L K R+RL+L+RE+Y NEAEM    PD      +ES+TGGDPFYDRFPWF++VGRSF++LSNLLY VPL+H+VA+VNE+G+V+G LR+A+QP+ + E       +         +    D+K  + AL   E DD   ++    L      L D      +D +     S +E  +++                         L++G+ F FRVT+LQ +G+ ++Y D FCQ++FL++  + +STEP+KN     P+GFYHVQN  V VT++F++Y+K   I F++F H +    L      +  S    +  L  + P+  PV S K          T+L ++D+LVWFEI EL+ NGEYV   V+HS + PC G+F++HQ +QRR  +TIVHEP T+    + + L+         GR+R+ PE  D  D+ + VLSL L P   +   GD+R  +RFEAAWDSSLH S LLN +++  E I++T+S YL++ENC +P  ITKD  +V+  RD++      K++FS +          +  + NR+TG+Y+L L++       RR +R  + +S YVRGEEN+ GWRPR DSLI DHQW+LEKLT+L+ V
Sbjct:    1 MSSVKVAVRVRPFNSREIARESKCIIEMAGATTAITNP--KVPPNTSDSVKRFNFDYSYWSHDHHDADFSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEE-QQEGIIPMICKDLFTRIQDTETDD------LKYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTK---KADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKAEGIEVQEG----PDGKVVCEKRDANKDELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEA--NVPQDIQLSGSHILKEHCTFENKNSTVTLLPHKDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLKAEMKKRLDNLEEQYKREKLQADQQFEEQRKTYEARIDALQKQVEEQSMTMSMYSSYSPEDFHQEEDVYTNPMYESCWTAREAGLAAWAFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPV--------------------------------SKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDY----NVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQPVLDEESIDFNNGVKQSARLVFNED---DAKPKYRALN--EKDDVQRYIDNGGLDSKLEELEDVDSGRGIDSN-----SASECHENSEEPGEH-------------------LQVGKEFTFRVTVLQATGIGAEYADIFCQFNFLHRHEEAFSTEPVKNSASGAPLGFYHVQNITVPVTKSFIEYLKTQPIMFKIFGHYQTH-PLHKDAKQDFVSRPPPRRMLPPSIPISQPVRSPKFGPLPCAPTSTVLAKHDVLVWFEICELAPNGEYVPSVVEHSDDLPCRGLFLLHQGIQRRIRITIVHEPTTEVKWKDINELVV--------GRIRNTPESSDEQDEDACVLSLGLFPGEALEVPGDDRSFYRFEAAWDSSLHNSALLNRVSQGGETIYITLSAYLELENCARPAIITKDLSMVIYGRDARTGPRSLKHLFSGQY---------RNPEANRLTGVYELALRRASEAGVQRRQRRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEV 1379          

HSP 2 Score: 139.043 bits (349), Expect = 2.661e-32
Identity = 91/246 (36.99%), Postives = 132/246 (53.66%), Query Frame = 2
Query: 4799 REKLLTSRCVELM------TVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRL-----VGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRR 5503
            RE+ L  +C++L+      + +N +QT QS +   D   ++M  S +S            SM  N   +   L +     + +G  +      P L     V E +EIR+SPV++RKG LN+LE    + W KRWV+VRRP+++IY  EKDPVER ++NLATA ++ +                 + +A    P +      FS+V  HR +L+QT+ D  KEVHDWLYA NPLLAGQI+S+L RR
Sbjct: 1447 REQDLMLKCLKLVQGRYTKSEANDTQT-QSDVSPSDEGCADMTVSCIS----------SNSMENNKFVIRRRLCSPDRADAPNGWEAPAPATQPALPLRLYVPELEEIRVSPVVARKGLLNVLEHGG-SGWKKRWVIVRRPYVFIYRSEKDPVERAVLNLATAHVECSE----------------DQAAMVKIPNT------FSVVTKHRGYLLQTLGD--KEVHDWLYAINPLLAGQIKSRLARR 1656          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0113089)

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 724/1496 (48.40%), Postives = 955/1496 (63.84%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP------KSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXX-------------XXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK--------KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMI-------SADDYLSDDENYE----PTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLD-LDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMV 4462
            MSSVKVAVRVRPFN REI+R++KCII M G+TT I  P  K PP      K F FDYSY S    D++F  Q  VY D+GE+ L+H+ +GYNVCI AYGQTGAGKSY+MMG+  +  QEGIIP +C+ LF R+ D + D+      +++++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V  +QDI++LID GNK+RTVAATNMNETSSRSHAVFTI  +QR  D    LT EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++S  K+TK   K DFIP+RDS LTWLLRENLGGNSKTAM+ AISPADINY+ETLS+LRYADRAKQIVCKAV+NED N +L+RELKEE+ KLR++LK E IEV EG    P+  V+ E R  +                        +  +++L+ASEKLIAELNETWE+KL++TE++R QR++  AE+G+ +K DG   GVFS KK P+LVNLNED  ++ECL+YY+K+G T++G  E   +   DI LSG  I+  HC F  +   VTL    DA  YVNG+++ E   LK+  R+I GKNHVFRF NP  A+  R+K          VE+   + +DWNFA  ELLEKQG+DL+ EM+ RL  LEEQ+K+EK +AD+ FE+Q++ YE +I  L++QV + SM        S +D+  +++ Y      + W+ R+  LAAWAF KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+  ++ +             P +                                +KT + +EV D KNGA H+W L K R+RL+L+RE+Y NEAEM    PD      +ES+TGGDPFYDRFPWF++VGRSF++LSNLLY VPL+H+VA+VNE+G+V+G LR+A+QP+ + E       +         +    D+K  + AL   E DD   ++    L      L D      +D +     S +E  +++                         L++G+ F FRVT+LQ +G+ ++Y D FCQ++FL++  + +STEP+KN     P+GFYHVQN  V VT++F++Y+K   I F++F H +    L      +  S    +  L  + P+  PV S K          T+L ++D+LVWFEI EL+ NGEYV   V+HS + PC G+F++HQ +QRR  +TIVHEP T+    + + L+         GR+R+ PE  D  D+ + VLSL L P   +   GD+R  +RFEAAWDSSLH S LLN +++  E I++T+S YL++ENC +P  ITKD  +V+  RD++      K++FS +          +  + NR+TG+Y+L L+   +  S    RR +R  + +S YVRGEEN+ GWRPR DSLI DHQW+LEKLT+L+ V
Sbjct:    1 MSSVKVAVRVRPFNSREIARESKCIIEMAGATTAITNP--KVPPNTSDSVKRFNFDYSYWSHDHHDADFSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEE-QQEGIIPMICKDLFTRIQDTETDD------LKYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTK---KADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKAEGIEVQEG----PDGKVVCEKRDANKDELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEA--NVPQDIQLSGSHILKEHCTFENKNSTVTLLPHKDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLKAEMKKRLDNLEEQYKREKLQADQQFEEQRKTYEARIDALQKQVEEQSMTMSMYSSYSPEDFHQEEDVYTNPMYESCWTAREAGLAAWAFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPV--------------------------------SKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDY----NVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQPVLDEESIDFNNGVKQSARLVFNED---DAKPKYRALN--EKDDVQRYIDNGGLDSKLEELEDVDSGRGIDSN-----SASECHENSEEPGEH-------------------LQVGKEFTFRVTVLQATGIGAEYADIFCQFNFLHRHEEAFSTEPVKNSASGAPLGFYHVQNITVPVTKSFIEYLKTQPIMFKIFGHYQTH-PLHKDAKQDFVSRPPPRRMLPPSIPISQPVRSPKFGPLPCAPTSTVLAKHDVLVWFEICELAPNGEYVPSVVEHSDDLPCRGLFLLHQGIQRRIRITIVHEPTTEVKWKDINELVV--------GRIRNTPESSDEQDEDACVLSLGLFPGEALEVPGDDRSFYRFEAAWDSSLHNSALLNRVSQGGETIYITLSAYLELENCARPAIITKDLSMVIYGRDARTGPRSLKHLFSGQY---------RNPEANRLTGVYELALRRASEAGSPGVQRRQRRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEV 1382          

HSP 2 Score: 139.043 bits (349), Expect = 2.641e-32
Identity = 91/246 (36.99%), Postives = 132/246 (53.66%), Query Frame = 2
Query: 4799 REKLLTSRCVELM------TVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRL-----VGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRR 5503
            RE+ L  +C++L+      + +N +QT QS +   D   ++M  S +S            SM  N   +   L +     + +G  +      P L     V E +EIR+SPV++RKG LN+LE    + W KRWV+VRRP+++IY  EKDPVER ++NLATA ++ +                 + +A    P +      FS+V  HR +L+QT+ D  KEVHDWLYA NPLLAGQI+S+L RR
Sbjct: 1450 REQDLMLKCLKLVQGRYTKSEANDTQT-QSDVSPSDEGCADMTVSCIS----------SNSMENNKFVIRRRLCSPDRADAPNGWEAPAPATQPALPLRLYVPELEEIRVSPVVARKGLLNVLEHGG-SGWKKRWVIVRRPYVFIYRSEKDPVERAVLNLATAHVECSE----------------DQAAMVKIPNT------FSVVTKHRGYLLQTLGD--KEVHDWLYAINPLLAGQIKSRLARR 1659          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0304679)

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 724/1496 (48.40%), Postives = 955/1496 (63.84%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP------KSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXX-------------XXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK--------KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMI-------SADDYLSDDENYE----PTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLD-LDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMV 4462
            MSSVKVAVRVRPFN REI+R++KCII M G+TT I  P  K PP      K F FDYSY S    D++F  Q  VY D+GE+ L+H+ +GYNVCI AYGQTGAGKSY+MMG+  +  QEGIIP +C+ LF R+ D + D+      +++++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V  +QDI++LID GNK+RTVAATNMNETSSRSHAVFTI  +QR  D    LT EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++S  K+TK   K DFIP+RDS LTWLLRENLGGNSKTAM+ AISPADINY+ETLS+LRYADRAKQIVCKAV+NED N +L+RELKEE+ KLR++LK E IEV EG    P+  V+ E R  +                        +  +++L+ASEKLIAELNETWE+KL++TE++R QR++  AE+G+ +K DG   GVFS KK P+LVNLNED  ++ECL+YY+K+G T++G  E   +   DI LSG  I+  HC F  +   VTL    DA  YVNG+++ E   LK+  R+I GKNHVFRF NP  A+  R+K          VE+   + +DWNFA  ELLEKQG+DL+ EM+ RL  LEEQ+K+EK +AD+ FE+Q++ YE +I  L++QV + SM        S +D+  +++ Y      + W+ R+  LAAWAF KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+  ++ +             P +                                +KT + +EV D KNGA H+W L K R+RL+L+RE+Y NEAEM    PD      +ES+TGGDPFYDRFPWF++VGRSF++LSNLLY VPL+H+VA+VNE+G+V+G LR+A+QP+ + E       +         +    D+K  + AL   E DD   ++    L      L D      +D +     S +E  +++                         L++G+ F FRVT+LQ +G+ ++Y D FCQ++FL++  + +STEP+KN     P+GFYHVQN  V VT++F++Y+K   I F++F H +    L      +  S    +  L  + P+  PV S K          T+L ++D+LVWFEI EL+ NGEYV   V+HS + PC G+F++HQ +QRR  +TIVHEP T+    + + L+         GR+R+ PE  D  D+ + VLSL L P   +   GD+R  +RFEAAWDSSLH S LLN +++  E I++T+S YL++ENC +P  ITKD  +V+  RD++      K++FS +          +  + NR+TG+Y+L L+   +  S    RR +R  + +S YVRGEEN+ GWRPR DSLI DHQW+LEKLT+L+ V
Sbjct:    1 MSSVKVAVRVRPFNSREIARESKCIIEMAGATTAITNP--KVPPNTSDSVKRFNFDYSYWSHDHHDADFSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEE-QQEGIIPMICKDLFTRIQDTETDD------LKYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTK---KADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKAEGIEVQEG----PDGKVVCEKRDANKDELTKSTVIKSPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEA--NVPQDIQLSGSHILKEHCTFENKNSTVTLLPHKDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLKAEMKKRLDNLEEQYKREKLQADQQFEEQRKTYEARIDALQKQVEEQSMTMSMYSSYSPEDFHQEEDVYTNPMYESCWTAREAGLAAWAFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPV--------------------------------SKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDY----NVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQPVLDEESIDFNNGVKQSARLVFNED---DAKPKYRALN--EKDDVQRYIDNGGLDSKLEELEDVDSGRGIDSN-----SASECHENSEEPGEH-------------------LQVGKEFTFRVTVLQATGIGAEYADIFCQFNFLHRHEEAFSTEPVKNSASGAPLGFYHVQNITVPVTKSFIEYLKTQPIMFKIFGHYQTH-PLHKDAKQDFVSRPPPRRMLPPSIPISQPVRSPKFGPLPCAPTSTVLAKHDVLVWFEICELAPNGEYVPSVVEHSDDLPCRGLFLLHQGIQRRIRITIVHEPTTEVKWKDINELVV--------GRIRNTPESSDEQDEDACVLSLGLFPGEALEVPGDDRSFYRFEAAWDSSLHNSALLNRVSQGGETIYITLSAYLELENCARPAIITKDLSMVIYGRDARTGPRSLKHLFSGQY---------RNPEANRLTGVYELALRRASEAGSPGVQRRQRRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEV 1382          

HSP 2 Score: 135.576 bits (340), Expect = 2.617e-31
Identity = 70/145 (48.28%), Postives = 94/145 (64.83%), Query Frame = 2
Query: 5069 VGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRR 5503
            V E +EIR+SPV++RKG LN+LE    + W KRWV+VRRP+++IY  EKDPVER ++NLATA ++ +                 + +A    P +      FS+V  HR +L+QT+ D  KEVHDWLYA NPLLAGQI+S+L RR
Sbjct: 1531 VPELEEIRVSPVVARKGLLNVLEHGG-SGWKKRWVIVRRPYVFIYRSEKDPVERAVLNLATAHVECSE----------------DQAAMVKIPNT------FSVVTKHRGYLLQTLGD--KEVHDWLYAINPLLAGQIKSRLARR 1650          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0330003)

HSP 1 Score: 1282.7 bits (3318), Expect = 0.000e+0
Identity = 722/1483 (48.69%), Postives = 955/1483 (64.40%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP------KSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK--------KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMI-------SADDYLSDDENYE----PTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLD-LDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMV 4462
            MSSVKVAVRVRPFN REI+R++KCII M G+TT I  P  K PP      K F FDYSY S    D++F  Q  VY D+GE+ L+H+ +GYNVCI AYGQTGAGKSY+MMG+  +  QEGIIP +C+ LF R+ D + D+      +++++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V  +QDI++LID GNK+RTVAATNMNETSSRSHAVFTI  +QR  D    LT EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++S  K+TK   K DFIP+RDS LTWLLRENLGGNSKTAM+ AISPADINY+ETLS+LRYADRAKQIVCKAV+NED N +L+RELKEE+ KLR++LK E IEV E    + + +VI+    +   S        +  +++L+ASEKLIAELNETWE+KL++TE++R QR++  AE+G+ +K DG   GVFS KK P+LVNLNED  ++ECL+YY+K+G T++G  E   +   DI LSG  I+  HC F  +   VTL    DA  YVNG+++ E   LK+  R+I GKNHVFRF NP  A+  R+K          VE+   + +DWNFA  ELLEKQG+DL+ EM+ RL  LEEQ+K+EK +AD+ FE+Q++ YE +I  L++QV + SM        S +D+  +++ Y      + W+ R+  LAAWAF KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+  ++ +             P +                                +KT + +EV D KNGA H+W L K R+RL+L+RE+Y NEAEM    PD      +ES+TGGDPFYDRFPWF++VGRSF++LSNLLY VPL+H+VA+VNE+G+V+G LR+A+QP+ + E       +         +    D+K  + AL   E DD   ++    L      L D      +D +     S +E  +++                         L++G+ F FRVT+LQ +G+ ++Y D FCQ++FL++  + +STEP+KN     P+GFYHVQN  V VT++F++Y+K   I F++F H +    L      +  S    +  L  + P+  PV S K          T+L ++D+LVWFEI EL+ NGEYV   V+HS + PC G+F++HQ +QRR  +TIVHEP T+    + + L+         GR+R+ PE  D  D+ + VLSL L P   +   GD+R  +RFEAAWDSSLH S LLN +++  E I++T+S YL++ENC +P  ITKD  +V+  RD++      K++FS +          +  + NR+TG+Y+L L+   +  S    RR +R  + +S YVRGEEN+ GWRPR DSLI DHQW+LEKLT+L+ V
Sbjct:    1 MSSVKVAVRVRPFNSREIARESKCIIEMAGATTAITNP--KVPPNTSDSVKRFNFDYSYWSHDHHDADFSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEE-QQEGIIPMICKDLFTRIQDTETDD------LKYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTK---KADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKAEGIEVQEE-DELTKSTVIK----SPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEA--NVPQDIQLSGSHILKEHCTFENKNSTVTLLPHKDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLKAEMKKRLDNLEEQYKREKLQADQQFEEQRKTYEARIDALQKQVEEQSMTMSMYSSYSPEDFHQEEDVYTNPMYESCWTAREAGLAAWAFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPV--------------------------------SKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDY----NVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQPVLDEESIDFNNGVKQSARLVFNED---DAKPKYRALN--EKDDVQRYIDNGGLDSKLEELEDVDSGRGIDSN-----SASECHENSEEPGEH-------------------LQVGKEFTFRVTVLQATGIGAEYADIFCQFNFLHRHEEAFSTEPVKNSASGAPLGFYHVQNITVPVTKSFIEYLKTQPIMFKIFGHYQTH-PLHKDAKQDFVSRPPPRRMLPPSIPISQPVRSPKFGPLPCAPTSTVLAKHDVLVWFEICELAPNGEYVPSVVEHSDDLPCRGLFLLHQGIQRRIRITIVHEPTTEVKWKDINELVV--------GRIRNTPESSDEQDEDACVLSLGLFPGEALEVPGDDRSFYRFEAAWDSSLHNSALLNRVSQGGETIYITLSAYLELENCARPAIITKDLSMVIYGRDARTGPRSLKHLFSGQY---------RNPEANRLTGVYELALRRASEAGSPGVQRRQRRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEV 1368          

HSP 2 Score: 135.961 bits (341), Expect = 2.363e-31
Identity = 70/145 (48.28%), Postives = 94/145 (64.83%), Query Frame = 2
Query: 5069 VGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRR 5503
            V E +EIR+SPV++RKG LN+LE    + W KRWV+VRRP+++IY  EKDPVER ++NLATA ++ +                 + +A    P +      FS+V  HR +L+QT+ D  KEVHDWLYA NPLLAGQI+S+L RR
Sbjct: 1517 VPELEEIRVSPVVARKGLLNVLEHGG-SGWKKRWVIVRRPYVFIYRSEKDPVERAVLNLATAHVECSE----------------DQAAMVKIPNT------FSVVTKHRGYLLQTLGD--KEVHDWLYAINPLLAGQIKSRLARR 1636          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Fly
Match: unc-104 (gene:FBgn0267002 transcript:FBtr0113088)

HSP 1 Score: 1282.7 bits (3318), Expect = 0.000e+0
Identity = 722/1483 (48.69%), Postives = 955/1483 (64.40%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP------KSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK--------KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMI-------SADDYLSDDENYE----PTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLD-LDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMV 4462
            MSSVKVAVRVRPFN REI+R++KCII M G+TT I  P  K PP      K F FDYSY S    D++F  Q  VY D+GE+ L+H+ +GYNVCI AYGQTGAGKSY+MMG+  +  QEGIIP +C+ LF R+ D + D+      +++++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V  +QDI++LID GNK+RTVAATNMNETSSRSHAVFTI  +QR  D    LT EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++S  K+TK   K DFIP+RDS LTWLLRENLGGNSKTAM+ AISPADINY+ETLS+LRYADRAKQIVCKAV+NED N +L+RELKEE+ KLR++LK E IEV E    + + +VI+    +   S        +  +++L+ASEKLIAELNETWE+KL++TE++R QR++  AE+G+ +K DG   GVFS KK P+LVNLNED  ++ECL+YY+K+G T++G  E   +   DI LSG  I+  HC F  +   VTL    DA  YVNG+++ E   LK+  R+I GKNHVFRF NP  A+  R+K          VE+   + +DWNFA  ELLEKQG+DL+ EM+ RL  LEEQ+K+EK +AD+ FE+Q++ YE +I  L++QV + SM        S +D+  +++ Y      + W+ R+  LAAWAF KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+  ++ +             P +                                +KT + +EV D KNGA H+W L K R+RL+L+RE+Y NEAEM    PD      +ES+TGGDPFYDRFPWF++VGRSF++LSNLLY VPL+H+VA+VNE+G+V+G LR+A+QP+ + E       +         +    D+K  + AL   E DD   ++    L      L D      +D +     S +E  +++                         L++G+ F FRVT+LQ +G+ ++Y D FCQ++FL++  + +STEP+KN     P+GFYHVQN  V VT++F++Y+K   I F++F H +    L      +  S    +  L  + P+  PV S K          T+L ++D+LVWFEI EL+ NGEYV   V+HS + PC G+F++HQ +QRR  +TIVHEP T+    + + L+         GR+R+ PE  D  D+ + VLSL L P   +   GD+R  +RFEAAWDSSLH S LLN +++  E I++T+S YL++ENC +P  ITKD  +V+  RD++      K++FS +          +  + NR+TG+Y+L L+   +  S    RR +R  + +S YVRGEEN+ GWRPR DSLI DHQW+LEKLT+L+ V
Sbjct:    1 MSSVKVAVRVRPFNSREIARESKCIIEMAGATTAITNP--KVPPNTSDSVKRFNFDYSYWSHDHHDADFSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEE-QQEGIIPMICKDLFTRIQDTETDD------LKYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTK---KADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKAEGIEVQEE-DELTKSTVIK----SPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEA--NVPQDIQLSGSHILKEHCTFENKNSTVTLLPHKDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLKAEMKKRLDNLEEQYKREKLQADQQFEEQRKTYEARIDALQKQVEEQSMTMSMYSSYSPEDFHQEEDVYTNPMYESCWTAREAGLAAWAFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPV--------------------------------SKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDY----NVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQPVLDEESIDFNNGVKQSARLVFNED---DAKPKYRALN--EKDDVQRYIDNGGLDSKLEELEDVDSGRGIDSN-----SASECHENSEEPGEH-------------------LQVGKEFTFRVTVLQATGIGAEYADIFCQFNFLHRHEEAFSTEPVKNSASGAPLGFYHVQNITVPVTKSFIEYLKTQPIMFKIFGHYQTH-PLHKDAKQDFVSRPPPRRMLPPSIPISQPVRSPKFGPLPCAPTSTVLAKHDVLVWFEICELAPNGEYVPSVVEHSDDLPCRGLFLLHQGIQRRIRITIVHEPTTEVKWKDINELVV--------GRIRNTPESSDEQDEDACVLSLGLFPGEALEVPGDDRSFYRFEAAWDSSLHNSALLNRVSQGGETIYITLSAYLELENCARPAIITKDLSMVIYGRDARTGPRSLKHLFSGQY---------RNPEANRLTGVYELALRRASEAGSPGVQRRQRRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEV 1368          

HSP 2 Score: 139.043 bits (349), Expect = 2.562e-32
Identity = 91/246 (36.99%), Postives = 132/246 (53.66%), Query Frame = 2
Query: 4799 REKLLTSRCVELM------TVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRL-----VGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRR 5503
            RE+ L  +C++L+      + +N +QT QS +   D   ++M  S +S            SM  N   +   L +     + +G  +      P L     V E +EIR+SPV++RKG LN+LE    + W KRWV+VRRP+++IY  EKDPVER ++NLATA ++ +                 + +A    P +      FS+V  HR +L+QT+ D  KEVHDWLYA NPLLAGQI+S+L RR
Sbjct: 1436 REQDLMLKCLKLVQGRYTKSEANDTQT-QSDVSPSDEGCADMTVSCIS----------SNSMENNKFVIRRRLCSPDRADAPNGWEAPAPATQPALPLRLYVPELEEIRVSPVVARKGLLNVLEHGG-SGWKKRWVIVRRPYVFIYRSEKDPVERAVLNLATAHVECSE----------------DQAAMVKIPNT------FSVVTKHRGYLLQTLGD--KEVHDWLYAINPLLAGQIKSRLARR 1645          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Zebrafish
Match: kif1aa (kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GENE-100913-3])

HSP 1 Score: 1387.86 bits (3591), Expect = 0.000e+0
Identity = 845/1871 (45.16%), Postives = 1124/1871 (60.07%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTD-FIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXN----IEVGEGLSGI-----PEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEM-FEAVPDCMINSQIESV-TGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLD-----IDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLS-DKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL----------LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDE---------RIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVS-NKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNS----------------RPMTTSLMTESIMSSEDGCRSAWKNNSPR-----LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRR 5506
            +SVKVAVRVRPFN REI +++KCII M G+TT I  P + +  KSF FDYSY S   P D N+ +QQ+VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIP LC  LF ++++    N+D    + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +QR  D + + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K + FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELK+EV +L+++L  +     IE+   ++G+           R    +S+    +    +++ IE+L+ +EK+IAELNETWE+KL++TE +R  R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +   SS+ DI LSG  I   HC F       GE V L     AE YVNGKR+ E T LKS +R+I GK+HVFRFN+P  A+  R++    E P E +DW FA  ELL+KQG+D+++EM+ RL  LE+Q++KE+EEA+ + E+Q+ +YE +++ L++QV +    +A++    +E  +   W+ER+ +LA WAF KW+ +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +                D  K                     S   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE+   AV DC      +SV TGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+VNEKGEVKG LRVA+Q I   E +           +  I   D       S++ HS L++     +   + +        GLS D+ +N++   +     S  +                           TGL          L++G+ F FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK   I FE+F H  ++P   L   L + L+  +R         PL  PVP+ K      P  G    +YDL+V+FEI EL ANG+Y+   VDH    PCHG FM+HQ +QRR +VT+VHE   D    E   L+         GR+R+ PE  +      +LSLN+L A YI    D+         R  +RFEAAWDSS+H S LLN +T   E I++T+S YL++ENC +P  ITKD C+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL                                   T+++ +                  +S + CGS D    ++    L       PG  D  NE   R++ L ++C+ L+  + N+  ++      E    S++ + SV+++ DS     E ++  +S                RP T    + ++  + D      K   PR      V +  EIR+SP++S+KGYL+ LE      WVKR+VVVRRP++YIY  ++D VER I+NL++AQ++Y+                 +  A    P +      F++   HR  L+Q   D  KE+HDWLYAFNPLLAG IRSKL RRR
Sbjct:    4 ASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTIINPKAPKENKSFNFDYSYWSHTSPEDINYASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPLLCEDLFTKINE----NNDNN--MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVMSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDSETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSGSNKNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKDEVSRLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAGSISSLHDRIMFSPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMDREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDA--SSRQDIVLSGHFIKEEHCTFTSTTGPMGEAVILEPCEGAETYVNGKRVTEPTVLKSGNRIILGKSHVFRFNHPEQARQERDRTPCAETPVEPVDWAFAQRELLDKQGIDMKQEMDQRLQELEDQYRKEREEANNLLEQQRLDYESRLEALQKQVDRCYPDAAEEDEEPEEEVQ---WTERETELAMWAFRKWRCYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAK---------------DREK---------------------SPFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEVPSNAVEDC------DSVLTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVNEKGEVKGFLRVAVQAISADEEAPDYGSGVRQSGTAKISFEDQQFEKFQSESCHSGLSRAAVSQEELRIVEGEGQSAEMGLSADEVNNNTCAANPEELDSPVK---------------------------TGLDGMLDGALDHLRIGEVFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKTQPIVFEVFGHYQKQPFPALCKDLISPLRPCRRQ---FPRVMPLSKPVPATKLTALTRPTAGPCHCKYDLMVFFEICELEANGDYIPAVVDHRVGMPCHGTFMLHQGIQRRVTVTMVHETGRDIDWKEVRELVV--------GRIRNTPEADEAIIDPNILSLNILSAGYIRPAHDDRQFLDSDMPRTFYRFEAAWDSSMHNSLLLNRVTPYGEKIYMTLSAYLEMENCTQPTVITKDLCMVFHSRDAKLPASRSIRNL--------FSSGTLRPSEGNRVTGVYELSLCHLADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLES---------------------------------TLLLGQ------------------ESLLSCGSEDLTESSSPSTHLGLGHNPGPG-PDTPNE---RQRELAAKCLRLLNHTFNRDYSHVCVSASE----SKLSEMSVTLLKDSASVCAESTLTPSSTCPSLVESRYIHNTDLRPPTPR--SRAVSPNPDSETDGKKIQEPRSRTRTFVPDIQEIRVSPIVSKKGYLHFLEPHS-NGWVKRYVVVRRPYVYIYNSDRDTVERAILNLSSAQVEYSE----------------DQQAMLKTPYT------FAVCTEHRGILLQASND--KEMHDWLYAFNPLLAGSIRSKLSRRR 1675          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Zebrafish
Match: kif1aa (kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GENE-100913-3])

HSP 1 Score: 1382.08 bits (3576), Expect = 0.000e+0
Identity = 844/1871 (45.11%), Postives = 1124/1871 (60.07%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXN----IEVGEGLSGI-----PEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQR-DSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEM-FEAVPDCMINSQIESV-TGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLD-----IDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLS-DKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL----------LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDE---------RIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVS-NKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNS----------------RPMTTSLMTESIMSSEDGCRSAWKNNSPR-----LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRR 5506
            +SVKVAVRVRPFN REI +++KCII M G+TT I  P + +  KSF FDYSY S   P D N+ +QQ+VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIP LC  LF ++++    N+D    + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +QR  D + + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S   + KKK+   FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELK+EV +L+++L  +     IE+   ++G+           R    +S+    +    +++ IE+L+ +EK+IAELNETWE+KL++TE +R  R ++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +   SS+ DI LSG  I   HC F       GE V L     AE YVNGKR+ E T LKS +R+I GK+HVFRFN+P  A+  R++    E P E +DW FA  ELL+KQG+D+++EM+ RL  LE+Q++KE+EEA+ + E+Q+ +YE +++ L++QV +    +A++    +E  +   W+ER+ +LA WAF KW+ +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +                D  K                     S   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE+   AV DC      +SV TGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+VNEKGEVKG LRVA+Q I   E +           +  I   D       S++ HS L++     +   + +        GLS D+ +N++   +     S  +                           TGL          L++G+ F FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK   I FE+F H  ++P   L   L + L+  +R    +    PL  PVP+ K      P  G    +YDL+V+FEI EL ANG+Y+   VDH    PCHG FM+HQ +QRR +VT+VHE   D    E   L+         GR+R+ PE  +      +LSLN+L A YI    D+         R  +RFEAAWDSS+H S LLN +T   E I++T+S YL++ENC +P  ITKD C+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL                                   T+++ +                  +S + CGS D    ++    L       PG  D  NE   R++ L ++C+ L+  + N+  ++      E    S++ + SV+++ DS     E ++  +S                RP T    + ++  + D      K   PR      V +  EIR+SP++S+KGYL+ LE      WVKR+VVVRRP++YIY  ++D VER I+NL++AQ++Y+                 +  A    P +      F++   HR  L+Q   D  KE+HDWLYAFNPLLAG IRSKL RRR
Sbjct:    4 ASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTIINPKAPKENKSFNFDYSYWSHTSPEDINYASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPLLCEDLFTKINE----NNDNN--MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVMSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDSETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVVS---NKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKDEVSRLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAGSISSLHDRIMFSPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMDRSEALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDA--SSRQDIVLSGHFIKEEHCTFTSTTGPMGEAVILEPCEGAETYVNGKRVTEPTVLKSGNRIILGKSHVFRFNHPEQARQERDRTPCAETPVEPVDWAFAQRELLDKQGIDMKQEMDQRLQELEDQYRKEREEANNLLEQQRLDYESRLEALQKQVDRCYPDAAEEDEEPEEEVQ---WTERETELAMWAFRKWRCYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAK---------------DREK---------------------SPFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEVPSNAVEDC------DSVLTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVNEKGEVKGFLRVAVQAISADEEAPDYGSGVRQSGTAKISFEDQQFEKFQSESCHSGLSRAAVSQEELRIVEGEGQSAEMGLSADEVNNNTCAANPEELDSPVK---------------------------TGLDGMLDGALDHLRIGEVFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKTQPIVFEVFGHYQKQPFPALCKDLISPLRPCRRQFPRV---MPLSKPVPATKLTALTRPTAGPCHCKYDLMVFFEICELEANGDYIPAVVDHRVGMPCHGTFMLHQGIQRRVTVTMVHETGRDIDWKEVRELVV--------GRIRNTPEADEAIIDPNILSLNILSAGYIRPAHDDRQFLDSDMPRTFYRFEAAWDSSMHNSLLLNRVTPYGEKIYMTLSAYLEMENCTQPTVITKDLCMVFHSRDAKLPASRSIRNL--------FSSGTLRPSEGNRVTGVYELSLCHLADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLES---------------------------------TLLLGQ------------------ESLLSCGSEDLTESSSPSTHLGLGHNPGPG-PDTPNE---RQRELAAKCLRLLNHTFNRDYSHVCVSASE----SKLSEMSVTLLKDSASVCAESTLTPSSTCPSLVESRYIHNTDLRPPTPR--SRAVSPNPDSETDGKKIQEPRSRTRTFVPDIQEIRVSPIVSKKGYLHFLEPHS-NGWVKRYVVVRRPYVYIYNSDRDTVERAILNLSSAQVEYSE----------------DQQAMLKTPYT------FAVCTEHRGILLQASND--KEMHDWLYAFNPLLAGSIRSKLSRRR 1672          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 458/791 (57.90%), Postives = 581/791 (73.45%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGL-------------------SGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMIS-ADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYS 2398
            +SVKVAVRVRPFN RE  +++KCII M+G++T I  P + + PK+F FDYSY S   P D +F +Q +VY+D+G++ L+HA EGYNVCI AYGQTGAGKSY+MMGK  +  QEGIIPQLC  LF++++D   +N++E   I +++EV+YMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+DAGNK+RTVAATNMNETSSRSHAVFTI+ +QR  D + +L+ EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+S      KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADIN++ETLS+LRYADRAKQI C AVINEDPN +LVRELK+EV +L+E+L+ + +  G+ L                   +G+  +S I+E          +     ++ IE+L+ SEK+IAELNETWE+KL+KTE +R +R++ LAE+G+ I+ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VGQ +     + DI LSG  I   HC+F  E        VTL     +E YVNGKR++ +  L+S +R+I GKNHVFRFN+P  A+  REK    E P E +DW FA  ELLEKQG+D+++EME RL  +E  +KKEKEEAD++ E+Q+  YE K+Q L++QV   S+ +   D   ++E  +   W++ +Y+LA WAF KW++HQ+TSLR             D LW N V+LKEANA+S EL KKV FQF LLT+T YS
Sbjct:    4 ASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTSPDDPSFASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEE-GQEGIIPQLCEELFEKIND---NNNEE---ISYSVEVAYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVS------KKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVSRLKELLRAQGL--GDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQE--------RIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADA--ERRQDIVLSGAHIKEEHCIFRSERNANGHVIVTLEPCEGSETYVNGKRVNSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGIDMKQEMEKRLTEMEILYKKEKEEADQLLEQQRLVYESKLQELQKQVETRSLAAETPDEEEEEEEEDEVPWTQHKYELAQWAFRKWRYHQFTSLR-------------DQLWGNAVYLKEANAISVELKKKVQFQFVLLTDTLYS 756          

HSP 2 Score: 427.172 bits (1097), Expect = 6.416e-122
Identity = 249/595 (41.85%), Postives = 352/595 (59.16%), Query Frame = 2
Query: 2744 GGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYI-SNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSE 4507
            G DPFYDR PWF LVGR+FV+LSNLLY VPL+HRVAVV EKG+V+G LRV +Q I   E                 +  D  S    S   ++ FD++  + +K+  T  +   S  +  +   V+   + S      +  N     +    +     GD     L++G  F FRVT+LQ SG+ ++Y D FCQ++FL++ ++ +STEPLKN G+  P+GFYHVQN +V VT +F++YIK   I FE+F H  Q P   L  +    +  S+ ++ +     PL  PVP+ K         G  + +YDLL WFEI EL   GEY+   VDH+   PCHG +++HQ +QRR +VT++HE        + S L +  VRE+VVGR+R++PE +D      VLSLN++ A  + S+    R  +RFEA WDSSLH S LLN +T   E I++T+S YL++++CI+P  ITKD C+V   RD+++S PR  +N+        F   + KT D N+VTG+Y+L L +I    S    RR ++  + +  YVRGEEN+ GWRPR DSLIL+HQW+L+K+ +L  VEK RH+LLLREKL E
Sbjct:  917 GQDPFYDRSPWFILVGRAFVYLSNLLYPVPLVHRVAVVTEKGDVRGFLRVGVQAIAADE-----------------EAPDYGSGVRQSGTAKISFDNE--YFKKNDFTSVAMTRSGLSLEELRIVEGQGQSSEVITPSEEMNRINEMDLKLGNVDTKLGDGLAEHLEVGSIFTFRVTVLQASGIPAEYADIFCQFNFLHRHDEAFSTEPLKNTGRGAPLGFYHVQNISVEVTESFIEYIKTKPIVFEVFGHYQQHP---LHIHGQDVVSPSQPSRKYYPPPMPLSKPVPATKLNTITKSNLGQCVSKYDLLAWFEISELEPTGEYIPAVVDHTGGLPCHGTYLLHQGIQRRITVTLIHE--------KGSELHWKDVRELVVGRIRNKPE-VDDSAADAVLSLNIISAKNLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAIITKDICMVFYSRDAKISPPRSLRNL--------FGSGYSKTPDCNKVTGVYELSLCKIADTGSPGMQRRRRKVLDTSVAYVRGEENLAGWRPRGDSLILEHQWELDKMEQLHEVEKTRHLLLLREKLGE 1472          

HSP 3 Score: 124.79 bits (312), Expect = 7.539e-28
Identity = 91/273 (33.33%), Postives = 135/273 (49.45%), Query Frame = 2
Query: 4799 REKLLTSRCVELMTVSNKSQTYQ-------------SSMGKE---DMFKSEMLDSSV---SMINDSHLFNDEGSMMTNSR------------PMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNN 5524
            REK L ++C+ L+T +  S+  Q             S MG++     F S  L  S    S+ +  +  + + +   NSR            PM   L T  +         A K+    LV   +E+R   V+S+KG LN +E  +   WVK +VVVRRP+++IY ++KDPVERG++NL+TAQ++Y+                 +  A    P +      F++   HR  L+Q   ++ K+++DWLYAFNPLLAG IRSKL RRR  V  N
Sbjct: 1530 REKELATKCLRLLTHTFNSEYNQMCNSISDCKFSDISPMGRDPSVSSFSSATLTPSSTCPSLSDSRYTLHTQKTPEANSRATSPSGSDYENFPMVPILETSYLAR-------AGKHEFLNLVPNIEEMRPGSVVSKKGILNFME-PRSNTWVKHFVVVRRPYVFIYNNDKDPVERGVLNLSTAQVEYSE----------------DQQAMLKTPHT------FAMCTKHRGILLQA--NNDKDMNDWLYAFNPLLAGTIRSKLARRRSGVMKN 1770          

HSP 4 Score: 83.1889 bits (204), Expect = 3.695e-15
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query: 2570 KTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVF 2806
            +T + +EV+D+KNGA HYW L K ++RLD +RE+Y    EM  +      +    ++TG DPFYDRF WF+LVG S +F
Sbjct:  778 RTVVAVEVQDLKNGATHYWSLEKLKQRLDQMREMYDRAGEMASS---NQGDDGEGALTGSDPFYDRFHWFKLVGSSPIF 853          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Zebrafish
Match: kif1b (kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE-030820-1])

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 458/791 (57.90%), Postives = 581/791 (73.45%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGL-------------------SGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMIS-ADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYS 2398
            +SVKVAVRVRPFN RE  +++KCII M+G++T I  P + + PK+F FDYSY S   P D +F +Q +VY+D+G++ L+HA EGYNVCI AYGQTGAGKSY+MMGK  +  QEGIIPQLC  LF++++D   +N++E   I +++EV+YMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+DAGNK+RTVAATNMNETSSRSHAVFTI+ +QR  D + +L+ EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+S      KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADIN++ETLS+LRYADRAKQI C AVINEDPN +LVRELK+EV +L+E+L+ + +  G+ L                   +G+  +S I+E          +     ++ IE+L+ SEK+IAELNETWE+KL+KTE +R +R++ LAE+G+ I+ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VGQ +     + DI LSG  I   HC+F  E        VTL     +E YVNGKR++ +  L+S +R+I GKNHVFRFN+P  A+  REK    E P E +DW FA  ELLEKQG+D+++EME RL  +E  +KKEKEEAD++ E+Q+  YE K+Q L++QV   S+ +   D   ++E  +   W++ +Y+LA WAF KW++HQ+TSLR             D LW N V+LKEANA+S EL KKV FQF LLT+T YS
Sbjct:    4 ASVKVAVRVRPFNSRETGKESKCIIQMQGNSTTILNPKNPKEPKTFSFDYSYWSHTSPDDPSFASQNQVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEE-GQEGIIPQLCEELFEKIND---NNNEE---ISYSVEVAYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKYDSETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVS------KKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINFDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVSRLKELLRAQGL--GDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQE--------RIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADA--ERRQDIVLSGAHIKEEHCIFRSERNANGHVIVTLEPCEGSETYVNGKRVNSAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPVEPVDWTFAQRELLEKQGIDMKQEMEKRLTEMEILYKKEKEEADQLLEQQRLVYESKLQELQKQVETRSLAAETPDEEEEEEEEDEVPWTQHKYELAQWAFRKWRYHQFTSLR-------------DQLWGNAVYLKEANAISVELKKKVQFQFVLLTDTLYS 756          

HSP 2 Score: 427.557 bits (1098), Expect = 5.088e-122
Identity = 249/595 (41.85%), Postives = 352/595 (59.16%), Query Frame = 2
Query: 2744 GGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYI-SNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSE 4507
            G DPFYDR PWF LVGR+FV+LSNLLY VPL+HRVAVV EKG+V+G LRV +Q I   E                 +  D  S    S   ++ FD++  + +K+  T  +   S  +  +   V+   + S      +  N     +    +     GD     L++G  F FRVT+LQ SG+ ++Y D FCQ++FL++ ++ +STEPLKN G+  P+GFYHVQN +V VT +F++YIK   I FE+F H  Q P   L  +    +  S+ ++ +     PL  PVP+ K         G  + +YDLL WFEI EL   GEY+   VDH+   PCHG +++HQ +QRR +VT++HE        + S L +  VRE+VVGR+R++PE +D      VLSLN++ A  + S+    R  +RFEA WDSSLH S LLN +T   E I++T+S YL++++CI+P  ITKD C+V   RD+++S PR  +N+        F   + KT D N+VTG+Y+L L +I    S    RR ++  + +  YVRGEEN+ GWRPR DSLIL+HQW+L+K+ +L  VEK RH+LLLREKL E
Sbjct:  917 GQDPFYDRSPWFILVGRAFVYLSNLLYPVPLVHRVAVVTEKGDVRGFLRVGVQAIAADE-----------------EAPDYGSGVRQSGTAKISFDNE--YFKKNDFTSVAMTRSGLSLEELRIVEGQGQSSEVITPSEEMNRINEMDLKLGNVDTKLGDGLAEHLEVGSIFTFRVTVLQASGIPAEYADIFCQFNFLHRHDEAFSTEPLKNTGRGAPLGFYHVQNISVEVTESFIEYIKTKPIVFEVFGHYQQHP---LHIHGQDVVSPSQPSRKYYPPPMPLSKPVPATKLNTITKSNLGQCVSKYDLLAWFEISELEPTGEYIPAVVDHTGGLPCHGTYLLHQGIQRRITVTLIHE--------KGSELHWKDVRELVVGRIRNKPE-VDDSAADAVLSLNIISAKNLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAIITKDICMVFYSRDAKISPPRSLRNL--------FGSGYSKTPDCNKVTGVYELSLCKIADTGSPGMQRRRRKVLDTSVAYVRGEENLAGWRPRGDSLILEHQWELDKMEQLHEVEKTRHLLLLREKLGE 1472          

HSP 3 Score: 125.176 bits (313), Expect = 5.942e-28
Identity = 91/266 (34.21%), Postives = 133/266 (50.00%), Query Frame = 2
Query: 4799 REKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEM----LDSSVSMINDSHL--------FNDEGSMMTNSR------------PMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNN 5524
            REK L ++C+ L+T +  S+  Q      D   S++     D SVS  + + L         +D  +   NSR            PM   L T  +         A K+    LV   +E+R   V+S+KG LN +E  +   WVK +VVVRRP+++IY ++KDPVERG++NL+TAQ++Y+                 +  A    P +      F++   HR  L+Q   ++ K+++DWLYAFNPLLAG IRSKL RRR  V  N
Sbjct: 1530 REKELATKCLRLLTHTFNSEYNQMCNSISDCKFSDISPMGRDPSVSSFSSATLTPSSTCPSLSDSRTPEANSRATSPSGSDYENFPMVPILETSYLAR-------AGKHEFLNLVPNIEEMRPGSVVSKKGILNFME-PRSNTWVKHFVVVRRPYVFIYNNDKDPVERGVLNLSTAQVEYSE----------------DQQAMLKTPHT------FAMCTKHRGILLQA--NNDKDMNDWLYAFNPLLAGTIRSKLARRRSGVMKN 1763          

HSP 4 Score: 83.1889 bits (204), Expect = 3.786e-15
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 2
Query: 2570 KTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVF 2806
            +T + +EV+D+KNGA HYW L K ++RLD +RE+Y    EM  +      +    ++TG DPFYDRF WF+LVG S +F
Sbjct:  778 RTVVAVEVQDLKNGATHYWSLEKLKQRLDQMREMYDRAGEMASS---NQGDDGEGALTGSDPFYDRFHWFKLVGSSPIF 853          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Zebrafish
Match: kif1ab (kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GENE-070912-480])

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 468/947 (49.42%), Postives = 595/947 (62.83%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNI-EVGEGLS----GIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSE--LAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVG------QPEIVN---------------------------SSKMDIHLSGDCIMPMHCVF----NCEGEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVF 2806
            +SVKVAVRVRPFN REI +D+KCII M G+TT I  P   +  KSF FDYSY S   P D N+  Q++VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMGK  + DQEGIIP LC  LF +++D    N+D    + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPL+GPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D D E T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++      KKK+   FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELKEEV +L+++L  + + ++ E LS     I  I  + +    S +++ +        +  L +    I+ L++         E + + +++E  +AEL  T +            +R   + +  +AL+AE  V   +DG T VG       P +VN                           SS+ DI LSG  I   HC+F    N  GE  V L     AE YVNGKR+ E T LKS +R+I GK+HVFRFN+P  A+  RE+    + P E +DW FA  ELLEKQG+D+++EM+ RL  LE+Q++KE+EEA  + E+Q+ +YE K++ L++QV   S    +    ++E  +   W++R+ +LA WAF KW+ +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YS        +       SIA   E +                                +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP   +      ++GGDPFYDRFPWF+LVGR+ + 
Sbjct:    4 ASVKVAVRVRPFNSREIGKDSKCIIQMSGNTTTILNPKQPKENKSFNFDYSYWSHTTPEDVNYACQKQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQEGIIPLLCEDLFTKIND----NNDNN--MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKQHDNDSENTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMNK-----KKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIENLSNYKANISSIQAVNQRGDFSTVTNAMTGMSPSPSLSALTSRVGSISSLHDRIMFSPGSEEAIERLKETEKIIAELNETWE---------EKLRRTEAIRMEREALLAEMGVAMREDGGT-VGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITKVGREDASSRQDIVLSGHFIKDEHCIFTSTTNAIGEGTVVLEPCEGAETYVNGKRVTEPTVLKSGNRIIMGKSHVFRFNDPEQARQDRERTPCADTPVEPVDWAFAQRELLEKQGIDMKQEMDQRLQELEDQYRKEREEASNLLEQQRLDYESKLEALQKQV--NSRYYPETTEEEEELEDEVPWTKRETELALWAFRKWRFYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYS-------PLPPDLLPPSIAKDREKRL-----------------------------FPRTIVAVEVQDQKNGATHYWTLDKLRQRLDLMREMYDRAAE----VPSTAVEDCDHIMSGGDPFYDRFPWFRLVGRTPIL 873          

HSP 2 Score: 429.869 bits (1104), Expect = 1.125e-122
Identity = 251/600 (41.83%), Postives = 345/600 (57.50%), Query Frame = 2
Query: 2744 GGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYH-----SALTQLEFDDDTYFLQKSLLTRNSTGLS-DKTDND----SVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDL---QLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKL 4501
            G DPFYDR+P F LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E +           +  I   D   + +      S ++Q    ++   + +     +  GLS D+ +N+    S D+  +P K   E                      + D     LK+G  F FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN  V VT++FV+YIK+  I FE+F H + +    P     + S +  +       PL  PVP+ K         G    +YDL+ +FEI EL ANG+Y+   VDH    PCHG F++HQ +QRR +VTI HE   D    E   L+         GR+R+ PE  +      +LSLN+L ++YI    D+R  +RFEAAWDSS+H S LLN +T   E I++T+S YL++ENC +P  +TKDFC+V   RD++L   R  +N+FS  +         +  + N VTG+Y+L    L  I S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL
Sbjct:  954 GQDPFYDRWPLFSLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADEEAPDYGSGVRQSGTAKISFEDQAFEKFQTEACTSGMSQTHTSEEELRIVEGEGQNSELGLSADEVNNNTCLVSPDISDSPLKGVLE-----------------CPLDVTQDKSLQHLKIGSNFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNITVEVTKSFVEYIKSQPIVFEVFGHYQ-KQPFPPLCKDLISSLRPMRRQFPRVMPLSKPVPATKLSTLARSTAGPCHCKYDLMAFFEICELEANGDYIPAVVDHRGGMPCHGTFLLHQGIQRRITVTIAHETGNDIEWKEVKELVI--------GRIRNTPEADETIIDPNILSLNILSSNYIRPTYDDRTFYRFEAAWDSSMHNSLLLNRVTPYGEKIYITLSAYLEMENCTQPTVVTKDFCMVFYSRDAKLPASRSIRNLFSTGAF--------RPLESNCVTGVYELSLCHLADIGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKL 1519          

HSP 3 Score: 124.405 bits (311), Expect = 9.829e-28
Identity = 65/141 (46.10%), Postives = 90/141 (63.83%), Query Frame = 2
Query: 5084 EIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRR 5506
            EIR+SP++S+KGYL+ LE    + WVKR++VVRRP++Y+Y  E+D VER IINL++AQ++Y+                      +T  R+    + F++   HR  L+Q   D  KE+HDWLYAFNPLLAG IRSKL RR+
Sbjct: 1664 EIRVSPIVSKKGYLHFLEPHT-SGWVKRYIVVRRPYVYLYRSERDYVERAIINLSSAQVEYS-------------------EDHHTLMRAP---NTFTVCTEHRNILLQATND--KEMHDWLYAFNPLLAGTIRSKLSRRK 1779          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Xenopus
Match: nos1ap (nitric oxide synthase 1 adaptor protein [Source:Xenbase;Acc:XB-GENE-5751148])

HSP 1 Score: 1288.86 bits (3334), Expect = 0.000e+0
Identity = 733/1510 (48.54%), Postives = 951/1510 (62.98%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI---------------SVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFN-----CEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKSL--LTRNSTG---LSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERI----MFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN REI +D+KCII M G+TT I  P   KE PKSF FDYSY S     DS +  Q++VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMG+  +  Q+GIIPQLC  LF R+ D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+QDI +L+D+GNK+RTVAATNMNETSSRSHAVF II +QR  D D + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++      KKK+K DFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       +       E+ +L ++   +GLS I +                   R     S+         +++ IE+L+ +EK+IAELNETWE+KL++TE +R  R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +   + + DI LSG  I   HC+F      C    VTL     A+ YVNGK++ +   L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EM+ RL  LE+Q++KE+EEA+ + E+Q+ +YE +++ L++Q+   S    +    ++E  +   W+E++Y LA WAF KWK +Q+TSLR             D LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   +  T       +P                                   +T + +EV+D KNGA HYW L K R+RLD++RE+Y   AE+    P  +       VTGGDPFYDRFPWF+LVGR+FV+LSNLLY+VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  ++   +TR+ T    L         + D  P            +      +       D  D     LKLG  F FRVT+LQ S +  +Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++FV+Y+K+  I FE+F H  Q P   L   + + L+SS+R    L    PL  PVP+ K      P  G    +YDL+ +F+I EL ANG+Y+ V VDH    PCHG F++HQ +QRR SVT+VHE          + L +  VRE+VVGR+R+ PE  +      +LSLN+L A Y    G +R+     + FE AWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y++ L ++    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL    R
Sbjct:    4 ASVKVAVRVRPFNSREIGKDSKCIIQMSGNTTTIVNPKQPKETPKSFSFDYSYWSHTSEEDSQYAGQRQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGR-QEPTQQGIIPQLCEDLFSRISDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYQDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDADAQTTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMN------KKKKKNDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------RLIRELKDEVARLRDLLGAQGLSDIIDTVNALTGMSPSSSMSGLSSRAASVTSLHERLAFTPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMDREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDA--TMRQDIVLSGHFIRDEHCIFRSDVLACGSVVVTLEPCDGADTYVNGKKLTDPCILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPSEPVDWAFAQRELLEKQGIDMKQEMDQRLQELEDQYRKEREEANYLLEQQRLDYESRLEALQRQM--DSRYFTEVNEEEEEPEDEVQWTEQEYDLALWAFRKWKWYQFTSLR-------------DQLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPDAHTER---EKRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDMMREMYDRAAEL----PSGLTEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYSVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFQKFQAETCPGMTRSGTSQEELRIVEGGQGQNPDSCPSADEVNNNTCAASLQSSLLDSPTKPPFDLSDTMGHPLKLGSIFTFRVTVLQASSIPPEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTQSFVEYVKSQPIVFEVFGHYQQHPFPPLCKDVLSPLRSSRR---LLPRVMPLSKPVPATKLSRQRVPSVGPCHCKYDLMAYFQICELEANGDYIPVSVDHGVGLPCHGTFLLHQGIQRRISVTLVHE--------AGAELKWLEVRELVVGRIRNTPEADESLIDPNILSLNILSAGYRPPEGGDRVFLGTFYHFEVAWDSSMHNSLLLNRVTPYREKIYMTLSAYVEMENCTQPAVITKDFCMVFYSRDAKLPACRSIRNL--------FGTGSLRASESNRVTGVYEMSLCRVAETSSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLEATLR 1401          

HSP 2 Score: 126.331 bits (316), Expect = 3.278e-28
Identity = 66/149 (44.30%), Postives = 89/149 (59.73%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
             V E  E+R+SP++S+KGYL+ LE      WVKR+VVVRRP++YIY  ++DPVER I+NL+ A ++Y+                 +  A    P +   C+       HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1561 FVPEIQEVRVSPIVSKKGYLHFLEPHT-GGWVKRYVVVRRPYVYIYNSDRDPVERAILNLSQAHVEYSE----------------DQQAMLKTPNTFAVCTQ------HRGILLQASND--KDMHDWLYAFNPLLAGSIRSKLSRRRSA 1684          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Xenopus
Match: KIF1B (kinesin family member 1B [Source:NCBI gene;Acc:100379810])

HSP 1 Score: 1286.94 bits (3329), Expect = 0.000e+0
Identity = 736/1508 (48.81%), Postives = 970/1508 (64.32%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLS-------------------GIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVF----NCEGEHVTLTAIGD-AECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKS-----LLTRNSTGLSDK--TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTG-LLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH-QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYI-SNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEA 4510
            +SVKVAVRVRPFN RE+S+++KCII M+G++T+I  P + KE  KSF FDYSY S     D  F +Q  VY+D+G++ LEHA EGYNVCI AYGQTGAGKSY+MMGK  +  Q GIIPQLC  LF++++D   +N+DE ++   ++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+DAGNK+RTVAATNMNETSSRSHAVFTI+ +Q+ LD    L+ EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ +    +KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN +LVRELK+EV +L+++L+ + +  G+ L                    G+  ++ I+E          +     ++ IE+L+ SEK+IAELNETWE+KL+KTE +R  R++ LAE+G+ I+ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VGQ +    S+ DI LSG  I   HC+F    N  GE +     GD +E YVNGKR+     L+S +R+I GKNHVFRFN+P  A+  REK    E P E +DW FA  ELLEKQG+D+++EME RL  +E  +KKEKEEAD + E+Q+ +YE K+Q L++QV   S+ +A+     +E  E   W++ +Y +A WAF KW++HQ+TSLRD              LW N ++LKEANA+S EL KKV FQF LLT+T YSP+                   PE+  + D +K+                        +T + +EV+D+KNGA HYW L K R RL+ +RE+Y    EM   V D   N  +  +TG DPFYDRF WF+LVGR+FV+LSNLL+ VPL+HR A+V+EKGEV+G LRVA+Q I   E                 +  D  S    S   ++ FD++  ++ K+     +LTR+   L +    +    + D T   S  E     +      N        +    D G  LK+G  F FRVT+LQ SG+  +Y D FCQ++FL++ ++ +STEPLKN G+  P+GFYHVQN AV +T +F++YIKN  I FE+F H Q+  ++L+     +L   ++ + +     PL  PVP+ K    +    G ++ +YDLLVWFEI EL   GEY+   VDHS   PC G F++HQ +QRR +VTIVHE   +    +   L+   VR              D      VLSLN++ A Y+ S+    R  +RFEA WDSSLH S LLN +T   E I++T+S YL++++CI+P  ITKD C++   RD+++S PR            F   + K+ D NRVTGIY+L L ++    S    RR ++  + +  YVRGEEN+ GWRPR DSLIL+HQW+LEK+ +L  VEK RH+LLLR+KL ++
Sbjct:    4 ASVKVAVRVRPFNSRELSKESKCIIQMQGNSTSIINPKNPKEAAKSFSFDYSYWSHTSQDDPCFASQSRVYNDIGKEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGKQEE-TQAGIIPQLCEDLFEKIND---NNNDEVSF---SVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKRLDIGTNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVTRLKDLLRAQGL--GDILDTSISSLASSPSSCSLSSQVGLTSVTSIQE--------RIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMDREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGLTRVGQADA--DSRQDIVLSGAHIKEEHCIFRSERNSNGEVIVTLEPGDRSETYVNGKRVVHPVELRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQKQVETHSL-AAETTDDGEEEEEEVPWTQHEYDVALWAFKKWRNHQFTSLRDL-------------LWGNAMYLKEANAISVELKKKVQFQFVLLTDTLYSPLP------------------PELLPS-DADKTTEDRTFP-----------------RTVVAVEVQDLKNGATHYWSLEKLRLRLEQMREMYDRAGEMASHVQDE--NDTV--ITGNDPFYDRFHWFKLVGRAFVYLSNLLFPVPLVHRAAIVSEKGEVRGFLRVAVQAISGDE-----------------EAPDYGSGIRQSGTAKISFDNE--YINKNEISSMVLTRSGLSLEELRIVEGQGQNSDIT---SLEEVNHLADLDLKSGNLLDGKMMMEGFSEDVGEHLKIGSMFTFRVTVLQASGIPPEYADIFCQFNFLHRHDEAFSTEPLKNSGRGNPLGFYHVQNIAVEITESFIEYIKNNPIVFEVFGHYQQHPLHLQ---GQDLSPPQQCRRYFPPPMPLSKPVPATKLNPLSKQSLGQVISKYDLLVWFEISELEPTGEYIPAVVDHSGGLPCQGTFLLHQGIQRRITVTIVHEKGNELHWKDVRELVVGRVRNKA-----------DEAAADAVLSLNIISAKYLRSSHSSGRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVITKDVCMIFYSRDAKISPPR-------SLRSLFGSGYSKSPDCNRVTGIYELSLCKMADTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKMEQLHEVEKTRHLLLLRDKLGDS 1395          

HSP 2 Score: 127.487 bits (319), Expect = 1.492e-28
Identity = 92/250 (36.80%), Postives = 135/250 (54.00%), Query Frame = 2
Query: 4799 REKLLTSRCVELMTVSNKSQTYQ----SSMGKE---DMFKSEML--DSSVSMINDSHLFN-DEGSMMTNSRPMTTSLMTESIMSSEDGCRS----AWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRR 5506
            REK L ++C+ L+T +   +  Q    S +G++     F S  L   S+   + DS   + D+ +   NSR  +     E         RS    A KN    LV + +EIR   V+S+KGYLN  +E    +WVK +VVVRRP+++IY  +KDPVERG+INL+TAQ++Y+   + + +                      S ++F++   +R  L+Q I D  K+++DWLYAFNPLLAG IRSKL RRR
Sbjct: 1451 REKELATKCLRLLTHTFNQELTQLSDISPIGRDPSVSSFSSATLTPSSTCPSLADSRCSSVDQKTPEANSRASSPCTEFEQFHLVPAVERSFLARAGKNEFLNLVPDIEEIRPGSVVSKKGYLNF-KEPLSHSWVKHFVVVRRPYVFIYNSDKDPVERGLINLSTAQVEYSEDQQAMVK----------------------SSNIFAVCTMYRGILLQAIND--KDMNDWLYAFNPLLAGTIRSKLARRR 1675          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Xenopus
Match: nos1ap (nitric oxide synthase 1 adaptor protein [Source:Xenbase;Acc:XB-GENE-5751148])

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 734/1517 (48.38%), Postives = 953/1517 (62.82%), Query Frame = 2
Query:   80 IKPKKLLMSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI---------------SVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFN-----CEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKSL--LTRNSTG---LSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDE--------RIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKL 4501
            +K + +  +SVKVAVRVRPFN REI +D+KCII M G+TT I  P   KE PKSF FDYSY S     DS +  Q++VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMG+  +  Q+GIIPQLC  LF R+ D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+QDI +L+D+GNK+RTVAATNMNETSSRSHAVF II +QR  D D + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K DFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       +       E+ +L ++   +GLS I +                   R     S+         +++ IE+L+ +EK+IAELNETWE+KL++TE +R  R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +   + + DI LSG  I   HC+F      C    VTL     A+ YVNGK++ +   L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EM+ RL  LE+Q++KE+EEA+ + E+Q+ +YE +++ L++Q+   S    +    ++E  +   W+E++Y LA WAF KWK +Q+TSLR             D LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   +  T       +P                                   +T + +EV+D KNGA HYW L K R+RLD++RE+Y   AE+    P  +       VTGGDPFYDRFPWF+LVGR+FV+LSNLLY+VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  ++   +TR+ T    L         + D  P            +      +       D  D     LKLG  F FRVT+LQ S +  +Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++FV+Y+K+  I FE+F H  Q P   L   + + L+SS+R    L    PL  PVP+ K      P  G    +YDL+ +F+I EL ANG+Y+ V VDH    PCHG F++HQ +QRR SVT+VHE          + L +  VRE+VVGR+R+ PE  +      +LSLN+L A Y    G +        R  + FE AWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y++ L ++    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL
Sbjct:   22 LKSQDMAGASVKVAVRVRPFNSREIGKDSKCIIQMSGNTTTIVNPKQPKETPKSFSFDYSYWSHTSEEDSQYAGQRQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGR-QEPTQQGIIPQLCEDLFSRISDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYQDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDADAQTTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGTNKNKKKKKNDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------RLIRELKDEVARLRDLLGAQGLSDIIDTVNALTGMSPSSSMSGLSSRAASVTSLHERLAFTPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMDREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDA--TMRQDIVLSGHFIRDEHCIFRSDVLACGSVVVTLEPCDGADTYVNGKKLTDPCILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPSEPVDWAFAQRELLEKQGIDMKQEMDQRLQELEDQYRKEREEANYLLEQQRLDYESRLEALQRQM--DSRYFTEVNEEEEEPEDEVQWTEQEYDLALWAFRKWKWYQFTSLR-------------DQLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPDAHTER---EKRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDMMREMYDRAAEL----PSGLTEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYSVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFQKFQAETCPGMTRSGTSQEELRIVEGGQGQNPDSCPSADEVNNNTCAASLQSSLLDSPTKPPFDLSDTMGHPLKLGSIFTFRVTVLQASSIPPEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTQSFVEYVKSQPIVFEVFGHYQQHPFPPLCKDVLSPLRSSRR---LLPRVMPLSKPVPATKLSRQRVPSVGPCHCKYDLMAYFQICELEANGDYIPVSVDHGVGLPCHGTFLLHQGIQRRISVTLVHE--------AGAELKWLEVRELVVGRIRNTPEADESLIDPNILSLNILSAGYRPPEGGDRCQSGRGTRTFYHFEVAWDSSMHNSLLLNRVTPYREKIYMTLSAYVEMENCTQPAVITKDFCMVFYSRDAKLPACRSIRNL--------FGTGSLRASESNRVTGVYEMSLCRVAETSSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKL 1432          

HSP 2 Score: 126.716 bits (317), Expect = 2.941e-28
Identity = 90/276 (32.61%), Postives = 135/276 (48.91%), Query Frame = 2
Query: 4766 GDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTT--SLMTESIMSSEDGCRSAWKNNSPR-------------------------LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
             +E+ L     R+K L ++C+ L+T    ++ Y  S       +S++ + SV+++ D  L    G  + +  P +T  SL+     S E   +   +  SP                           V E  E+R+SP++S+KGYL+ LE      WVKR+VVVRRP++YIY  ++DPVER I+NL+ A ++Y+                 +  A    P +   C+       HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1471 AEENPLETASERQKELAAKCLRLLT-HTFNREYSYSHVCVSASESKLSEMSVTLLRDPSL---SGLGVNSLTPSSTCPSLVEGRYCSPEASPQPISRVFSPERELLSPAGDLLKSPSGELKTPTLNLFVPEIQEVRVSPIVSKKGYLHFLEPHT-GGWVKRYVVVRRPYVYIYNSDRDPVERAILNLSQAHVEYSE----------------DQQAMLKTPNTFAVCTQ------HRGILLQASND--KDMHDWLYAFNPLLAGSIRSKLSRRRSA 1717          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Xenopus
Match: nos1ap (nitric oxide synthase 1 adaptor protein [Source:Xenbase;Acc:XB-GENE-5751148])

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 735/1523 (48.26%), Postives = 954/1523 (62.64%), Query Frame = 2
Query:   80 IKPKKLLMSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI---------------SVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFN-----CEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKSL--LTRNSTG---LSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDE---------RIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +K + +  +SVKVAVRVRPFN REI +D+KCII M G+TT I  P   KE PKSF FDYSY S     DS +  Q++VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMG+  +  Q+GIIPQLC  LF R+ D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+QDI +L+D+GNK+RTVAATNMNETSSRSHAVF II +QR  D D + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K DFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       +       E+ +L ++   +GLS I +                   R     S+         +++ IE+L+ +EK+IAELNETWE+KL++TE +R  R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +   + + DI LSG  I   HC+F      C    VTL     A+ YVNGK++ +   L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EM+ RL  LE+Q++KE+EEA+ + E+Q+ +YE +++ L++Q+   S    +    ++E  +   W+E++Y LA WAF KWK +Q+TSLR             D LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   +  T       +P                                   +T + +EV+D KNGA HYW L K R+RLD++RE+Y   AE+    P  +       VTGGDPFYDRFPWF+LVGR+FV+LSNLLY+VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  ++   +TR+ T    L         + D  P            +      +       D  D     LKLG  F FRVT+LQ S +  +Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++FV+Y+K+  I FE+F H  Q P   L   + + L+SS+R    L    PL  PVP+ K      P  G    +YDL+ +F+I EL ANG+Y+ V VDH    PCHG F++HQ +QRR SVT+VHE          + L +  VRE+VVGR+R+ PE  +      +LSLN+L A Y    G +         R  + FE AWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y++ L ++    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL    R
Sbjct:   22 LKSQDMAGASVKVAVRVRPFNSREIGKDSKCIIQMSGNTTTIVNPKQPKETPKSFSFDYSYWSHTSEEDSQYAGQRQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGR-QEPTQQGIIPQLCEDLFSRISDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYQDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDADAQTTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGTNKNKKKKKNDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------RLIRELKDEVARLRDLLGAQGLSDIIDTVNALTGMSPSSSMSGLSSRAASVTSLHERLAFTPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMDREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDA--TMRQDIVLSGHFIRDEHCIFRSDVLACGSVVVTLEPCDGADTYVNGKKLTDPCILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPSEPVDWAFAQRELLEKQGIDMKQEMDQRLQELEDQYRKEREEANYLLEQQRLDYESRLEALQRQM--DSRYFTEVNEEEEEPEDEVQWTEQEYDLALWAFRKWKWYQFTSLR-------------DQLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPDAHTER---EKRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDMMREMYDRAAEL----PSGLTEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYSVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFQKFQAETCPGMTRSGTSQEELRIVEGGQGQNPDSCPSADEVNNNTCAASLQSSLLDSPTKPPFDLSDTMGHPLKLGSIFTFRVTVLQASSIPPEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTQSFVEYVKSQPIVFEVFGHYQQHPFPPLCKDVLSPLRSSRR---LLPRVMPLSKPVPATKLSRQRVPSVGPCHCKYDLMAYFQICELEANGDYIPVSVDHGVGLPCHGTFLLHQGIQRRISVTLVHE--------AGAELKWLEVRELVVGRIRNTPEADESLIDPNILSLNILSAGYRPPEGGDRQFLDSDTPRTFYHFEVAWDSSMHNSLLLNRVTPYREKIYMTLSAYVEMENCTQPAVITKDFCMVFYSRDAKLPACRSIRNL--------FGTGSLRASESNRVTGVYEMSLCRVAETSSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLEATLR 1438          

HSP 2 Score: 126.716 bits (317), Expect = 2.527e-28
Identity = 90/276 (32.61%), Postives = 135/276 (48.91%), Query Frame = 2
Query: 4766 GDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTT--SLMTESIMSSEDGCRSAWKNNSPR-------------------------LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
             +E+ L     R+K L ++C+ L+T    ++ Y  S       +S++ + SV+++ D  L    G  + +  P +T  SL+     S E   +   +  SP                           V E  E+R+SP++S+KGYL+ LE      WVKR+VVVRRP++YIY  ++DPVER I+NL+ A ++Y+                 +  A    P +   C+       HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1472 AEENPLETASERQKELAAKCLRLLT-HTFNREYSYSHVCVSASESKLSEMSVTLLRDPSL---SGLGVNSLTPSSTCPSLVEGRYCSPEASPQPISRVFSPERELLSPAGDLLKSPSGELKTPTLNLFVPEIQEVRVSPIVSKKGYLHFLEPHT-GGWVKRYVVVRRPYVYIYNSDRDPVERAILNLSQAHVEYSE----------------DQQAMLKTPNTFAVCTQ------HRGILLQASND--KDMHDWLYAFNPLLAGSIRSKLSRRRSA 1718          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Xenopus
Match: nos1ap (nitric oxide synthase 1 adaptor protein [Source:Xenbase;Acc:XB-GENE-5751148])

HSP 1 Score: 1279.62 bits (3310), Expect = 0.000e+0
Identity = 734/1526 (48.10%), Postives = 953/1526 (62.45%), Query Frame = 2
Query:   80 IKPKKLLMSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI---------------SVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFN-----CEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKSL--LTRNSTG---LSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDE-----------------RIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKL 4501
            +K + +  +SVKVAVRVRPFN REI +D+KCII M G+TT I  P   KE PKSF FDYSY S     DS +  Q++VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMG+  +  Q+GIIPQLC  LF R+ D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+QDI +L+D+GNK+RTVAATNMNETSSRSHAVF II +QR  D D + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K DFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       +       E+ +L ++   +GLS I +                   R     S+         +++ IE+L+ +EK+IAELNETWE+KL++TE +R  R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +   + + DI LSG  I   HC+F      C    VTL     A+ YVNGK++ +   L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EM+ RL  LE+Q++KE+EEA+ + E+Q+ +YE +++ L++Q+   S    +    ++E  +   W+E++Y LA WAF KWK +Q+TSLR             D LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   +  T       +P                                   +T + +EV+D KNGA HYW L K R+RLD++RE+Y   AE+    P  +       VTGGDPFYDRFPWF+LVGR+FV+LSNLLY+VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  ++   +TR+ T    L         + D  P            +      +       D  D     LKLG  F FRVT+LQ S +  +Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++FV+Y+K+  I FE+F H  Q P   L   + + L+SS+R    L    PL  PVP+ K      P  G    +YDL+ +F+I EL ANG+Y+ V VDH    PCHG F++HQ +QRR SVT+VHE          + L +  VRE+VVGR+R+ PE  +      +LSLN+L A Y    G +                 R  + FE AWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y++ L ++    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL
Sbjct:   22 LKSQDMAGASVKVAVRVRPFNSREIGKDSKCIIQMSGNTTTIVNPKQPKETPKSFSFDYSYWSHTSEEDSQYAGQRQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGR-QEPTQQGIIPQLCEDLFSRISDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYQDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDADAQTTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGTNKNKKKKKNDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------RLIRELKDEVARLRDLLGAQGLSDIIDTVNALTGMSPSSSMSGLSSRAASVTSLHERLAFTPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMDREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDA--TMRQDIVLSGHFIRDEHCIFRSDVLACGSVVVTLEPCDGADTYVNGKKLTDPCILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPSEPVDWAFAQRELLEKQGIDMKQEMDQRLQELEDQYRKEREEANYLLEQQRLDYESRLEALQRQM--DSRYFTEVNEEEEEPEDEVQWTEQEYDLALWAFRKWKWYQFTSLR-------------DQLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPDAHTER---EKRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDMMREMYDRAAEL----PSGLTEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYSVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFQKFQAETCPGMTRSGTSQEELRIVEGGQGQNPDSCPSADEVNNNTCAASLQSSLLDSPTKPPFDLSDTMGHPLKLGSIFTFRVTVLQASSIPPEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTQSFVEYVKSQPIVFEVFGHYQQHPFPPLCKDVLSPLRSSRR---LLPRVMPLSKPVPATKLSRQRVPSVGPCHCKYDLMAYFQICELEANGDYIPVSVDHGVGLPCHGTFLLHQGIQRRISVTLVHE--------AGAELKWLEVRELVVGRIRNTPEADESLIDPNILSLNILSAGYRPPEGGDRQFLDSDTPSCQSGRGTRTFYHFEVAWDSSMHNSLLLNRVTPYREKIYMTLSAYVEMENCTQPAVITKDFCMVFYSRDAKLPACRSIRNL--------FGTGSLRASESNRVTGVYEMSLCRVAETSSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKL 1441          

HSP 2 Score: 126.716 bits (317), Expect = 2.998e-28
Identity = 90/276 (32.61%), Postives = 135/276 (48.91%), Query Frame = 2
Query: 4766 GDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTT--SLMTESIMSSEDGCRSAWKNNSPR-------------------------LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
             +E+ L     R+K L ++C+ L+T    ++ Y  S       +S++ + SV+++ D  L    G  + +  P +T  SL+     S E   +   +  SP                           V E  E+R+SP++S+KGYL+ LE      WVKR+VVVRRP++YIY  ++DPVER I+NL+ A ++Y+                 +  A    P +   C+       HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1480 AEENPLETASERQKELAAKCLRLLT-HTFNREYSYSHVCVSASESKLSEMSVTLLRDPSL---SGLGVNSLTPSSTCPSLVEGRYCSPEASPQPISRVFSPERELLSPAGDLLKSPSGELKTPTLNLFVPEIQEVRVSPIVSKKGYLHFLEPHT-GGWVKRYVVVRRPYVYIYNSDRDPVERAILNLSQAHVEYSE----------------DQQAMLKTPNTFAVCTQ------HRGILLQASND--KDMHDWLYAFNPLLAGSIRSKLSRRRSA 1726          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Mouse
Match: Kif1a (kinesin family member 1A [Source:MGI Symbol;Acc:MGI:108391])

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 736/1509 (48.77%), Postives = 960/1509 (63.62%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C A+INEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HC+F  +    GE  VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  ++      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P           +        D  + +   G  DT L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + Y+    D+R  ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL    R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGVTRVGREDA--ERRQDIVLSGHFIKEEHCIFRSDSRGGGEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVVEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADAGPSADEVNN-NTCSAVPPEGLMDSPEKAALDGPLDTALDHLRLGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTMTRPSPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDEALIDPNILSLNILSSGYVHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVITKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRATEGNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETTQR 1405          

HSP 2 Score: 123.25 bits (308), Expect = 2.246e-27
Identity = 67/149 (44.97%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    A W KR+VVVRRP+ Y+Y  +KD VER ++NL+TAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1562 LVPDIQEIRVSPIVSKKGYLHFLEPHT-AGWAKRFVVVRRPYAYMYNSDKDTVERFVLNLSTAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQANSD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1685          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Mouse
Match: Kif1a (kinesin family member 1A [Source:MGI Symbol;Acc:MGI:108391])

HSP 1 Score: 1278.85 bits (3308), Expect = 0.000e+0
Identity = 737/1517 (48.58%), Postives = 961/1517 (63.35%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMF--------RFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C A+INEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HC+F  +    GE  VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  ++      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P           +        D  + +   G  DT L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + Y+    D+R+ F        +FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL    R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGVTRVGREDA--ERRQDIVLSGHFIKEEHCIFRSDSRGGGEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVVEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADAGPSADEVNN-NTCSAVPPEGLMDSPEKAALDGPLDTALDHLRLGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTMTRPSPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDEALIDPNILSLNILSSGYVHPAQDDRVSFGNDTRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVITKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRATEGNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETTQR 1413          

HSP 2 Score: 123.25 bits (308), Expect = 2.329e-27
Identity = 67/149 (44.97%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    A W KR+VVVRRP+ Y+Y  +KD VER ++NL+TAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1570 LVPDIQEIRVSPIVSKKGYLHFLEPHT-AGWAKRFVVVRRPYAYMYNSDKDTVERFVLNLSTAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQANSD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1693          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Mouse
Match: Kif1a (kinesin family member 1A [Source:MGI Symbol;Acc:MGI:108391])

HSP 1 Score: 1277.69 bits (3305), Expect = 0.000e+0
Identity = 736/1518 (48.48%), Postives = 960/1518 (63.24%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDE---------RIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C A+INEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HC+F  +    GE  VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  ++      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P           +        D  + +   G  DT L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + Y+    D+         R  ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL    R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGVTRVGREDA--ERRQDIVLSGHFIKEEHCIFRSDSRGGGEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVVEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADAGPSADEVNN-NTCSAVPPEGLMDSPEKAALDGPLDTALDHLRLGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTMTRPSPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDEALIDPNILSLNILSSGYVHPAQDDRQFLDSDIPRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVITKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRATEGNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETTQR 1414          

HSP 2 Score: 123.25 bits (308), Expect = 2.214e-27
Identity = 67/149 (44.97%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    A W KR+VVVRRP+ Y+Y  +KD VER ++NL+TAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1571 LVPDIQEIRVSPIVSKKGYLHFLEPHT-AGWAKRFVVVRRPYAYMYNSDKDTVERFVLNLSTAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQANSD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1694          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Mouse
Match: Kif1b (kinesin family member 1B [Source:MGI Symbol;Acc:MGI:108426])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 495/923 (53.63%), Postives = 628/923 (68.04%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISV---------------IRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVF 2806
            +SVKVAVRVRPFN RE S+++KCII M+G++T+I  P + KE PKSF FDYSY S   P D  F +Q  VY+D+G++ L HA EGYNVCI AYGQTGAGKSY+MMGK  +  Q GIIPQLC  LF++++D    N +E   + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+DAGNK+RTVAATNMNETSSRSHAVFTI+ +Q+  D +  L+ EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+S      KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       K       E+ +L+++   +GL  I + S+               +      S+    +     ++ IE+L+ SEK+IAELNETWE+KL+KTE +R +R++ LAE+G+ I+ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VGQ +     + DI LSG  I   HC+F  E  +     VTL     +E YVNGKR+     L+S +R+I GKNHVFRFN+P  A+  REK    E P E +DW FA  ELLEKQG+D+++EME RL  +E  +KKEKEEAD + E+Q+ +YE K+Q L++QV   S+ +      ++E   P  W++ +++LA WAF KWK HQ+TSLRD              LW N V+LKEANA+S EL KKV FQF LLT+T YSP+  ++   EM  ++     +P                                   +T + +EV+D+KNGA HYW L K ++RLDL+RE+Y    E+  +  D   +S+  ++TG DPFYDRF WF+LVG S +F
Sbjct:    4 ASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTSPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEE-SQAGIIPQLCEELFEKIND----NCNEE--MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKQDPETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVS------KKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNA------KLVRELKEEVTRLKDLLRAQGLGDIIDTSMGSLTSSPSSCSLNSQVGLTSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADA--ERRQDIVLSGAHIKEEHCLFRSERSNTGEVIVTLEPCERSETYVNGKRVAHPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQRQVETRSLAAETTEEEEEEEEVP--WTQHEFELAQWAFRKWKSHQFTSLRDL-------------LWGNAVYLKEANAISVELKKKVQFQFVLLTDTLYSPVPPELLPSEMEKTH---EDRP---------------------------------FPRTVVAVEVQDLKNGATHYWSLDKLKQRLDLMREMYDRAGEVASSAQD---DSET-TMTGSDPFYDRFHWFKLVGSSPIF 850          

HSP 2 Score: 427.557 bits (1098), Expect = 6.615e-122
Identity = 265/604 (43.87%), Postives = 359/604 (59.44%), Query Frame = 2
Query: 2744 GGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSL----LTRNSTGLSD----KTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH-QEPRINLEPY-LDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNV-GDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEA 4510
            G DPFYDR PWF LVGR+FV+LSNLLY VPLIHRVA+V+EKGEV+G LRVA+Q I   E                 +  D  S    S   ++ FD++ YF Q       +TR+   L +    +    S +V   P +     R ++ +       DG        +     LKLG  F FRVT+LQ SG+  +Y D FCQ++FL++ ++ +STEPLKN G+ +P+GFYHVQN AV VT +FVDYIK   I FE+F H Q+  ++L+   L++  Q S+R   F     PL  PVP+ K    N    G  + +YDLLVWFEI EL   GEY+   VDH+   PC G F++HQ +QRR +VTI+HE        + S L +  VRE+VVGR+R++PE +D      VLSLN++ A  +       R  +RFEA WDSSLH S LLN +T   E I++T+S YL++++CI+P  ITKD C+V   RD+++S PR  +N+        F   + K+ D NRVTGIY+L L ++    S    RR ++  + +  YVRGEEN+ GWRPR DSLIL+HQW+LEKL  L  VEK RH LLLRE+L ++
Sbjct:  913 GHDPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADE-----------------EAPDYGSGIRQSGTAKISFDNE-YFNQSDFSSAAMTRSGLSLEELRIVEGQGQSSEVISPPEEVN---RMNDLDLKSGTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQFNFLHRHDEAFSTEPLKNNGRGSPLGFYHVQNIAVEVTESFVDYIKTKPIVFEVFGHYQQHPLHLQGQDLNSPPQPSRR---FFPPPMPLSKPVPATKLNTMNKTTLGQSMSKYDLLVWFEISELEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHE--------KGSELHWKDVRELVVGRIRNKPE-VDEAAVDAVLSLNIISAKSLKAAHSSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRNL--------FGSGYSKSPDSNRVTGIYELSLCKMADTGSPGMQRRRRKVLDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLELLHEVEKTRHFLLLRERLGDS 1475          

HSP 3 Score: 122.479 bits (306), Expect = 3.972e-27
Identity = 68/154 (44.16%), Postives = 94/154 (61.04%), Query Frame = 2
Query: 5042 AWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRR 5503
            A KN    LV + +E+R   V+S+KGYL+  +E   +NW K +VVVRRP+++IY  +KDPVERGIINL+TAQ++Y+                 +  A    P +      F++   HR  L+Q + D  K+++DWLYAFNPLLAG IRSKL RR
Sbjct: 1635 AGKNEFLNLVPDIEEVRAGSVVSKKGYLHF-KEPLSSNWAKHFVVVRRPYVFIYNSDKDPVERGIINLSTAQVEYSE----------------DQQAMVKTPNT------FAVCTKHRGVLLQALND--KDMNDWLYAFNPLLAGTIRSKLSRR 1763          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Mouse
Match: Kif1a (kinesin family member 1A [Source:MGI Symbol;Acc:MGI:108391])

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 462/1067 (43.30%), Postives = 636/1067 (59.61%), Query Frame = 2
Query: 1379 VIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEHV-TLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
             IE+L+ +EK+IAELNETWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HC+F  +    GE V TL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  ++      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P           +        D  + +   G  DT L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + Y+    D+R  ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL    R
Sbjct:  442 AIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGVTRVGREDA--ERRQDIVLSGHFIKEEHCIFRSDSRGGGEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVVEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADAGPSADEVNN-NTCSAVPPEGLMDSPEKAALDGPLDTALDHLRLGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTMTRPSPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDEALIDPNILSLNILSSGYVHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVITKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRATEGNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETTQR 1414          

HSP 2 Score: 536.184 bits (1380), Expect = 1.607e-159
Identity = 271/369 (73.44%), Postives = 308/369 (83.47%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPN 1204
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C A+INEDPN
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIINEDPN 365          

HSP 3 Score: 123.25 bits (308), Expect = 2.310e-27
Identity = 67/149 (44.97%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    A W KR+VVVRRP+ Y+Y  +KD VER ++NL+TAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1571 LVPDIQEIRVSPIVSKKGYLHFLEPHT-AGWAKRFVVVRRPYAYMYNSDKDTVERFVLNLSTAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQANSD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1694          
BLAST of Kinesin-like protein KIF1A vs. UniProt/SwissProt
Match: sp|Q12756|KIF1A_HUMAN (Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2)

HSP 1 Score: 1289.63 bits (3336), Expect = 0.000e+0
Identity = 737/1509 (48.84%), Postives = 958/1509 (63.49%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HCVF  +        VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  +I      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P          +         D  + +   G  D  L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VDH    PC G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + YI    D+R  ++FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  +TKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL  A R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGRED--GERRQDIVLSGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVIEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADVGPSADEVNNNTCSAVPPEGLLLDSSEKAALDGPLDAALDHLRLGNTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTLTRPCPGPCHCKYDLLVYFEICELEANGDYIPAVVDHRGGMPCMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDESLIDPNILSLNILSSGYIHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVVTKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRASESNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETAQR 1406          

HSP 2 Score: 123.25 bits (308), Expect = 1.494e-26
Identity = 66/149 (44.30%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    + W +R+VVVRRP+ Y+Y  +KD VER ++NLATAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1563 LVPDIQEIRVSPIVSKKGYLHFLEPHT-SGWARRFVVVRRPYAYMYNSDKDTVERFVLNLATAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQAASD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1686          
BLAST of Kinesin-like protein KIF1A vs. UniProt/SwissProt
Match: sp|A1ZAJ2|KIF1A_DROME (Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1)

HSP 1 Score: 1282.7 bits (3318), Expect = 0.000e+0
Identity = 722/1483 (48.69%), Postives = 955/1483 (64.40%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP------KSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK--------KTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMI-------SADDYLSDDENYE----PTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLD-LDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMV 4462
            MSSVKVAVRVRPFN REI+R++KCII M G+TT I  P  K PP      K F FDYSY S    D++F  Q  VY D+GE+ L+H+ +GYNVCI AYGQTGAGKSY+MMG+  +  QEGIIP +C+ LF R+ D + D+      +++++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V  +QDI++LID GNK+RTVAATNMNETSSRSHAVFTI  +QR  D    LT EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++S  K+TK   K DFIP+RDS LTWLLRENLGGNSKTAM+ AISPADINY+ETLS+LRYADRAKQIVCKAV+NED N +L+RELKEE+ KLR++LK E IEV E    + + +VI+    +   S        +  +++L+ASEKLIAELNETWE+KL++TE++R QR++  AE+G+ +K DG   GVFS KK P+LVNLNED  ++ECL+YY+K+G T++G  E   +   DI LSG  I+  HC F  +   VTL    DA  YVNG+++ E   LK+  R+I GKNHVFRF NP  A+  R+K          VE+   + +DWNFA  ELLEKQG+DL+ EM+ RL  LEEQ+K+EK +AD+ FE+Q++ YE +I  L++QV + SM        S +D+  +++ Y      + W+ R+  LAAWAF KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+  ++ +             P +                                +KT + +EV D KNGA H+W L K R+RL+L+RE+Y NEAEM    PD      +ES+TGGDPFYDRFPWF++VGRSF++LSNLLY VPL+H+VA+VNE+G+V+G LR+A+QP+ + E       +         +    D+K  + AL   E DD   ++    L      L D      +D +     S +E  +++                         L++G+ F FRVT+LQ +G+ ++Y D FCQ++FL++  + +STEP+KN     P+GFYHVQN  V VT++F++Y+K   I F++F H +    L      +  S    +  L  + P+  PV S K          T+L ++D+LVWFEI EL+ NGEYV   V+HS + PC G+F++HQ +QRR  +TIVHEP T+    + + L+         GR+R+ PE  D  D+ + VLSL L P   +   GD+R  +RFEAAWDSSLH S LLN +++  E I++T+S YL++ENC +P  ITKD  +V+  RD++      K++FS +          +  + NR+TG+Y+L L+   +  S    RR +R  + +S YVRGEEN+ GWRPR DSLI DHQW+LEKLT+L+ V
Sbjct:    1 MSSVKVAVRVRPFNSREIARESKCIIEMAGATTAITNP--KVPPNTSDSVKRFNFDYSYWSHDHHDADFSTQSMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEE-QQEGIIPMICKDLFTRIQDTETDD------LKYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDLMTNLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKNTK---KADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKAEGIEVQEE-DELTKSTVIK----SPTKSRNRNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRVQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKEGLTRLGTHEA--NVPQDIQLSGSHILKEHCTFENKNSTVTLLPHKDAIIYVNGRKLVEPEVLKTGSRVILGKNHVFRFTNPEQARELRDKIETENEAENEVEKTDTQQVDWNFAQCELLEKQGIDLKAEMKKRLDNLEEQYKREKLQADQQFEEQRKTYEARIDALQKQVEEQSMTMSMYSSYSPEDFHQEEDVYTNPMYESCWTAREAGLAAWAFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELASTVAPVHQEDEFGAPPV--------------------------------SKTLVAVEVTDTKNGATHHWSLEKLRQRLELMREMYHNEAEMSPTSPDY----NVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQPVLDEESIDFNNGVKQSARLVFNED---DAKPKYRALN--EKDDVQRYIDNGGLDSKLEELEDVDSGRGIDSN-----SASECHENSEEPGEH-------------------LQVGKEFTFRVTVLQATGIGAEYADIFCQFNFLHRHEEAFSTEPVKNSASGAPLGFYHVQNITVPVTKSFIEYLKTQPIMFKIFGHYQTH-PLHKDAKQDFVSRPPPRRMLPPSIPISQPVRSPKFGPLPCAPTSTVLAKHDVLVWFEICELAPNGEYVPSVVEHSDDLPCRGLFLLHQGIQRRIRITIVHEPTTEVKWKDINELVV--------GRIRNTPESSDEQDEDACVLSLGLFPGEALEVPGDDRSFYRFEAAWDSSLHNSALLNRVSQGGETIYITLSAYLELENCARPAIITKDLSMVIYGRDARTGPRSLKHLFSGQY---------RNPEANRLTGVYELALRRASEAGSPGVQRRQRRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEV 1368          

HSP 2 Score: 139.043 bits (349), Expect = 2.569e-31
Identity = 91/246 (36.99%), Postives = 132/246 (53.66%), Query Frame = 2
Query: 4799 REKLLTSRCVELM------TVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRL-----VGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRR 5503
            RE+ L  +C++L+      + +N +QT QS +   D   ++M  S +S            SM  N   +   L +     + +G  +      P L     V E +EIR+SPV++RKG LN+LE    + W KRWV+VRRP+++IY  EKDPVER ++NLATA ++ +                 + +A    P +      FS+V  HR +L+QT+ D  KEVHDWLYA NPLLAGQI+S+L RR
Sbjct: 1436 REQDLMLKCLKLVQGRYTKSEANDTQT-QSDVSPSDEGCADMTVSCIS----------SNSMENNKFVIRRRLCSPDRADAPNGWEAPAPATQPALPLRLYVPELEEIRVSPVVARKGLLNVLEHGG-SGWKKRWVIVRRPYVFIYRSEKDPVERAVLNLATAHVECSE----------------DQAAMVKIPNT------FSVVTKHRGYLLQTLGD--KEVHDWLYAINPLLAGQIKSRLARR 1645          
BLAST of Kinesin-like protein KIF1A vs. UniProt/SwissProt
Match: sp|P33173|KIF1A_MOUSE (Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2)

HSP 1 Score: 1272.69 bits (3292), Expect = 0.000e+0
Identity = 736/1517 (48.52%), Postives = 959/1517 (63.22%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEI--SVIRECRXXXXXXXXXXXXXXXXVIEKL---RASEKLIAELNE----------TWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKS--LLTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMF--------RFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGR 4516
            +SVKVAVRVRPFN RE+SRD+KCII M GSTT I  P   KE PKSF FDYSY S   P D N+ +Q++VY D+GE+ L+HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQLC  LF R++D   DN      + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK RTVAATNMNETSSRSHAVF II +Q+  D +  +T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+KTDFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C A+INEDPN       K       E+ +L ++   +GL  I ++  +++    S+S+ +          + E++     SE+ I  L E          TWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ +     + DI LSG  I   HC+F  +    GE  VTL     A+ YVNGK++ E + L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++Q+   S    +    ++E  +   W+ER+ +LA WAF KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +       T+P                                   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP  ++      VTGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ FDD  +  F  +S  ++  + +G S +     +      D  P           +        D  + +   G  DT L  L+LG TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++F++YIK+  I FE+F H  Q P     P     L   + ++       PL  PVP+ K      P  G    +YDLLV+FEI EL ANG+Y+   VD  H   C G F++HQ +QRR +VT++HE          S + +  VRE+VVGR+R+ PE  +      +LSLN+L + Y+    D+R+ F        +FEAAWDSS+H S LLN +T   E I++T+S Y+++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL    R
Sbjct:    4 ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEKDQQGIIPQLCEDLFSRINDTTNDN------MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIINEDPNN------KLIRELKDEVTRLRDLLYAQGLGDITDMTNALVGMSPSSSLSALSSRAASVSSLHERILFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGVTRVGREDA--ERRQDIVLSGHFIKEEHCIFRSDSRGGGEAVVTLEPCEGADTYVNGKKVTEPSILRSGNRIIMGKSHVFRFNHPEQARQERERTPCAETPAEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEATYLLEQQRLDYESKLEALQKQM--DSRYYPEVNEEEEEPEDEVQWTERECELALWAFRKWKWYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPPEAAKDR---ETRP---------------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSVVEDCDNVVTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFDDQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADAGPSADEVNN-NTCSAVPPEGLMDSPEKAALDGPLDTALDHLRLGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHP---FPPLCKDVLSPLRPSRRHFPRVMPLSKPVPATKLSTMTRPSPGPCHCKYDLLVYFEICELEANGDYIPAVVD--HRGACMGTFLLHQGIQRRITVTLLHE--------TGSHIRWKEVRELVVGRIRNTPETDEALIDPNILSLNILSSGYVHPAQDDRVFFGNDTRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTLSAYIEMENCTQPAVITKDFCMVFYSRDAKLPASRSIRNL--------FGSGSLRATEGNRVTGVYELSLCHVADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKLETTQR 1411          

HSP 2 Score: 123.25 bits (308), Expect = 1.587e-26
Identity = 67/149 (44.97%), Postives = 91/149 (61.07%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
            LV +  EIR+SP++S+KGYL+ LE    A W KR+VVVRRP+ Y+Y  +KD VER ++NL+TAQ++Y+                 +  A    P +      F++   HR  L+Q   D  K++HDWLYAFNPLLAG IRSKL RRR +
Sbjct: 1568 LVPDIQEIRVSPIVSKKGYLHFLEPHT-AGWAKRFVVVRRPYAYMYNSDKDTVERFVLNLSTAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQANSD--KDMHDWLYAFNPLLAGTIRSKLSRRRSA 1691          
BLAST of Kinesin-like protein KIF1A vs. UniProt/SwissProt
Match: sp|Q28WQ1|KIF1A_DROPS (Kinesin-like protein unc-104 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=unc-104 PE=3 SV=1)

HSP 1 Score: 985.712 bits (2547), Expect = 0.000e+0
Identity = 538/964 (55.81%), Postives = 669/964 (69.40%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNI----FKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGE------GLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKT-------VEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMI-------SADDYLSDDENYE----PTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            MSSVKVAVRVRPFN REI R++KCII M G+TT I      P++ E  K F FDYSY S  P DS+F  Q  VY D+GE+ L+H+ +GYNVCI AYGQTGAGKSY+MMG+  +  QEGIIP +C+ LF R+ D + D       +++++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V  +QDI++LID GNK+RTVAATNMNETSSRSHAVFTI  +QR  D   +LT EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++S  K  K   K DFIP+RDS LTWLLRENLGGNSKTAM+ AISPADINY+ETLS+LRYADRAKQIVCKAV+NED N +L+RELKEE+ KLR++LK E IEV E        +GI   S  R                 +  +++L+ASEKLIAELNETWE+KL++TE++R QR++  AE+G+ +K DG   GVFS KK P+LVNLNED  ++ECL+YY+KDG T++G  E   +   DI LSG  I+  HC F      VTL    DA  +VNG+++ E   LK+  R+I GKNHVFRF NP  A+  REK T       VE+     +DWNFA  ELLEKQG+DL+ EM+ RL  LEEQ+K+EK +AD+ FE+Q++ YE +I  L++QV + SM        S +D+  +++ Y      + W+ R+  LAAWAF KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+       E+++S   +  + E                                 +KT + +EV D KNGA HYW L K R+RL+L+RE+Y NEAEM    PD      +ES+TGGDPFYDRFPWF++VGRSF++LSNLLY VPL+H+VA+VNE+G+V+G LR+A+QP+
Sbjct:    1 MSSVKVAVRVRPFNSREIGRESKCIIEMTGATTAITNPKVPPNTSEAVKRFNFDYSYWSHDPRDSDFSTQTMVYKDIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGRQEE-QQEGIIPMICQDLFTRIHDTETDE------LKYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTDYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRHDTMTDLTTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVASKKKHNK---KADFIPYRDSALTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRDLLKAEGIEVQEEDELNKSTTGIKSPSKSRN----------RNGSTTEMAVDQLQASEKLIAELNETWEEKLKRTEEIRLQREAVFAEMGVAVKEDGITVGVFSPKKTPHLVNLNEDPNLSECLLYYIKDGLTRLGTHEA--NVPQDIQLSGSHILKEHCTFENRNSTVTLLPHKDAIIFVNGRQLVEPEVLKTGSRVILGKNHVFRFTNPEQARELREKITENEAENEVEKADAPQVDWNFAQCELLEKQGIDLKAEMKKRLDNLEEQYKREKMQADQQFEEQRKTYEARIDALQKQVEEQSMTMSMYSSYSPEDFHQEEDVYNNPMYESCWTAREAGLAAWAFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPP-----ELASSVAPLQQEDEFG---------------------------APPVSKTLVAVEVTDTKNGATHYWSLEKLRQRLELMREMYHNEAEMSPTSPDY----NVESLTGGDPFYDRFPWFRMVGRSFIYLSNLLYPVPLVHKVAIVNERGDVRGYLRIAVQPV 893          

HSP 2 Score: 331.643 bits (849), Expect = 1.432e-90
Identity = 173/412 (41.99%), Postives = 256/412 (62.14%), Query Frame = 2
Query: 3239 LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLD-LDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMV 4462
            L++G+ F FRVT+LQ +G+ ++Y D FCQ++FL++  + +STEP+KN     P+GFYHVQN  V VT++F++Y+K   I F++F H +    L      +  S    +  L  + P+  PV S K      P   T+L ++D+LVWFEI EL+ NGEYV   V+HS + PC G+F++HQ +QRR  +TIVHEP  +    + + L+         GR+R+ PE  D  D+ + VLSL L P   +   GD+R  +RFEAAWDSSLH S LLN +++  E I++T+S YL++ENC +P  +TKD  +V+  RD++      K++FS +          +  + NR++G+Y+L L+   +  S    RR +R  + +S YVRGEEN+ GWRPR DSLI DHQW+LEKLT+L+ V
Sbjct:  975 LQVGKEFTFRVTVLQATGIGAEYADIFCQFNFLHRHEEAFSTEPVKNSASGAPLGFYHVQNITVPVTKSFIEYLKTQPIMFKIFGHYQTH-PLHKDAKQDFVSRPPPRRMLPPSIPISQPVRSPKFGPLPCPPSSTVLAKHDVLVWFEICELAPNGEYVPSVVEHSDDLPCRGLFLLHQGIQRRIRITIVHEPTPEVKWKDINELVV--------GRIRNTPESSDEQDEDACVLSLGLFPGEVLDVPGDDRSFYRFEAAWDSSLHNSALLNRVSQGGETIYITLSAYLELENCARPAIVTKDLSMVIYGRDARTGPRSLKHLFSGQY---------RNPEANRLSGVYELSLRRASEAGSPGVQRRQRRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEV 1368          

HSP 3 Score: 139.043 bits (349), Expect = 2.402e-31
Identity = 92/247 (37.25%), Postives = 131/247 (53.04%), Query Frame = 2
Query: 4799 REKLLTSRCVELMTV-------SNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRL-----VGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRR 5503
            RE+ L  +C++L+         +N +QT QS +   D   ++M  S +S            SM  N   +   L +     + +G  +      P L     V E +EIR+SPV++RKG LN+LE    + W KRWV VRRP+++IY  EKDPVER ++NLATAQ++ +                 + +A    P +      FS+V  HR +L+QT+ D  KEVHDWLYA NPLLAGQI+S+L RR
Sbjct: 1436 REQDLMLKCLKLVQAGRYAKNEANDTQT-QSDVSPSDEGCADMTVSCIS----------SNSMEDNKFVIRRRLCSPDRADAPNGWEAPAPATQPALPLRLYVPELEEIRVSPVVARKGLLNVLEHGG-SGWKKRWVTVRRPYVFIYRSEKDPVERAVLNLATAQVECSE----------------DQAAMVKIPNT------FSVVTKHRGYLLQTLGD--KEVHDWLYAINPLLAGQIKSRLARR 1646          
BLAST of Kinesin-like protein KIF1A vs. UniProt/SwissProt
Match: sp|Q17BU3|KIF1A_AEDAE (Kinesin-like protein unc-104 OS=Aedes aegypti OX=7159 GN=unc-104 PE=3 SV=1)

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 539/959 (56.20%), Postives = 675/959 (70.39%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP------KSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK---KTVEEFP---CESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMI-------SADDYLSDDENY-EP---TAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            MSSVKVAVRVRPFN REISR++KCII M G+TT I  P  K PP      K F +DYSY S  P D+ F  Q  VY D+GE+ L+H+ +GYNVCI AYGQTGAGKSY+MMGK  +  QEG+IP +C+ LF+R+ +       E   +++++EVSYMEIYCERVRDLLNPKNK NL+VREHPLLGPYVEDLSK  V S+QDI++LID GNK+RTVAATNMNETSSRSHAVFTI  +QR +D+   L  EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE++S    +KK +K DFIP+RDSVLTWLLRENLGGNSKTAM+ AISPADINY+ETLS+LRYADRAKQIVCKAV+NED N +L+RELKEE+ KLRE+LK E IEV EG    P   +    R       +      +  +++L+ASEKLIAELNETWE+KL++TE +R QR++  AE+G+ +K DG   GVFS KK P+LVNLNED  ++ECL+YY+KDG T++G  E   +   DI LSG  I+  HCVF  +   VTL    DA  Y+NG+++ E   L++  R+I GKNHVFRF +P  A+  REK   K V E P    E+ DWNFA  ELLEKQG+DL+ EM+ RL  LEEQFK+EK  AD+ FE+Q++ YE +I  L++QV + SM        S +D+  +++ +  P   + W+ R+  LAAWAF KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+  ++    +    ++   + E  Q                           S   +T + +EV D KNGA H+W L K R+RL+L+RE+Y NEAE+    PD      +ES+TGGDPFYDRFPWF++VGRSFV+LSNLLY VPL+H+VA+VNE+G+V+G LRVA+QP+
Sbjct:    1 MSSVKVAVRVRPFNSREISRESKCIIEMSGNTTCITNP--KVPPGTSDSIKRFNYDYSYWSHDPRDAEFSTQSMVYADIGEEMLQHSFDGYNVCIFAYGQTGAGKSYTMMGKQEE-SQEGVIPMICKDLFRRIQET------EGVDLKYSVEVSYMEIYCERVRDLLNPKNKGNLKVREHPLLGPYVEDLSKLAVTSYQDIHDLIDEGNKARTVAATNMNETSSRSHAVFTIFFTQRRVDKMTSLETEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVAS---KSKKSKKADFIPYRDSVLTWLLRENLGGNSKTAMIAAISPADINYDETLSTLRYADRAKQIVCKAVVNEDANAKLIRELKEEIQKLRELLKAEGIEVQEGNRRTPTPMICSPNR-----LRKRTGSSTEMAVDQLQASEKLIAELNETWEEKLKRTEQIRLQREAVFAEMGVAVKEDGITVGVFSPKKSPHLVNLNEDPTLSECLLYYIKDGLTRLGTSEA--NVPQDIQLSGSHILKEHCVFENKDGVVTLVPHKDALVYLNGRKLVEPEVLQTGSRVILGKNHVFRFTHPEQAREKREKPKDKDVGENPGGNAEAADWNFAQCELLEKQGIDLKAEMQKRLCALEEQFKREKLAADQEFEEQRKTYEARIDALQKQVEEQSMTMSMYSSYSPEDFHQEEDIFVNPLFESCWTAREAGLAAWAFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELKKKVQFQFTLLTDTLYSPLPPELAPSPIIGGALTNGQEDEFGQ---------------------------SPIPRTIVAVEVTDTKNGATHHWSLDKLRQRLELMREMYHNEAELSPTSPD----YNVESLTGGDPFYDRFPWFRMVGRSFVYLSNLLYPVPLVHKVAIVNERGDVRGYLRVAVQPV 896          

HSP 2 Score: 357.451 bits (916), Expect = 7.820e-99
Identity = 188/428 (43.93%), Postives = 274/428 (64.02%), Query Frame = 2
Query: 3239 LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH-QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLD-LDDY-SKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLK---QILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLS 4504
            L+ G+ F FRVT+LQ +G++++Y D FCQ++FL++  + +STEP+KN G   P+GFYHVQN  V VT++F++Y+K   I F++F H Q   ++ +   D ++ +    +  L  + P+  PV S K      P   T+L ++D+LVWFEI EL+ NGEYV   VDHS + PC G++++HQ +QRR  +TIVHEP  +    +   L+         GR+R++PE  D LDD  S VLSL L P   +   GD+R  FRFEAAWDSSLH S LLN +T+  E IF+T+S YL++ENC +P  ITKD  +++  RD++      K++FS +          +  + NR++G+Y+L L+   +  S    RR +R  + +S YVRGEEN+ GWRPR DSLI DHQW+LEKLT+L+ V +VRH+L+LRE+L 
Sbjct:  982 LQPGKEFTFRVTVLQATGIAAEYADIFCQFNFLHRHEEAFSTEPVKNSGSGAPLGFYHVQNITVPVTKSFIEYLKTQPIVFKVFGHYQNHPLHKDAKQDCQI-TRPPPRRMLPPSIPISQPVRSPKFGPLPCPPSSTVLAKHDVLVWFEICELAPNGEYVPAVVDHSDDLPCRGLYLLHQGIQRRIRITIVHEPTAEVKWKDIRELVV--------GRIRNQPEPADELDDSDSCVLSLGLFPGEVLEVPGDDRSFFRFEAAWDSSLHNSALLNRVTQTGEQIFITLSAYLELENCARPAIITKDLSMIIYGRDARTGPRSLKHLFSGQY---------RNPEANRLSGVYELSLRRASEAGSPGVQRRQRRVLDTSSTYVRGEENLHGWRPRGDSLIFDHQWELEKLTRLEEVGRVRHLLMLRERLG 1391          

HSP 3 Score: 129.413 bits (324), Expect = 2.184e-28
Identity = 67/139 (48.20%), Postives = 90/139 (64.75%), Query Frame = 2
Query: 5069 VGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIR 5485
            V E +EIR+SPV++RKGYLN+LE    + W KRWV VRRP+++I+  +KDPVER ++NLATAQ++ +                 + +A    P +      FS+V  HR +L+QT+ D  KEVHDWLYA NPLLAGQIR
Sbjct: 1531 VPELEEIRVSPVVARKGYLNVLEHGG-SGWKKRWVTVRRPYVFIFRSDKDPVERAVLNLATAQVECSE----------------DQAAMVKVPNT------FSVVTKHRGYLLQTLGD--KEVHDWLYAINPLLAGQIR 1644          
BLAST of Kinesin-like protein KIF1A vs. TrEMBL
Match: R7UUT0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_150014 PE=3 SV=1)

HSP 1 Score: 1518.44 bits (3930), Expect = 0.000e+0
Identity = 896/1849 (48.46%), Postives = 1156/1849 (62.52%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEP---PKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPC----ESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISA--------------DDY-------LSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEP---RINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVG------ECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVK 5518
            MSSVKVAVRVRPFN RE S D+KCIISM+G TT I  P          SF FD+SY S     D  F NQ+ VY ++G + LEHA EGYNVCI AYGQTGAGKSY+MMG+  D  Q GIIPQLC  LF R+      +SD    +Q+ +EVSYMEIYCERVRDLLNPK+  NLRVREHPLLGPYVEDLSK  V SF DIN LI+ GNK+RTVAATNMNETSSRSHAVFTII  Q   D+   L GEKVSKISLVDLAGSERADSTGAKG RLKEGANINKSLTTLGKVISALAE+ S   +TKKK+K +FIP+RDSVLTWLLRENLGGNSKTAM+ A+S ADINYEETLS+LRYADRAKQI+CKAV+NEDPN RL+RELK EV +LR++L+LE I++GEGL+GIP+   +   R      S  + ++ +D IE+L+ SEKLI+ELNETWE+K+++T+++RK R++ LA++G+ ++ DGGA GVFS K+ P+LVNLNED LM+ECL+YY+KDG T+VG  E  +S    I L G  I+  HC F    + +T+     A  Y+NGK + E T LK+  R+I GKNHVFRF +P  A+   EKK+          E +DW++A  ELLEKQG+DLRKEM+ RL  LEEQ+ KEKEE++++FEKQ++E+E KI +L++QV + SM+S+              + Y       +S   + E   W+ER+YQLAAW F KW++HQ+TSLR             DDLW N +FLKEANA+S EL KKV FQF LLT+T YSP+  ++               PE + +                         G    KT + +EV D+KNGA HYW L KFR+RL+L+RE+Y NEAE+    P+   N ++ S+TGGDPFYDRFPWF+LVGR+FVFLSNL Y VPL+HRVA+V+EKGEVKG +RVA+Q + + +     +  S         K+  +  +Y+  + + EFD   Y   + L  R   G     D   ++V    +K+  + +  N   AF                    L++GQ F FRVT+LQ S +S +Y D FCQ++FL++ ++ +STEP+KN GK  P+GFYHVQNF V VT++F+DY+K   I FE+F H  Q P   +    PY     Q      S      P+  PVPS K  +  +P    +  +YDLLVWFEI EL+ NGEYV   V+H+ +  C G +M+HQ +QRR ++TIVHE    NG      L++  VRE+VVGR+R+ PE+ + D    VLSLNLLPAHYI   GD+R+ FRFEAAWDSSLH S LLN +T   E I+LT+S YLDVENC +P CITKD  +V+  RD++++ PR            F  SF K+ D N+VTG+YDL LKQ     S    RR +R  + +S YVRGEEN++GWRPR DSLI+DHQW+LEKLT+L+MVEK RH+LLLREKL E  R  E+ +LDKEA                    +   +  +     L+Q +  N  D         K   T    DL                   REK LTSRC++L+     S   + S          +L    S+   S   +  G  + +   M++  ++++      G R         L G      E +EIR+SPV+SRKGYLN LEE K + W+KRWVVVRRP++Y+Y +EKDPVERG+INLATAQ++++   + +              AR T          FS++   R +LIQT+  D KE HDWLYA NPLLAGQIRSKL RR++S++
Sbjct:    1 MSSVKVAVRVRPFNNRENSYDSKCIISMDGKTTTITDPRPGHDFGRVHSFNFDHSYWSHTTAEDPKFANQKLVYDEIGIEMLEHAFEGYNVCIFAYGQTGAGKSYTMMGR-NDPGQSGIIPQLCEDLFNRIGA----SSDPD--VQYKVEVSYMEIYCERVRDLLNPKHNKNLRVREHPLLGPYVEDLSKLAVTSFDDINALIEEGNKTRTVAATNMNETSSRSHAVFTIIFGQAKHDKQTNLVGEKVSKISLVDLAGSERADSTGAKGMRLKEGANINKSLTTLGKVISALAEVVS---ATKKKKKAEFIPYRDSVLTWLLRENLGGNSKTAMVAALSAADINYEETLSTLRYADRAKQIMCKAVVNEDPNARLIRELKAEVERLRDLLRLEGIQIGEGLAGIPDPKDVVRSR----KDSVTLGENGEDAIERLKMSEKLISELNETWEEKMRRTDEIRKDREAVLADMGVALREDGGALGVFSPKRTPHLVNLNEDPLMSECLLYYIKDGITRVGNAECKDSQH--IKLVGQHILENHCTFESNDDKITIIPNDTAIVYINGKEVTEPTVLKTGSRVILGKNHVFRFTHPEQAREIAEKKSTPSAATPSSGEMVDWSYAHVELLEKQGIDLRKEMQQRLKELEEQYAKEKEESERLFEKQRKEFECKITSLQEQVERYSMMSSMTPDDFDEDDEAFGNSYTLFFFFLISVYADAEECNWTEREYQLAAWGFRKWRYHQFTSLR-------------DDLWGNAIFLKEANAISVELRKKVQFQFVLLTDTLYSPLAPEL-------------MPPEGRDD-------------------------GRPFPKTVVAVEVEDLKNGATHYWSLEKFRQRLELMREMYHNEAELSPTSPEPQ-NMEL-SMTGGDPFYDRFPWFRLVGRAFVFLSNLFYPVPLVHRVAIVSEKGEVKGYIRVAVQAVTDDDELPPGIKQSGNA------KIAFNDADYNRKV-KPEFD---YAAHEEL--RIVEGQRSDPDASMLEVQMAAQKAEQDNKLQNEVDAFPEIKTDELPEH---------LQVGQQFTFRVTVLQASSISPEYADIFCQFNFLHRHDEAFSTEPVKNTGKGPPLGFYHVQNFTVTVTKSFIDYVKTQPIVFEVFGHYQQHPLHDQAKEAPYSVRPPQRRNFPPSL-----PISRPVPSPKLGVIKSPSTSHVHAKYDLLVWFEIQELAPNGEYVPTVVEHNEDMACLGTYMLHQGIQRRLAITIVHE----NG----PDLIWRDVRELVVGRIRNTPEWTEPDGEHTVLSLNLLPAHYIQQPGDDRVFFRFEAAWDSSLHNSPLLNRVTPYGEKIYLTLSAYLDVENCAQPACITKDLGMVLYARDTRITAPR-------SLRSLFGQSFYKSHDTNKVTGVYDLTLKQRADSGSPGVQRRQRRVLDTSSTYVRGEENLQGWRPRGDSLIIDHQWELEKLTRLEMVEKARHVLLLREKLQEQHRTRELSKLDKEA------------------SNLFRRQAGSLAQDELSQKERDNRDDK--------KLEKTESASDLSVD----------------REKELTSRCLKLLMQGRLSGPMKRSP------TGPLLSVPCSIPRSSSAPDVRGQFLHS---MSSDNLSQAANDLPGGGRRIPLPRKTSLEGEGQYVVETEEIRVSPVVSRKGYLNFLEE-KTSGWIKRWVVVRRPYVYLYNNEKDPVERGLINLATAQVEFSEESQAMI------------RARNT----------FSVMTKQRGFLIQTL--DDKEFHDWLYAINPLLAGQIRSKLSRRKQSLR 1663          
BLAST of Kinesin-like protein KIF1A vs. TrEMBL
Match: A0A0L8FXM5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005183mg PE=3 SV=1)

HSP 1 Score: 1514.98 bits (3921), Expect = 0.000e+0
Identity = 897/1891 (47.44%), Postives = 1181/1891 (62.45%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIF--KPSSKEPP-KSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSS--MDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGE--GLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESL-------DWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISA---DDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRK------------STAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFS-------HQEPRINL----EPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRAN---HRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGD--EDILNEEGGREKLLTSRCVELM------------TVSNKSQTYQSSMGKEDMFKSEMLD------SSVSMINDSHLFNDEGSMMTNS------RPMTTSLMTES---------IMSSEDGCRSAWKNNSPR-----LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVK 5518
            MSSVKVAVRVRPFN REI+RD+ CII M G+TT I   KP  K+   KSF FDYSY S   P+D  F +Q +VY D+G + L+HA EGYNVCI AYGQTGAGKSY+MMGK  D  Q GIIP LC+ LF R+ D K      TA   +++EVSYMEIYCERVRDLLNP NKNNLRVREHPLLGPYVEDLSK  V+SF+DI +LID GNK+RTVAATNMNETSSRSHAVFTII +Q+ LD+  ++ GEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALA++S+  +  S+KKK+KTDFIP+RDSVLTWLLRENLGGNSKTAM+ A+SPADIN++ETLS+LRYADRAKQIVCKAV+NEDPN +++RELKEEV +LRE+L  E IE+ E    +G  EI   R+         + +  D  D +E+L+ SEKL+AELNE+WE+KL+KTE +RK R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG P        DI L+G  I   HC+F+     VT+     +  YVNG++I E T LK   R+I GKNHVFRFN+P+ A+ SR   T      ESL       DW FA  ELLE QG+DLRK+ME RL+ LEEQ++KEKEEAD +FE+Q+++YE +I  L++QV + SM+S+   DD+  ++++     W++ + Q+A WAF KWK+HQ+TSLR             DDLW N +FLKE+NA+S ELNKKV FQF LLT+T YSP+++++   +   SN                                          KT + +EV+D+KNGA H+W L K R+RL+L+RE+Y NEAE+    P+      I+++TGGDPFYDRFPWF+LVGRSFV+LSNL Y VPL+HRVA+VNEKG+VKG L VA+Q +   E                   +D       S   ++ FDDD YF +K L    S  L+    N    V+  P++             + E  ++   +              +       LK+G  F FRVT+L+ SG+S +Y D FCQ++FL++ ++ +STEPLKN GK  P+ FYHVQNF V VT++F+DYIK+  + FE+F        H++ + NL     P      +  +R+      + P+  PVPS K  +   P    +  +YDLLVWFEI EL+ NGEYV   VDHS + PC G +++HQ +QRR ++TIVHE   D        L++  ++E+VVGR+R+  +Y D+D  + VLSL+L PAHY+    D+RI FRFEAAWDSSLH S LLN +T   E +F+T+S YL+V+NC +P  ITKD CL++  RD +L+ PR  +N+FS    R         +D NR+ G+Y+L L++  +  +    RR +R  + +S YVRGEEN+ GWRPR DSLIL+HQW+LEKLT+L+MVEK RHILLLR+KL E  +  E+ +LDK+A                         Y  +KS    + +         + G +DKD  T G D  +  S   PG    D +   G   K LT++C+ L+             V+  +++  SS   ED      +D      +S S++N S   +++   M +S      RP +T   T+S           +SE       K N P       + + +E+R+SP++SRKGYLN LEE K   W KRWVVVRRP++YIY +EKDPVERG+INLATAQI+Y+             ++      R T          FS++  HR + +QT+  D K+ HDWLYA NPLLAG+IRSKL RR++SVK
Sbjct:    1 MSSVKVAVRVRPFNSREIARDSTCIIDMCGTTTTIQNPKPGPKDQMYKSFNFDYSYWSHTDPSDPEFSSQTKVYEDIGLEMLDHAFEGYNVCIFAYGQTGAGKSYTMMGKNED-SQRGIIPLLCQDLFDRIKDNK------TAEQMYSVEVSYMEIYCERVRDLLNPSNKNNLRVREHPLLGPYVEDLSKLAVQSFEDIGKLIDEGNKARTVAATNMNETSSRSHAVFTIIFTQKKLDQATKMVGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALADVSAEGIKVSSKKKKKTDFIPYRDSVLTWLLRENLGGNSKTAMVAALSPADINFDETLSTLRYADRAKQIVCKAVVNEDPNAKVIRELKEEVARLRELLVHEGIEINECNTPTGQKEIKRTRK---------ESMSTDGDDPVERLQLSEKLMAELNESWEEKLRKTEAIRKDREAVLAEMGVALREDGGTIGVFSPKKTPHLVNLNEDPLMSECLIYYIKDGITRVGLPN--TKQPPDIQLNGTHIKEDHCMFDNNEGTVTVIPSNGSIIYVNGRQITEPTILKVGARVILGKNHVFRFNHPVQARESRALMTESITDLESLSQNQEPVDWTFAQLELLENQGIDLRKDMEQRLLALEEQYRKEKEEADMLFEQQRKDYEFQIHALQEQVERHSMMSSFTTDDFNEEEDHQMECTWTDHERQIAVWAFRKWKYHQFTSLR-------------DDLWGNAIFLKESNAISVELNKKVQFQFVLLTDTNYSPLSSELLPQDERDSNRPFP--------------------------------------KTIVAVEVQDLKNGATHFWSLEKLRQRLELMREMYHNEAELSPTSPE----PSIDNMTGGDPFYDRFPWFRLVGRSFVYLSNLFYPVPLVHRVAIVNEKGDVKGYLCVAVQAVTEKE-----------------DTVDYAPGIKQSGNAKISFDDDNYFEKKQLY---SPKLAQDCSNLKKAVELPPQEEERIVEGEGTSPDSNEMLEEGKVNVDNTRESADYFPDIADKELPEHLKIGSVFQFRVTVLKASGISPEYADIFCQFNFLHRHDEAFSTEPLKNSGKELPLSFYHVQNFTVTVTKSFIDYIKSQHLVFEVFGHYQQHPLHEQAKENLLCSGSPLYSNIRRPPRRS---FPMSLPVSKPVPSPKFGVITPPSTSPVHAKYDLLVWFEICELAPNGEYVPTVVDHSDDLPCAGTYLLHQGIQRRITITIVHEKGPD--------LIWRDIKELVVGRIRNTLDYRDVDSENTVLSLSLFPAHYVQQPNDDRIFFRFEAAWDSSLHNSPLLNRVTPYGEKVFMTLSAYLEVDNCAQPAYITKDLCLLIHARDGKLTAPRSLRNLFSGGYSR---------KDTNRLGGVYELFLRRCNNSGSPGVQRRQRRVLDTSSTYVRGEENLNGWRPRGDSLILEHQWELEKLTRLEMVEKARHILLLRKKLGEQNKTQELSKLDKDAS----------------------NMYAKAKSQRAKEEE---------LKGDDDKDLSTDGTDKKLKFS--NPGGPIPDFVT-NGDANKELTAKCLRLLLQGRLPLSSQNKPVTALNESMVSSNSDEDETAPMSMDNVMQASTSSSVLNTSLNNSNQNCSMDSSVTSDILRPTSTETKTQSKSCESLSSMAENSERKFSLPLKTNKPETDQQLFIPDIEEVRVSPIVSRKGYLNFLEE-KTNGWTKRWVVVRRPYVYIYNNEKDPVERGLINLATAQIEYS------------EDQQAMLKTRNT----------FSVMTKHRGFFLQTL--DDKDFHDWLYAINPLLAGRIRSKLSRRKQSVK 1719          
BLAST of Kinesin-like protein KIF1A vs. TrEMBL
Match: A0A0L8FYA3 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005183mg PE=3 SV=1)

HSP 1 Score: 1512.28 bits (3914), Expect = 0.000e+0
Identity = 899/1907 (47.14%), Postives = 1184/1907 (62.09%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIF--KPSSKEPP-KSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSS--MDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGE--GLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESL-------DWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISA---DDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRK------------STAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFS-------HQEPRINL----EPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRAN---HRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGD--EDILNEEGGREKLLTSRCVEL---------------------MTVSNKSQTYQSSMGKEDMFK----SEMLDSSVSMIN-----DSHLFND--------EGSMMTNSRPMTTSLMT-------ESIMS----SEDGCRSAWKNNSPR-----LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVK 5518
            MSSVKVAVRVRPFN REI+RD+ CII M G+TT I   KP  K+   KSF FDYSY S   P+D  F +Q +VY D+G + L+HA EGYNVCI AYGQTGAGKSY+MMGK  D  Q GIIP LC+ LF R+ D      ++TA   +++EVSYMEIYCERVRDLLNP NKNNLRVREHPLLGPYVEDLSK  V+SF+DI +LID GNK+RTVAATNMNETSSRSHAVFTII +Q+ LD+  ++ GEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALA++S+  +  S+KKK+KTDFIP+RDSVLTWLLRENLGGNSKTAM+ A+SPADIN++ETLS+LRYADRAKQIVCKAV+NEDPN +++RELKEEV +LRE+L  E IE+ E    +G  EI   R+         + +  D  D +E+L+ SEKL+AELNE+WE+KL+KTE +RK R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG P        DI L+G  I   HC+F+     VT+     +  YVNG++I E T LK   R+I GKNHVFRFN+P+ A+ SR   T      ESL       DW FA  ELLE QG+DLRK+ME RL+ LEEQ++KEKEEAD +FE+Q+++YE +I  L++QV + SM+S+   DD+  ++++     W++ + Q+A WAF KWK+HQ+TSLR             DDLW N +FLKE+NA+S ELNKKV FQF LLT+T YSP+++++   +   SN                                          KT + +EV+D+KNGA H+W L K R+RL+L+RE+Y NEAE+    P+      I+++TGGDPFYDRFPWF+LVGRSFV+LSNL Y VPL+HRVA+VNEKG+VKG L VA+Q +   E                   +D       S   ++ FDDD YF +K L    S  L+    N    V+  P++             + E  ++   +              +       LK+G  F FRVT+L+ SG+S +Y D FCQ++FL++ ++ +STEPLKN GK  P+ FYHVQNF V VT++F+DYIK+  + FE+F        H++ + NL     P      +  +R+      + P+  PVPS K  +   P    +  +YDLLVWFEI EL+ NGEYV   VDHS + PC G +++HQ +QRR ++TIVHE   D        L++  ++E+VVGR+R+  +Y D+D  + VLSL+L PAHY+    D+RI FRFEAAWDSSLH S LLN +T   E +F+T+S YL+V+NC +P  ITKD CL++  RD +L+ PR  +N+FS    R         +D NR+ G+Y+L L++  +  +    RR +R  + +S YVRGEEN+ GWRPR DSLIL+HQW+LEKLT+L+MVEK RHILLLR+KL E  +  E+ +LDK+A                         Y  +KS    + +         + G +DKD  T G D  +  S   PG    D +   G   K LT++C+ L                     M  SN  +   + M  +++ +    S +L++S++  N     DS + +D        EG    N+    TS  T       ES+ S    SE       K N P       + + +E+R+SP++SRKGYLN LEE K   W KRWVVVRRP++YIY +EKDPVERG+INLATAQI+Y+             ++      R T          FS++  HR + +QT+  D K+ HDWLYA NPLLAG+IRSKL RR++SVK
Sbjct:    1 MSSVKVAVRVRPFNSREIARDSTCIIDMCGTTTTIQNPKPGPKDQMYKSFNFDYSYWSHTDPSDPEFSSQTKVYEDIGLEMLDHAFEGYNVCIFAYGQTGAGKSYTMMGKNED-SQRGIIPLLCQDLFDRIKD------NKTAEQMYSVEVSYMEIYCERVRDLLNPSNKNNLRVREHPLLGPYVEDLSKLAVQSFEDIGKLIDEGNKARTVAATNMNETSSRSHAVFTIIFTQKKLDQATKMVGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALADVSAEGIKVSSKKKKKTDFIPYRDSVLTWLLRENLGGNSKTAMVAALSPADINFDETLSTLRYADRAKQIVCKAVVNEDPNAKVIRELKEEVARLRELLVHEGIEINECNTPTGQKEIKRTRK---------ESMSTDGDDPVERLQLSEKLMAELNESWEEKLRKTEAIRKDREAVLAEMGVALREDGGTIGVFSPKKTPHLVNLNEDPLMSECLIYYIKDGITRVGLPN--TKQPPDIQLNGTHIKEDHCMFDNNEGTVTVIPSNGSIIYVNGRQITEPTILKVGARVILGKNHVFRFNHPVQARESRALMTESITDLESLSQNQEPVDWTFAQLELLENQGIDLRKDMEQRLLALEEQYRKEKEEADMLFEQQRKDYEFQIHALQEQVERHSMMSSFTTDDFNEEEDHQMECTWTDHERQIAVWAFRKWKYHQFTSLR-------------DDLWGNAIFLKESNAISVELNKKVQFQFVLLTDTNYSPLSSELLPQDERDSNRPFP--------------------------------------KTIVAVEVQDLKNGATHFWSLEKLRQRLELMREMYHNEAELSPTSPE----PSIDNMTGGDPFYDRFPWFRLVGRSFVYLSNLFYPVPLVHRVAIVNEKGDVKGYLCVAVQAVTEKE-----------------DTVDYAPGIKQSGNAKISFDDDNYFEKKQLY---SPKLAQDCSNLKKAVELPPQEEERIVEGEGTSPDSNEMLEEGKVNVDNTRESADYFPDIADKELPEHLKIGSVFQFRVTVLKASGISPEYADIFCQFNFLHRHDEAFSTEPLKNSGKELPLSFYHVQNFTVTVTKSFIDYIKSQHLVFEVFGHYQQHPLHEQAKENLLCSGSPLYSNIRRPPRRS---FPMSLPVSKPVPSPKFGVITPPSTSPVHAKYDLLVWFEICELAPNGEYVPTVVDHSDDLPCAGTYLLHQGIQRRITITIVHEKGPD--------LIWRDIKELVVGRIRNTLDYRDVDSENTVLSLSLFPAHYVQQPNDDRIFFRFEAAWDSSLHNSPLLNRVTPYGEKVFMTLSAYLEVDNCAQPAYITKDLCLLIHARDGKLTAPRSLRNLFSGGYSR---------KDTNRLGGVYELFLRRCNNSGSPGVQRRQRRVLDTSSTYVRGEENLNGWRPRGDSLILEHQWELEKLTRLEMVEKARHILLLRKKLGEQNKTQELSKLDKDAS----------------------NMYAKAKSQRAKEEE---------LKGDDDKDLSTDGTDKKLKFS--NPGGPIPDFVT-NGDANKELTAKCLRLLLQGRLPLSSQNKPVTALNESMVSSNSDEDETAPMSMDNVMQASTSSSVLNTSLNNSNQNCSMDSSVTSDILSVSMHSEGQQAANAHKWPTSTETKTQSKSCESLSSMAENSERKFSLPLKTNKPETDQQLFIPDIEEVRVSPIVSRKGYLNFLEE-KTNGWTKRWVVVRRPYVYIYNNEKDPVERGLINLATAQIEYS------------EDQQAMLKTRNT----------FSVMTKHRGFFLQTL--DDKDFHDWLYAINPLLAGRIRSKLSRRKQSVK 1735          
BLAST of Kinesin-like protein KIF1A vs. TrEMBL
Match: A0A0L8FX89 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22005183mg PE=3 SV=1)

HSP 1 Score: 1511.12 bits (3911), Expect = 0.000e+0
Identity = 894/1886 (47.40%), Postives = 1179/1886 (62.51%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIF--KPSSKEPP-KSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSS--MDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGE--GLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESL-------DWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISA---DDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYF--LQKSLLTRNSTGLSDKTDNDSVDVDRT-----PRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFS-------HQEPRINL----EPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRAN---HRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGD--EDILNEEGGREKLLTSRCVELM------------TVSNKSQTYQSSMGKEDMFKSEMLD------SSVSMINDSHLFNDEGSMMTNS------RPMTTSLMTES---------IMSSEDGCRSAWKNNSPR-----LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVK 5518
            MSSVKVAVRVRPFN REI+RD+ CII M G+TT I   KP  K+   KSF FDYSY S   P+D  F +Q +VY D+G + L+HA EGYNVCI AYGQTGAGKSY+MMGK  D  Q GIIP LC+ LF R+ D K      TA   +++EVSYMEIYCERVRDLLNP NKNNLRVREHPLLGPYVEDLSK  V+SF+DI +LID GNK+RTVAATNMNETSSRSHAVFTII +Q+ LD+  ++ GEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALA++S+  +  S+KKK+KTDFIP+RDSVLTWLLRENLGGNSKTAM+ A+SPADIN++ETLS+LRYADRAKQIVCKAV+NEDPN +++RELKEEV +LRE+L  E IE+ E    +G  EI   R+         + +  D  D +E+L+ SEKL+AELNE+WE+KL+KTE +RK R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG P        DI L+G  I   HC+F+     VT+     +  YVNG++I E T LK   R+I GKNHVFRFN+P+ A+ SR   T      ESL       DW FA  ELLE QG+DLRK+ME RL+ LEEQ++KEKEEAD +FE+Q+++YE +I  L++QV + SM+S+   DD+  ++++     W++ + Q+A WAF KWK+HQ+TSLR             DDLW N +FLKE+NA+S ELNKKV FQF LLT+T YSP+++++   +   SN                                          KT + +EV+D+KNGA H+W L K R+RL+L+RE+Y NEAE+    P+      I+++TGGDPFYDRFPWF+LVGRSFV+LSNL Y VPL+HRVA+VNEKG+VKG L VA+Q +   E                   +D       S   ++ FDDD YF  L    L ++ + L    +    + +R          + E  ++   +              +       LK+G  F FRVT+L+ SG+S +Y D FCQ++FL++ ++ +STEPLKN GK  P+ FYHVQNF V VT++F+DYIK+  + FE+F        H++ + NL     P      +  +R+      + P+  PVPS K  +   P    +  +YDLLVWFEI EL+ NGEYV   VDHS + PC G +++HQ +QRR ++TIVHE   D        L++  ++E+VVGR+R+  +Y D+D  + VLSL+L PAHY+    D+RI FRFEAAWDSSLH S LLN +T   E +F+T+S YL+V+NC +P  ITKD CL++  RD +L+ PR  +N+FS    R         +D NR+ G+Y+L L++  +  +    RR +R  + +S YVRGEEN+ GWRPR DSLIL+HQW+LEKLT+L+MVEK RHILLLR+KL E  +  E+ +LDK+A                         Y  +KS    + +         + G +DKD  T G D  +  S   PG    D +   G   K LT++C+ L+             V+  +++  SS   ED      +D      +S S++N S   +++   M +S      RP +T   T+S           +SE       K N P       + + +E+R+SP++SRKGYLN LEE K   W KRWVVVRRP++YIY +EKDPVERG+INLATAQI+Y+             ++      R T          FS++  HR + +QT+  D K+ HDWLYA NPLLAG+IRSKL RR++SVK
Sbjct:    1 MSSVKVAVRVRPFNSREIARDSTCIIDMCGTTTTIQNPKPGPKDQMYKSFNFDYSYWSHTDPSDPEFSSQTKVYEDIGLEMLDHAFEGYNVCIFAYGQTGAGKSYTMMGKNED-SQRGIIPLLCQDLFDRIKDNK------TAEQMYSVEVSYMEIYCERVRDLLNPSNKNNLRVREHPLLGPYVEDLSKLAVQSFEDIGKLIDEGNKARTVAATNMNETSSRSHAVFTIIFTQKKLDQATKMVGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALADVSAEGIKVSSKKKKKTDFIPYRDSVLTWLLRENLGGNSKTAMVAALSPADINFDETLSTLRYADRAKQIVCKAVVNEDPNAKVIRELKEEVARLRELLVHEGIEINECNTPTGQKEIKRTRK---------ESMSTDGDDPVERLQLSEKLMAELNESWEEKLRKTEAIRKDREAVLAEMGVALREDGGTIGVFSPKKTPHLVNLNEDPLMSECLIYYIKDGITRVGLPN--TKQPPDIQLNGTHIKEDHCMFDNNEGTVTVIPSNGSIIYVNGRQITEPTILKVGARVILGKNHVFRFNHPVQARESRALMTESITDLESLSQNQEPVDWTFAQLELLENQGIDLRKDMEQRLLALEEQYRKEKEEADMLFEQQRKDYEFQIHALQEQVERHSMMSSFTTDDFNEEEDHQMECTWTDHERQIAVWAFRKWKYHQFTSLR-------------DDLWGNAIFLKESNAISVELNKKVQFQFVLLTDTNYSPLSSELLPQDERDSNRPFP--------------------------------------KTIVAVEVQDLKNGATHFWSLEKLRQRLELMREMYHNEAELSPTSPE----PSIDNMTGGDPFYDRFPWFRLVGRSFVYLSNLFYPVPLVHRVAIVNEKGDVKGYLCVAVQAVTEKE-----------------DTVDYAPGIKQSGNAKISFDDDNYFEKLYSPKLAQDCSNLKKAVELPPQEEERIVEGEGTSPDSNEMLEEGKVNVDNTRESADYFPDIADKELPEHLKIGSVFQFRVTVLKASGISPEYADIFCQFNFLHRHDEAFSTEPLKNSGKELPLSFYHVQNFTVTVTKSFIDYIKSQHLVFEVFGHYQQHPLHEQAKENLLCSGSPLYSNIRRPPRRS---FPMSLPVSKPVPSPKFGVITPPSTSPVHAKYDLLVWFEICELAPNGEYVPTVVDHSDDLPCAGTYLLHQGIQRRITITIVHEKGPD--------LIWRDIKELVVGRIRNTLDYRDVDSENTVLSLSLFPAHYVQQPNDDRIFFRFEAAWDSSLHNSPLLNRVTPYGEKVFMTLSAYLEVDNCAQPAYITKDLCLLIHARDGKLTAPRSLRNLFSGGYSR---------KDTNRLGGVYELFLRRCNNSGSPGVQRRQRRVLDTSSTYVRGEENLNGWRPRGDSLILEHQWELEKLTRLEMVEKARHILLLRKKLGEQNKTQELSKLDKDAS----------------------NMYAKAKSQRAKEEE---------LKGDDDKDLSTDGTDKKLKFS--NPGGPIPDFVT-NGDANKELTAKCLRLLLQGRLPLSSQNKPVTALNESMVSSNSDEDETAPMSMDNVMQASTSSSVLNTSLNNSNQNCSMDSSVTSDILRPTSTETKTQSKSCESLSSMAENSERKFSLPLKTNKPETDQQLFIPDIEEVRVSPIVSRKGYLNFLEE-KTNGWTKRWVVVRRPYVYIYNNEKDPVERGLINLATAQIEYS------------EDQQAMLKTRNT----------FSVMTKHRGFFLQTL--DDKDFHDWLYAINPLLAGRIRSKLSRRKQSVK 1717          
BLAST of Kinesin-like protein KIF1A vs. TrEMBL
Match: B6RJZ4 (Kinesin-3 OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 1509.2 bits (3906), Expect = 0.000e+0
Identity = 897/1897 (47.29%), Postives = 1181/1897 (62.26%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPK-----SFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSS---MDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISR--------EKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYE-----PTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQK----SLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEP----------RINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYN--------------NPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRAN---HRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATS--LIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTES--------------IMSSEDGCR--SAWKNNSPR-----------------LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVK 5518
            MSSVKVAVRVRPFN REISRD+ CII M G+TT I  P  K  PK     SF FDYSY S   P DS F +Q +VY D+G + L+HA EGYNVCI AYGQTGAGKSY+MMGK  +  Q GIIP LC+ LF R+ D K   S+E  +   ++EVSYMEIYCERVRDLLNP NKNNLRVREHPLLGPYVEDLSK  V+S++DI +LID GNK+RTVAATNMNETSSRSHAVFTII +Q+  D   ++TGE+VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+S+     KS+KKK+KTDFIP+RDSVLTWLLRENLGGNSKTAM+ A+SPADIN++ETLS+LRYADRAKQIVCKAV+NEDPN RL+RELKEEV +LRE+L  E IE+ +  +   +  + R  + +               + +L+ SEKL+AELNE+WE+KL+KTE +RK R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG P        DI LSG  I   HC+F      VT+     A  YVNG+++ E+T LK   R+I GKNHVFRFN+P+ A+ SR        + +T+ +   E +DW FA  ELLEKQG+DLRK+ME RL+ LEEQ++KEKEEAD +FE+Q+++YE +I  L++QV + SM+S+    ++D NYE        WS+ + QLA WAF KWK+HQ+TSLR             DDLW N +FLKE+NA+S EL+KKV FQF LLT+T YSP+++++ + E   +N                                          KT + +EV+D+KNGA HYW L K R RL+L+RE+Y NEAE+    P+      I+++TGGDPFYDRFPWF+LVGRSFV LSNLLY VPL+HRVA+VNEKG+VKG LRVA+Q +   + +    P      +    ++  D +NY   L   ++  D   L+K     +L        + T+ D+            E+RK + +  +   +   D            LK+G  F FRV +LQ SG+S +Y D FCQ++FL++ ++ +STEPLKN G+  P+GFYHVQNF V VT++F+DYIKN  + FE+F H  Q P          R    P+        +R+      + P+  PVPS K  +                +P    +  +YDLLVWFEI EL+ NGEYV   VDHS + PC G +++HQ +QRR ++TIVHE   D        L++  ++E+VVGR+R+  +Y D+D  + VLSL+L PAHY+    D+RI FRFEAAWDSSLH S LLN +T   E IF+T+S YL+VENC +P CITKD CLVV  RD +L+ PR  +N+FS    R         +D +R++G+Y+L L++  +  +    RR +R  + +S YVRGEEN+ GWRPR DSLI++HQW+LEKLT+L+MVEK RHILLLREKL E  +  E+ +LDK+A     K    +            +  T+     L          +G V G+ D  +      +L A    LI+ G   + ++      L  S    L ++S++ +T  ++ G +++ ++    S ++    S++ N   +  T S   + S+ TE+              I +    C   SA   NS R                  V + +E+R+SPV+SRKGYLN LEE K   WVKRWVVVRRP++YIY +E+DPVERG+INLATAQI+Y+             ++      R T          FS++  HR + +QT+  D K+ HDWLYA NPLLAGQIRSKL RR++SVK
Sbjct:    1 MSSVKVAVRVRPFNSREISRDSTCIIDMTGNTTTIQNP--KPGPKDYQYKSFNFDYSYWSHTDPNDSKFASQTKVYEDIGLEMLDHAFEGYNVCIFAYGQTGAGKSYTMMGK-NEESQRGIIPLLCQDLFDRIKDNK---SEEQLY---SVEVSYMEIYCERVRDLLNPSNKNNLRVREHPLLGPYVEDLSKLAVQSYEDIGKLIDEGNKARTVAATNMNETSSRSHAVFTIIFTQKKYDSSTKMTGERVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVSADAMGKKSSKKKKKTDFIPYRDSVLTWLLRENLGGNSKTAMIAALSPADINFDETLSTLRYADRAKQIVCKAVVNEDPNARLIRELKEEVARLRELLVNEGIEISDANTPANQKEIKRARKESMSADGDDP-------VGRLQMSEKLMAELNESWEEKLRKTEAIRKDREAVLAEMGVALREDGGTIGVFSPKKTPHLVNLNEDPLMSECLIYYIKDGTTRVGLPNA--KQPPDIQLSGTHIKEEHCMFENIDGTVTVIPCNGAMIYVNGRQVTEATVLKVGSRVILGKNHVFRFNHPVQARESRALMTESIPDIETLAQQNQEPVDWTFAQLELLEKQGIDLRKDMEQRLLALEEQYRKEKEEADLLFEQQRKDYEFQIHALQEQVERHSMMSS--CTTEDLNYEEDTEMECTWSDHERQLAGWAFQKWKYHQFTSLR-------------DDLWGNAIFLKESNAISVELHKKVQFQFVLLTDTSYSPLSSELLSQEDRDTNRPFP--------------------------------------KTIVAVEVQDLKNGATHYWSLEKLRRRLELMREMYHNEAELSPTSPE----PSIDNMTGGDPFYDRFPWFRLVGRSFVCLSNLLYPVPLVHRVAIVNEKGDVKGYLRVAVQAVTEKDDAVDYAPGIKQSGNA---RISFDDENYFRKLCTPKYSQDASILKKVGEVPILEEERVIEGEGTNPDA--------NGMLEERKCSVDKTWEGQDHFPDIVEKDLPDH---LKVGSVFQFRVAVLQASGISPEYADIFCQFNFLHRHDEAFSTEPLKNTGRGPPLGFYHVQNFTVTVTKSFIDYIKNQHLVFEVFGHYQQHPLHDQAKEVPFRFAPSPFYSNLRPPPRRS---FPMSLPVSKPVPSPKFGVITPPSGPLAVPSDWTLHPSSSPVHAKYDLLVWFEICELAPNGEYVPTVVDHSDDLPCAGTYLLHQGIQRRIAITIVHEKGPD--------LIWRDIKELVVGRIRNTLDYRDVDTENTVLSLSLFPAHYVQQPNDDRIFFRFEAAWDSSLHNSPLLNRVTPYGEKIFMTLSAYLEVENCAQPACITKDLCLVVHARDGKLTAPRSLRNLFSGGYAR---------KDTDRLSGVYELFLRRCNNSGSPGVQRRQRRVLDTSSTYVRGEENLNGWRPRGDSLIIEHQWELEKLTRLEMVEKARHILLLREKLGEQNKTQELSKLDKDASNMYAKAKSQRAKEEELKEDEEKDLLTDGADKKLKS------SSAGAVPGALDFQTNNDPSKELTAKCLRLILQGRLPLSSQNKPNPVLSES---TLSSISDEDET--ATTGGDNVMRASTSSSGLNTTVHSNIMNSSMNSSTTSDIFSASVPTEAQQAGHSDKWPISPDIKTQSKSCEGISAMAENSERKFSLPLKPIKPDGDRQVYVPDIEEVRVSPVVSRKGYLNFLEE-KTNGWVKRWVVVRRPYVYIYNNERDPVERGLINLATAQIEYS------------EDQQAMLKTRNT----------FSVMTKHRGFFLQTL--DDKDFHDWLYAINPLLAGQIRSKLSRRKQSVK 1752          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Cavefish
Match: kif1aa (kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GENE-100913-3])

HSP 1 Score: 1385.55 bits (3585), Expect = 0.000e+0
Identity = 847/1876 (45.15%), Postives = 1130/1876 (60.23%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTD-FIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVI-------------------RECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNC----EGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKSL---LTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGL--LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVV-CGSND-KDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVS-NKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFND--------------EGSMMTN---------SRPMTTSLMTESIMSSEDGCRSAWKNNSPR-------LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRR 5506
            +SVKVAVRVRPFN RE+S+++KCII M G+TT I  P   +  KSF FDYSY S   P D N+ +QQ VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMG+  + DQ+GIIP LC  LF +++D   DNS     + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +QR  D + + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K + FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELK+EV +L+      ++   +GL  I E   +                   R    +S+    +    +++ IE+L+ +EK+IAELNETWE+KL++TE +R +R + LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+ + +   + DI LSG  I   HC F       GE V L     AE YVNGK++ E T L+S +R+I GK+HVFRFN+P  A+ +R++    E P E +DW FA  ELLEKQG+D+++EM+ RL  LE+Q+++E+EEA+ + E+Q+ +YE +++ L++QV +    +A++    +E  +   W+ER+ +LA WAF KW+ +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D+   E +                D  K                     S   +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    +P   I      +TGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ F+D  +  F  +S    LTR  TG S +     + +  + +  P   +A++  +N  +A   + +    SG  G  D  L  LK+G+ F FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++FV+YIK   I FE+F H  ++P   L   L + L+  +R    +    PL  PVP+ K      P  G    +YDL+V+FEI EL A GEYV   VDH    PCHG F++HQ +QRR +VT+VHE   D    E   L+         GR+R+ PE  +      +LSLN+  + YI    D+R  +RFEAAWDSS+H S LLN +T   E I++T+S YL++ENC +P  ITKDFC+V   RD++LS  R  +N+FS  S         +  + NRVTG+Y+L L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLL                     RE+++                                T+  G   ++ CGS D  +S +       +     P   D  NE   R++ L ++C+ L+T S N+  ++      E    S++ + SV+++ DS   +               EG   +N         SR ++ S   +S  S+ +G      +  P         V +  EIR+SP++S+KGYL+ LE      WVKR+VVVRRP++YIY  E+D VER I+NL++AQ++Y+   + + +                      +   F++   HR  L+Q   D  KE+HDWLYAFNPLLAG IRSKL RRR
Sbjct:    4 ASVKVAVRVRPFNSREMSKESKCIIQMSGNTTTILNPKVPKETKSFNFDYSYWSHTSPEDINYASQQLVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGR-QEKDQQGIIPLLCEDLFTKINDSNNDNS-----MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQRRHDSETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSGANKNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKDEVSRLK------DLLYAQGLGDIIESKAVLTNAMTGMSPSPSLSALSSRAGSISSLHDRIMFSPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMERSALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGREDAMR--RQDIVLSGHFIKDEHCTFTSTTGPNGEAVILEPCEGAETYVNGKKVTEPTVLRSGNRIILGKSHVFRFNHPEQARQARDRTPCAETPVEPVDWAFAQRELLEKQGIDMKQEMDQRLQELEDQYRREREEANNLLEQQRLDYESRLEALQKQVDRYYPEAAEEEDEPEEEVQ---WTERETELALWAFRKWRCYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDLLPAEAAK---------------DREK---------------------SPFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----IPSTAIEDCDSVLTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFEDQQFEKFQAESCPNGLTR--TGPSQEELRIVEGEGQNAEMIP---SADEVNNNTCAANPDDLESPVKSGLDGVLDGALEHLKIGEVFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFVEYIKTQPIVFEVFGHYQKQPFPPLCKDLISPLRPCRRQFPRV---MPLSKPVPATKLTTLTRPTAGPCHCKYDLMVFFEICELEATGEYVPAAVDHRGGMPCHGTFLLHQGIQRRVTVTMVHETGGDIEWKEVRELVV--------GRIRNTPEADETIIDPNILSLNIHSSGYIRPTPDDRTFYRFEAAWDSSMHNSLLLNRVTPYGEKIYMTLSAYLEMENCTQPAVITKDFCMVFYSRDAKLSASRSIRNLFSSGS--------LRPSEGNRVTGVYELSLSHLADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLL---------------------REKLE-------------------------------STLLLGQEPLLSCGSEDPAESSSPSTHPAPSHCPEDPPRPDTTNE---RQRELAAKCLRLLTHSFNRDYSHVCVSASE----SKLSEMSVTLMRDSTSVSALNTLTPSSTCPSLVEGRYGSNTELRPPTPRSRAISPSPEHQS-QSAPEGEAKKSPSGPPESKRRVHTFVPDIQEIRVSPIVSKKGYLHFLEPHT-NGWVKRYVVVRRPYVYIYNSERDTVERAILNLSSAQVEYSEDQQAMLK----------------------TLFTFAVCTEHRGILLQATND--KEMHDWLYAFNPLLAGSIRSKLSRRR 1683          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Cavefish
Match: kif1ab (kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GENE-070912-480])

HSP 1 Score: 1282.32 bits (3317), Expect = 0.000e+0
Identity = 738/1500 (49.20%), Postives = 957/1500 (63.80%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTD-FIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXN----IEVGEGLSGI--------PEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVF----NCEGEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTG---------LLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKL 4501
            +SVKVAVRVRPFN REI +++KCII M G+TT I  P   +  KSF FDYSY S   P D NF  Q++VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIP LC  LF +++D    N+D    + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPL+GPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D D + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S+    KKK+K + FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELKEEV +L+++L  +     IE+   ++G+              R    +S+    +    +++ IE+L+ +EK+IAELNETWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG TKVG+ +   S + DI LSG  I   HC+F       GE  V L    DAE YVNGKR+ E T L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA  + E+Q+ +YE K++ L++QV   S    +    ++E  E  AW+ R+ +LA WAF KW+ +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YS        +       SIA   E +                                +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE    VP   +     ++TGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ F+D  +   +   T + TG    ++    ++     +  +     + +           +S       TG          LK+G TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN  V VT++FV+YIK+  I FE+F H  ++P   L   L + L+ S+R         PL  PVP+ K         G    +YDL+ +FEI EL ANG+Y+   VDH    PCHG F++HQ +QRR +VTI HE   D    E   L+         GR+R+ PE  +      +LSLN+L A       D+R  +RFEAAWDSS+H S LLN +T   E I++T+S YL++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y++ L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL
Sbjct:    4 ASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTILNPKQPKENKSFNFDYSYWSHTSPEDINFACQKQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQ-EKDQQGIIPLLCEDLFTKIND----NNDNN--MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDSDTDNTLEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSLPNKNKKKKKAESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSALSSRAGSISSLHDRIMFSPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITKVGREDA--SCRQDIVLSGHFIEEEHCLFTSSTGASGEGVVVLEPCKDAETYVNGKRVTEPTVLRSGNRIIMGKSHVFRFNDPEQARQERERTPCAETPVEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEASNLLEQQRLDYESKLEALQRQV--DSRYYPETTEEEEEPEEEVAWTNRETELALWAFRKWRFYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYS-------PLPPDLLPPSIAKDREKRP-----------------------------FPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAE----VPSSAMEDCDHALTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFEDQQF---EKFQTESCTGGMSHSNTSQEELRIVEGEGQSSDLSLSADEVNNNTCTDAPASPLKSLEVTGDILQEKAFQHLKIGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNITVEVTKSFVEYIKSQPIVFEVFGHYQKQPFPPLCKDLISPLRPSRRQ---FPRVMPLSKPVPATKLGAMTRSSAGPCHCKYDLMAFFEICELEANGDYIPAVVDHRGGMPCHGTFLLHQGIQRRITVTIAHESGRDIEWKEVKELVI--------GRIRNTPEADETIIDPNILSLNILSAGSYRPSYDDRRFYRFEAAWDSSMHNSLLLNRVTPYGEKIYITLSAYLEMENCSQPTVITKDFCMVFYSRDAKLPASRSIRNL--------FSTGVLRPSESNRVTGVYEISLCHLADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKL 1400          

HSP 2 Score: 114.775 bits (286), Expect = 6.868e-25
Identity = 61/140 (43.57%), Postives = 88/140 (62.86%), Query Frame = 2
Query: 5093 ISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKS 5512
             SP++S+KGYL+ LE    ++WVKR+VVVRRP++Y+Y  E+D VER +INL++AQ++Y+                     + T  R+    + F++   HR  L+Q   D  KE+HDWLYAFNPLLAG IRSKL R++ +
Sbjct: 1540 FSPIVSKKGYLHFLE-LHTSSWVKRYVVVRRPYVYLYRSERDSVERAVINLSSAQVEYS-------------------EDQQTMLRTP---NTFAVCTEHRGILLQASND--KEMHDWLYAFNPLLAGTIRSKLSRKKSA 1654          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Cavefish
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:103027085])

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 462/792 (58.33%), Postives = 581/792 (73.36%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGL-------------------SGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMIS-ADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYS 2398
            +SVKVAVRVRPFN REIS+++KCII M+G++T I  P + KE PKSF FDYSY S   P D  F +Q  VY+D+G++ L+HA EGYNVCI AYGQTGAGKSY+MMGK  +  QEGIIPQLC  LF++++D   + +DE   I +++EV+YMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+DAGNK+RTVAATNMNETSSRSHAVFTI+ +QR  D + +L+ EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+S      KKK+K+DFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN +LVRELK+EVL+L+++L+ + +  G+ L                   +G+  +S I+E          +     ++ IE+L+ SEK+IAELNETWE+KL+KTE +R +R++ LAE+G+ I+ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VGQ +     + DI LSG  I   HC+F  E        V L     +E YVNGKR+  +  L+S +R+I GKNHVFRFN+P  A+  REK    E P E +DW FA  ELLEKQG+D+++EME RL  +E  +KKEKEEAD++ E+Q+  YE K+Q L++QV   S+I+   D   ++E  +   W++ +++LA WAF KW++HQ+TSLR             D LW N V+LKEANA+S EL KKV FQF LLT+T YS
Sbjct:    4 ASVKVAVRVRPFNSREISKESKCIIQMQGNSTTILNPKAPKESPKSFSFDYSYWSHTSPDDPTFASQNRVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEE-GQEGIIPQLCEDLFEKIND---NINDE---ISYSVEVAYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDTETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVS------KKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVLRLKDLLRAQGL--GDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQE--------RIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADA--ERRQDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVMAAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPTAETPVEPVDWTFAQRELLEKQGIDMKQEMEKRLTEMEILYKKEKEEADQLLEQQRLVYESKLQELQKQVETRSLIAETPDEEEEEEEEDEVPWTQAEFELAQWAFRKWRYHQFTSLR-------------DQLWGNAVYLKEANAISVELKKKVQFQFVLLTDTLYS 757          

HSP 2 Score: 479.174 bits (1232), Expect = 7.858e-140
Identity = 278/658 (42.25%), Postives = 391/658 (59.42%), Query Frame = 2
Query: 2570 KTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSL----LTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYI-SNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEA 4510
            +T + +EV+D+KNGA HYW L K ++RL+ +RE+Y    EM  +  +         +TG DPFYDRF WF+LVGR+FV+LSNLLY+VPL+HRVAVV EKGEV+G LRV +Q I   E                 +  D  S    S   ++ FDD+ YF +       +TR+   L +      V+      +      + N  +         D+     +   G L++G  F FRVT+LQ +G+  +Y D FCQ++FL++ ++ +STEPLKN GK TP+GFYHVQN +V VT +F++YIK+  I FE+F H  Q P   L  +    +   + +K +     PL  PVP+ K    +    G  + +YDLL WFEI EL   GEY+   VDH+   PCHG +++HQ +QRR +VT++HE        + S L +  VRE+VVGR+R++PE +D      VLSLN++ A  + S+    R  +RFEA WDSSLH S LLN +T   E I++T+S YL++++CI+P  ITKD C+V   RD+++S PR  +N+        F   + KT D NRVTGIY+L L ++    S    RR ++  + +  YVRGEEN+ GWRPR DSLIL+HQW+LEKL +L  VEK RH+LLLREKLSE+
Sbjct:  779 RTVVAVEVQDLKNGATHYWSLEKLKQRLEQMREMYDRAGEMASSNQE----DGEGPLTGSDPFYDRFHWFKLVGRAFVYLSNLLYSVPLVHRVAVVTEKGEVRGFLRVGVQAIAADE-----------------EAPDYGSGVRQSGTAKISFDDE-YFKKSDFSSVAMTRSGLSLEELR---IVEGQGQSSEVITPSEEMNRINEMDLKLGNVDTKLGLSEGVAGQLEVGSIFTFRVTVLQANGILPEYADIFCQFNFLHRHDEAFSTEPLKNTGKGTPLGFYHVQNISVEVTESFIEYIKSKPIVFEVFGHYQQHP---LHHHGQDAVSLPQPSKKYYPPPMPLSKPVPATKLNTISKSNLGQCVSKYDLLAWFEISELEPTGEYIPAVVDHTGGLPCHGTYLLHQGIQRRITVTLIHE--------KGSELHWKDVRELVVGRIRNKPE-VDDTAADAVLSLNIISAKNMKSSHNTNRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAIITKDICMVFYSRDAKISPPRSLRNL--------FGSGYSKTPDCNRVTGIYELSLCKMADTGSPGMQRRRRKVLDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLEQLHEVEKTRHLLLLREKLSES 1391          

HSP 3 Score: 120.939 bits (302), Expect = 1.055e-26
Identity = 90/273 (32.97%), Postives = 137/273 (50.18%), Query Frame = 2
Query: 4799 REKLLTSRCVELMTVSNKSQTYQ-------------SSMGKE---DMFKSEML--DSSVSMINDSHLFN-DEGSMMTNSR------------PMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNN 5524
            REK L ++C+ L+T +  S   Q             S MG++       S  L   S+   + DS   + D+ +   NSR            PM  +L T  +         A K+    LV + +E+R   V+S+KGYL+ +E  +  +W+K +VVVRRP+++IY  +KDPVERG++NL+TAQ++Y+                 +  A    P +      F++   HR  L+Q   ++ K+++DWLYAFNPLLAG IRSKL RRR  +  N
Sbjct: 1448 REKELATKCLRLLTHTFNSDYNQLCNSISDCKLSDISPMGRDPSVTSLSSATLTPSSTCPSLADSRCGSVDQKTPEANSRASSPSCSDYENFPMVPTLETSYLAR-------AGKHEFLNLVPDIEEMRPGSVVSKKGYLSFME-PRSNSWLKHFVVVRRPYVFIYNSDKDPVERGVLNLSTAQVEYSE----------------DQQAMLKTPNT------FAVCTKHRGILLQA--NNDKDMNDWLYAFNPLLAGTIRSKLARRRSGLMKN 1688          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Cavefish
Match: kif1b (kinesin family member 1B [Source:NCBI gene;Acc:103027085])

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 411/680 (60.44%), Postives = 511/680 (75.15%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSS-KEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGL-------------------SGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQK 2065
            +SVKVAVRVRPFN REIS+++KCII M+G++T I  P + KE PKSF FDYSY S   P D  F +Q  VY+D+G++ L+HA EGYNVCI AYGQTGAGKSY+MMGK  +  QEGIIPQLC  LF++++D   + +DE   I +++EV+YMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+DAGNK+RTVAATNMNETSSRSHAVFTI+ +QR  D + +L+ EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+S      KKK+K+DFIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN +LVRELK+EVL+L+++L+ + +  G+ L                   +G+  +S I+E          +     ++ IE+L+ SEK+IAELNETWE+KL+KTE +R +R++ LAE+G+ I+ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VGQ +     + DI LSG  I   HC+F  E        V L     +E YVNGKR+  +  L+S +R+I GKNHVFRFN+P  A+  REK    E P E +DW FA  ELLEKQG+D+++EME RL  +E  +KKEKEEAD++ E+Q+
Sbjct:    4 ASVKVAVRVRPFNSREISKESKCIIQMQGNSTTILNPKAPKESPKSFSFDYSYWSHTSPDDPTFASQNRVYNDIGKEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEE-GQEGIIPQLCEDLFEKIND---NINDE---ISYSVEVAYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQRKHDTETDLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVS------KKKKKSDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKDEVLRLKDLLRAQGL--GDILDTPMGCLTASPSSGSLCSQAGLQSVSSIQE--------RIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADA--ERRQDIVLSGAHIKEEHCIFRSERNANGDVIVMLVPCEGSETYVNGKRVMAAVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPTAETPVEPVDWTFAQRELLEKQGIDMKQEMEKRLTEMEILYKKEKEEADQLLEQQR 658          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Cavefish
Match: KIF1C (kinesin-like protein KIF1C [Source:NCBI gene;Acc:103042456])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 387/701 (55.21%), Postives = 481/701 (68.62%), Query Frame = 2
Query:   98 LMSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKP-SSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGI-----PEISVIRECRXXXXXXXXXXXXXXXXV---------------------------IEKLRASEKL------IAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEH-----VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQK 2065
            + +SVKVAVRVRPFN RE SRDAKC+I M+G TT I  P   KE  K+F FDYSY S     D NF  Q+ VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMGK  + DQ+GIIPQ+C  LFKR  +    N+D    + +++EVSYMEIYCERVRDLLNPK+  NLRVREHP++GPYVEDLSK  V ++ DI  L+D GNK+RTVAATNMNETSSRSHAVFTII +QR  D+   L  EKVSKISLVDLAGSERADS+GAKG RLKEGANINKSLTTLGKVISALA++ S      KK+K++FIP+RDSVLTWLL+ENLGGNS+TAM+ A+SPADINYEETLS+LRYADRAKQI C A+INEDPN       +       E+ +L  I + +GLS +     PE++  R C +     +      +  +                           I K  A E+L      IAELNETWE+KL+KTE +R +R++ LAE+G++IK DGG  GVFS K  P+LVNLNED LM+ECL+YY+K+G T+VGQ ++      DI LSG  I   HCVF C   H     VTL  +  AE YVNG  I E  +LK  +R++ GKNHVFRFN+P  A++ RE+ +  E   E +DW++A  ELLE QG+D++ EM+ RL  +E  +++EKEEAD + E+ +
Sbjct:    1 MAASVKVAVRVRPFNNRESSRDAKCVIQMQGKTTCITNPKQPKESAKNFTFDYSYWSHTTEDDPNFACQRRVYLDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGK-QEPDQQGIIPQMCEDLFKRTSE----NTDPD--LSYSVEVSYMEIYCERVRDLLNPKSGGNLRVREHPIMGPYVEDLSKLAVTTYSDITHLMDCGNKARTVAATNMNETSSRSHAVFTIIFTQRRRDQLTSLDTEKVSKISLVDLAGSERADSSGAKGMRLKEGANINKSLTTLGKVISALADMQS-----SKKKKSEFIPYRDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRAKQIRCNAIINEDPNA------RLIRELKEEVNRLREILLTQGLSQLITAAGPEVNNNRVCPALPADPTPNGGPPSTTIVPEHSPAQDGDPTPDDGLNQSEFPKVVISKEEAVERLRETEKIIAELNETWEEKLRKTESIRLERETLLAEMGVSIKEDGGTVGVFSPKGTPHLVNLNEDPLMSECLLYYIKEGVTRVGQKDV------DIRLSGQFIKEQHCVFYCNTNHNGEVVVTLEPLEGAETYVNGIEITEPMALKQGNRIVMGKNHVFRFNHPEQARLERERSSSMEQQGEPVDWSYAQKELLENQGIDIKLEMDKRLQDMELLYRREKEEADLLLEQHR 677          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Sea Lamprey
Match: kif16bb (kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GENE-070424-241])

HSP 1 Score: 464.151 bits (1193), Expect = 6.337e-138
Identity = 302/742 (40.70%), Postives = 423/742 (57.01%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGS---TTNIFKPS------SKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKN--NLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVI----------EKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEF------------PCESLDWNFATAELLEKQGVDL----RKEME------TR--LVMLEEQFKKEKEEADKIFEK------QKQEYEIKIQTLEQQVVKASM---ISADDYLSDDENYE 2164
            M+SVKVAVRVRP N RE   +AK II MEG     TN+  P       S+E  K F +DYSY S+      F +Q+ VY D+G D L+ A EGYN CI AYGQTG+GKSY+MMG PGD    G+IP++C  L++ +      +   ++   +  EVSY+EIY ERVRDLL  K+    NLRVREHP  GPYVEDLSK +V+++ D+ EL++AGN +RT AAT MN+ SSRSHA+FTI  +Q   D   E+  E VSKI LVDLAGSERAD+TGA G RLKEG NINKSL TLG VIS+LA+LS    S + ++K  F+P+RDSVLTWLL+++LGGNSKT M+  ISPAD+NY ETLS+LRYA+RAK I+ K  INED N                                  + +IRE R+  +    ++ Q NQ+ +          +KL  +E  + EL + W +K  +T+++       L E  + ++ +G   GV    + P+L+ +++D L    ++Y+LK+G T VG     N  + DI L G  +   HCVF      VTL    +A C VNG +I + T L     ++ G+ ++FRFN+P  A   REK+                  CE+L     +A +L   G++     ++EME      TR  +V +E++ K  K E +K+ E+      + Q+ +++I+  E+ + + SM       D+L + E +E
Sbjct:    1 MASVKVAVRVRPMNQREKGLEAKFIIQMEGKKTVITNLKTPEGSTGDVSRERLKEFTYDYSYFSVDKRSPQFASQEMVYKDIGMDVLDAAFEGYNACIFAYGQTGSGKSYTMMGNPGDL---GLIPRICEGLYRGV------SQHISSGASYRTEVSYLEIYNERVRDLLRRKSSKSFNLRVREHPKEGPYVEDLSKHLVQNYSDVEELMEAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFD--AEMPRETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISSLADLSLSSSSPQGRKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIINKPTINEDSN----------------------------------VKLIRELRAEIVRLKALLTQGNQNSLLDSPTALSMEQKLHQNEARVEELTKEWTNKWNETQNI-------LREQTLALRKEG--IGVILDSELPHLIGIDDDLLSTGIILYHLKEGRTFVGVDNAEN--EQDIILHGPDLESEHCVFEHLKGVVTLVPRDNALCSVNGVQIRQPTQLSQGAVILLGRTNMFRFNHPKEAAKLREKRKSGLLSTLSLSMTDLSKSCENL-----SAVMLYNPGLEFERQHKEEMEKLEHKSTRKEIVEMEQKHKTAKAELEKMQEEMESQRVETQKVQLQIKRQEESLKRRSMDIESKFKDFLVEKERFE 681          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009202.1 (pep scaffold:Pmarinus_7.0:GL476573:157904:241529:1 gene:ENSPMAG00000008319.1 transcript:ENSPMAT00000009202.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 357.451 bits (916), Expect = 2.959e-105
Identity = 244/631 (38.67%), Postives = 352/631 (55.78%), Query Frame = 2
Query:   98 LMSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP-KSFIFDYSYSS-----------ICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKN--KNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQI---SREKKTV------EEFPCES 1921
            +  ++KVAVRVRPFN RE +R A  IISMEG+TT I KP S +   K+F FDYSY S           + P +  F +Q+ V+ DLGE  LE+A  GYN  + AYGQTG+GK+YS++G   +   +GI+P  C  LF   +DI+          +  + +S +EIY E+VRDLLNP++  +  LR+RE    G +VE+L    V S+ DI+  I  G ++RT+AAT+MN TSSR+H +  I   Q+ +  DG  T +K S I++VDLAGSERA +TGA   RLKEG  IN+SL+TLG VI ALA+        K  +K+  +PFRDSVLT LL+  LGGNSKT M+ A+SPAD+NYEETLS+LR+ DRAK I  +AV+NE P +RLVREL++E ++L+E+L   +       S  P  S   + R      +           E+  ASE+L        + KL++ ++LR++R                       K  P+L NLNED  +   L +++ +G   +G  +  N + + +H  G  ++P H   N +   + L    +A   +NG  + +   L  +DRL+ G + ++   +P    +      K+TV      EE  C S
Sbjct:    3 MTENIKVAVRVRPFNEREKTRGASIIISMEGNTTRIIKPRSGDADVKTFTFDYSYWSHDGFVALDNGYLAPENEQFADQKRVFSDLGEGILENAWNGYNCSLFAYGQTGSGKTYSVVGGSAN---KGILPLFCERLF---EDIERKQESAAEGTEFQVSLSMVEIYNEQVRDLLNPQSGRQGGLRIREKVDHGFFVENLLTVPVGSYGDIDSRIQEGTRNRTIAATHMNATSSRAHTIVAITFVQKAMS-DGGHTLQKSSTINIVDLAGSERAGNTGAARERLKEGCMINQSLSTLGNVIKALAD------QGKGVQKSTVLPFRDSVLTKLLKNALGGNSKTIMIAALSPADVNYEETLSTLRFVDRAKAIRVQAVVNESPTSRLVRELQQENMRLQELLSQASYGALSNHSWNPCASSWEQNRREMEHMAMSW--------EQRLASERL------AHQQKLKEEKELREKR-----------------------KTIPHLWNLNEDPALNGLLCHFIPEGSLSIGNGKSENPAGIILH--GVGVLPHHASVNNKDGVIILAPSPEARVLINGCPLTQPALLNHNDRLLLGASQLYVLYDPKAVSVDSGGDHKQTVTFDKAQEEIACNS 581          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009206.1 (pep scaffold:Pmarinus_7.0:GL476573:157919:195746:1 gene:ENSPMAG00000008319.1 transcript:ENSPMAT00000009206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 341.273 bits (874), Expect = 1.100e-102
Identity = 229/572 (40.03%), Postives = 327/572 (57.17%), Query Frame = 2
Query:  107 SVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPP-KSFIFDYSYSS-----------ICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKN--KNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNG 1780
            ++KVAVRVRPFN RE +R A  IISMEG+TT I KP S +   K+F FDYSY S           + P +  F +Q+ V+ DLGE  LE+A  GYN  + AYGQTG+GK+YS++G   +   +GI+P  C  LF+ ++      + + A + + + +S +EIY E+VRDLLNP++  +  LR+RE    G +VE+L    V S+ DI+  I  G ++RT+AAT+MN TSSR+H +  I   Q+ +  DG  T +K S I++VDLAGSERA +TGA   RLKEG  IN+SL+TLG VI ALA+     K  +K      +PFRDSVLT LL+  LGGNSKT M+ A+SPAD+NYEETLS+LR+ DRAK I  +AV+NE P +RLVREL++E ++L+E+L   ++   +G S     +    C                   +  R  E +      +WE +L       +Q+  E  EL    KT             P+L NLNED  +   L +++ +G   +G  +  N + + +H  G  ++P H   N +   + L    +A   +NG
Sbjct:    1 NIKVAVRVRPFNEREKTRGASIIISMEGNTTRIIKPRSGDADVKTFTFDYSYWSHDGFVALDNGYLAPENEQFADQKRVFSDLGEGILENAWNGYNCSLFAYGQTGSGKTYSVVGGSAN---KGILPLFCERLFEDIERNVEHITGDMALVCN-VSLSMVEIYNEQVRDLLNPQSGRQGGLRIREKVDHGFFVENLLTVPVGSYGDIDSRIQEGTRNRTIAATHMNATSSRAHTIVAITFVQKAMS-DGGHTLQKSSTINIVDLAGSERAGNTGAARERLKEGCMINQSLSTLGNVIKALAD---QGKGVQKSTALVLLPFRDSVLTKLLKNALGGNSKTIMIAALSPADVNYEETLSTLRFVDRAKAIRVQAVVNESPTSRLVRELQQENMRLQELLSQASVGSVQGESWGGPCTTKCPCDPAKFSLLASWNPCASSWEQNRREMEHMAM----SWEQRLASERLAHQQKLKEEKELREKRKTI------------PHLWNLNEDPALNGLLCHFIPEGSLSIGNGKSENPAGIILH--GVGVLPHHASVNNKDGVIILAPSPEARVLING 546          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005274.1 (pep scaffold:Pmarinus_7.0:GL482849:195:11973:-1 gene:ENSPMAG00000004797.1 transcript:ENSPMAT00000005274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.997 bits (798), Expect = 4.629e-96
Identity = 166/305 (54.43%), Postives = 215/305 (70.49%), Query Frame = 2
Query:  296 QQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKN-KNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNT 1207
            Q+ V+H LG+  L++A +GYN CI AYGQTG+GKSYSMMG     +Q G+ P+LC +LF+R+  +  D+          +EVSYMEIY E+VRDLL+PK  + +L+VREH LLGPYV+ LS+  VR+FQ +N L   G+K R        E +S +   +   L+Q + D     +GEKVS++SLVDLAGSERA  TGA G RLKEG+NINKSL+TLG VISALA+ ++       K K  F+P+RDS LTWLL++NLGGNS+TAM+  +SPA  NYEETLS+LRYADRAK+IV  AV+NEDPN 
Sbjct:    3 QEVVFHALGDGILDNAFQGYNACIFAYGQTGSGKSYSMMGSA---EQPGLTPRLCGALFERVSRLSRDDH------SFKVEVSYMEIYNEKVRDLLDPKGGRQSLKVREHKLLGPYVDGLSQLAVRTFQHVNNLYKIGSKFRPGHRVTSRELASCNQGWWGXTLTQTLTDLASGTSGEKVSRLSLVDLAGSERASKTGAAGDRLKEGSNINKSLSTLGLVISALADQAA------GKNKNKFVPYRDSALTWLLKDNLGGNSRTAMVATVSPAADNYEETLSTLRYADRAKRIVNHAVVNEDPNA 292          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005277.1 (pep scaffold:Pmarinus_7.0:GL482849:207:11964:-1 gene:ENSPMAG00000004797.1 transcript:ENSPMAT00000005277.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 292.738 bits (748), Expect = 2.290e-89
Identity = 157/304 (51.64%), Postives = 206/304 (67.76%), Query Frame = 2
Query:  305 VYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKN-KNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKS---RTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPN 1204
            V+H LG+  L++A +GYN CI AYGQTG+GKSYSMMG     +Q G+ P+LC +LF+R+  +  D+          +EVSYMEIY E+VRDLL+PK  + +L+VREH LLGPYV+ LS+  VR+FQ  +  + + N+           + + +S          +          +GEKVS++SLVDLAGSERA  TGA G RLKEG+NINKSL+TLG VISALA+ ++       K K  F+P+RDS LTWLL++NLGGNS+TAM+  +SPA  NYEETLS+LRYADRAK+IV  AV+NEDPN
Sbjct:    3 VFHALGDGILDNAFQGYNACIFAYGQTGSGKSYSMMGSA---EQPGLTPRLCGALFERVSRLSRDDH------SFKVEVSYMEIYNEKVRDLLDPKGGRQSLKVREHKLLGPYVDGLSQLAVRTFQVTSRELASCNQGWWGELTLTQTLTDLASGRPRTHWCSCTNTCTQTTRRTSGEKVSRLSLVDLAGSERASKTGAAGDRLKEGSNINKSLSTLGLVISALADQAA------GKNKNKFVPYRDSALTWLLKDNLGGNSRTAMVATVSPAADNYEETLSTLRYADRAKRIVNHAVVNEDPN 291          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 202.601 bits (514), Expect = 7.036e-54
Identity = 129/322 (40.06%), Postives = 188/322 (58.39%), Query Frame = 2
Query:  239 FIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNN-LRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQ--RILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINE 1195
            F+FD  +           +Q  VY +     L+  L+G+N  + AYG TG GK+Y++ G P    Q GII      LF ++ D+K    DE  +    + +SY+EIY ER+RDLL P+  +  L +RE       V +LS     + +D+ +L+  GN +RT + T  NE SSRSHAV  I + Q  +++D   + T    + +S++DLAGSERA +T  +G RL EGANIN+SL  LG  I+AL  L+   +S         IP+RDS LT LL+ +LGGN KT M+V ISP+  +Y+ETL++L+YA+RAK+I  K + N+
Sbjct:  153 FVFDKLFDETS-------SQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPS---QPGIIFLAMEELFNKITDLK----DEKDF---EISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHT---FATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALC-LNDGSRSCH-------IPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQ 446          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 180.259 bits (456), Expect = 5.224e-46
Identity = 137/398 (34.42%), Postives = 208/398 (52.26%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPT---DSNF---VNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKP---GDF---------DQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRD-----------LLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGE-----KVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINE 1195
            S++ V VR R  N REI   +  +IS  G       P  KE   S     SYSS   T   D  F    +Q+ V++   ++ ++  L GYN  I AYGQTG GK+Y+M G     GD          +  GIIP++   LFK L  +  +         +++++S++E+Y E ++D           + +PK +  +    +      V+ + +  + S  +   L+  G+  R VAAT  N+ SSRSH VFTI  +  I+++D +  G+     K+ K++LVDLAGSE  + +GA+  R +E   INKSL TLG+VI+AL + S            + IP+R+S LT LL+++LGG +KT ++  ISPA I+ EET S+L YA RAK I     +N+
Sbjct:   51 SNIHVYVRCRSRNKREIEEKSSVVISTLG-------PQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKE---------YSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTI--TTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS------------NHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 418          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 166.392 bits (420), Expect = 1.707e-42
Identity = 128/376 (34.04%), Postives = 190/376 (50.53%), Query Frame = 2
Query:   98 LMSSVKVAVRVRP------------FNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNN--------LRVREHPLLGPYVEDLSKSIVRSFQDINELI-DAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRA 1162
            L  +++V  R+RP             N+ E   D   + SME     + K  +      F FD  +      D+N     +V+ ++G+  ++ +L+GYNVCI AYGQTG+GK+++M+  PGD    GIIP     +F  ++ +K    D      + +   ++EIY E + DLL   N N           +R              S     +++ E+I    NK R+ A+T  NE SSRSH++F I LS      + +        ++LVDLAGSER + +   G RL+E  NINKSL+ LG VI AL +      STK+      IPFR+S LT+LL+ +L G+SKT M V ISP+  +  ETL+SLR+A + 
Sbjct:  383 LRGNIRVYCRIRPALKNLENSDTSLINVNEFD-DNSGVQSME-----VTKIQNTAQVHEFKFDKIFDQ---QDTNV----DVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLN-PGD----GIIPSTISHIFNWINKLKTKGWD------YKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLS----GSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQ----PDSTKR-----HIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 141.354 bits (355), Expect = 4.367e-34
Identity = 83/184 (45.11%), Postives = 118/184 (64.13%), Query Frame = 2
Query:  632 GPYVEDLSK-SIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCK 1180
            G Y+++L +  I  + + +N L+  G K R VA+T MN+ SSRSH +FTI L ++  DE       ++SK++LVDLAGSE  + +GA   R KE  +IN+SL TLG+VI+AL +            K+  IPFR+S LT LL+++LGGN+KTA++  ISPA +  EET S+L YA +AK I  K
Sbjct:  315 GIYIQNLQEFHITNAMEGLN-LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF-----RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD------------KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480          

HSP 2 Score: 61.2326 bits (147), Expect = 1.613e-9
Identity = 52/174 (29.89%), Postives = 84/174 (48.28%), Query Frame = 2
Query:  107 SVKVAVRVRPFNMREISRDAKCIIS---MEGS------TTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQE-----GIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLN 586
            ++ VAVR R  N REIS  +  +++   + GS      TT     +++   K +  D  +      D  F    EV   L +D     ++GYN  +L YG T  GK+Y+M G    ++ E     GIIP   R L K  D ++L  +D      + ++ S++E+Y E ++DLL+
Sbjct:   36 NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF---DEVAGPLFQD----FIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIP---RVLLKLFDTLELQQND------YVVKCSFIELYNEELKDLLD 193          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 133.265 bits (334), Expect = 5.251e-32
Identity = 110/354 (31.07%), Postives = 172/354 (48.59%), Query Frame = 2
Query:  239 FIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLL-------------------NPKNKNNL----RVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALA--ELSSM-----------------DKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIV 1174
            F FD+ ++S C   +N     EVY    +  ++  L G+N  I AYG TG+GK+++M G   +    G+IP     LF  + +  ++   +   I     +SY+EIY ER+ DLL                   +  N N L    ++R+    G  V  L++    S +++   I  G+KSR +  T+ N  SSRSHA+  I    R+   + +    + S +SL DLAGSERA  TG +  R KEG+ INKSL  LG VIS L+  +++S+                 + +      ++ IP+RDS LT LL+  L G+S    +  +   +    ET+++LR+A RAK + 
Sbjct:  163 FKFDHVFASHC---TNL----EVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQEL---GLIPLSVSYLFTNIMEQSMNGDKKFDVI-----ISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLI----RLTSTNVKNGTSRSSTLSLCDLAGSERA--TGQQ-ERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVA 494          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Nematostella
Match: EDO38591 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK0])

HSP 1 Score: 501.13 bits (1289), Expect = 8.056e-151
Identity = 361/941 (38.36%), Postives = 528/941 (56.11%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPK--------SFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKN-NLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAI 2899
            S VKVAVRVRP N REI   +K ++ ME + T I  PS     K        +F FD+ + SI    + F  Q +VY  LG D LE+A EGYN CI AYGQTG+GK+Y+MMG   D   +GIIP+LC +LF+ +   + DN D    I + +EVSY+EIY E+VRDLL P+  + +LRVREH ++GPYVE L+K +V SF+DI  ++  GNKSRTVAAT MN  SSRSHAVF I+L++   D   E  GEKVSK+SLVDLAGSERA  TGA+G RLKEG+NIN+SL TLG+VIS+LAE S+       K+   F+P+RDSVLTWLL++NLGGNSKT M+  ISP+  NYEETLS+LRYADRAK+IV  AV+NEDPN R++REL+EEV +L+ +L+ +       ++G P    I+E                 ++ E +  +E L+ E   +WE K ++TE ++++R   L ++GI+I++ G   GV   K +  LVNLN D  M E LVYYLK+  +KVG+ +  ++   DI L G  I+P HC  + E   V LT   +A  +VNG+ + E T L+  DR+++G NH FR N P      R   + E+ P + +D+  A  EL+  +    +  ++  +  LEEQ++ +K+ A    EKQ+  YE KI+ L+++V  +   S      D  +   +  S    +++ +   +    QY    +     Q    +K+++      ++EAN +S+E+NK   F                  T+++ TS++                              T   S   + ++  +V++    K+     W L K   ++  +RELY    E  E VP    N +++     D F++      L+G   VFL  LL++V   +   +++++GEV G L+V +
Sbjct:    3 SKVKVAVRVRPLNRREIDLGSKVVVDMEENQT-ILLPSRGNDRKQAKVRMVHNFAFDHCFWSIDAAKTKFAAQDKVYECLGSDVLENAFEGYNACIFAYGQTGSGKTYTMMGAGED---KGIIPRLCVNLFRGIS--QNDNHD----ITYKVEVSYIEIYNEKVRDLLCPRGGSASLRVREHKVMGPYVEGLTKLVVSSFEDIEAIMMEGNKSRTVAATRMNTESSRSHAVFNILLARTEYDHQTESIGEKVSKLSLVDLAGSERACKTGAEGDRLKEGSNINRSLVTLGQVISSLAEQSA---GKHGKKGAHFVPYRDSVLTWLLKDNLGGNSKTVMVATISPSADNYEETLSTLRYADRAKKIVNHAVVNEDPNARIIRELREEVERLKHLLQSK-------IAGFP----IQE------------ETGELEIQEMISENENLMKECTMSWEQKEKQTEKIQQERHKALEDMGISIQSSG--IGV--EKNKFYLVNLNADPAMNELLVYYLKE-HSKVGRLDANHTP--DIQLGGLGILPEHCEMDIEENEVYLTPSPNARTFVNGRDVKERTLLRHGDRILWGNNHFFRINCP------RPPGSSEQQPEQQVDFMSAQQELMMHEIA--QGPLQESVRALEEQYQADKQGA---LEKQRLMYEEKIEELKKEVQMSPFGSRPQI--DRTSSLSSFSSGYGSRMSWYEDRELSQSQYDPRPE-----QRPLVLKEEVLKANTLVREANQLSEEMNKDTDFAV----------------TLQIPTSSL------------------------------TFGKSRSGYSSEVAIVVK---HKSRGTQIWSLDKLSNKIYDMRELYNQCIE--EGVP---FNDKVDDT---DLFFE-VECHTLIGVCNVFLECLLHDVSHEYAAPIISQQGEVCGRLKVEV 824          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Nematostella
Match: EDO33740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRC2])

HSP 1 Score: 465.307 bits (1196), Expect = 1.985e-146
Identity = 274/612 (44.77%), Postives = 377/612 (61.60%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIF---------KPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNK----NNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVN-SSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKK 1894
            M+SVKVAVRVRP N RE +  AK II MEG  T I+         +   K   K F FDYSY S+     +FVNQ+ V+ DLG D ++ A EGYN CI AYGQTG+GK+Y+MMG  GD    G+IP++C ++F R+     +NS+    +    EVSY+EIY ERVRDLL P  K    ++LRVREHP  GPYV+DL+K +V  +  I  L++ GN  R  A+T MN+ SSRSHA+FT+  +Q   D   EL  E  SKI+LVDLAGSERAD+TGA G RLKEGANINKSL TLG VISALA+ S+   S     K  FIP+RDSVLTWLL+++LGGNSKT M+  ISPAD+NY ET+S+LRYA+RAK I+ K  INEDPN +L+R+L+ ++ KL+ +           +S + ++  +++           + +      +KL  +E  + +L + W+D+ ++T+ L ++R+ +L E G+ IK D            P+LV +++D L     VY+LK+G+T VG   + N +S  DI +SG      HC F        + +  ++ CYVN   I++ T LK  D +I G+ +VFRFN+P  A   REK+
Sbjct:    1 MASVKVAVRVRPLNNRENNMGAKTIIEMEGKKTRIYNVKGTNVTGEGERKNYVKDFSFDYSYWSVDERSRHFVNQERVFKDLGTDVVKAAFEGYNACIFAYGQTGSGKTYTMMGHNGD---TGLIPRICENMFHRM----TENSNADDGVSFRTEVSYLEIYQERVRDLLRPPTKGRAAHSLRVREHPKEGPYVQDLTKHLVSDYAAIEHLMEQGNSHRVTASTGMNDVSSRSHAIFTMNFTQAKFDM--ELPCETASKINLVDLAGSERADATGATGERLKEGANINKSLVTLGTVISALADASTGHGSHGSHHK--FIPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYAETMSTLRYANRAKNIMNKPTINEDPNVKLIRDLRSQIEKLKAM-----------ISPVSQLKALKDL----------LGEAELAAAKKLSENEARVTQLTDKWKDRWKETQKLLQEREMKLQEEGVGIKMD---------SILPHLVLVDDDLLSTGITVYHLKEGKTTVG---LTNPNSTQDIVISGPDTQANHCEFEHTKSGTVILSPLESLCYVNNNEINKPTRLKQGDVIILGQTNVFRFNHPKEAAELREKR 568          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Nematostella
Match: EDO29392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3S3])

HSP 1 Score: 407.142 bits (1045), Expect = 3.327e-124
Identity = 258/644 (40.06%), Postives = 369/644 (57.30%), Query Frame = 2
Query:  239 FIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLL-------NPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILD--EDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREK----KTVEEFPCESL---DWNFATAELLEKQGVDLRKEMETRLVM--------LEEQFKKEKEEADKIFEKQKQEYEIKIQTLE 2098
            F++D S  S   T+ +++ Q+++Y  +G+  L  A +GYN C+ AYGQTG+GKSYS+MG+    D+ GI+P+ C  LF+R+             ++ T+E+SY EIY E++ DLL           K  LRVREHP+LGP+V+DLS  +V S+ DI   +  GNK+R  A T MN+ SSRSH+VFTI++SQ   +  ED E    K SKI+L+DLAGSERA          +EG +INKSL TLGKVIS L+     DK   KK+K  +IP+RDS+LTWLL+++LGGNSKT M+  +SPA+ ++ ETLS+LRYA RA+ IV +A+INEDPN +++REL+ E+ +L  +       V E    + E++ +R                      KL+ +++++ E    W++KL  +E  + +    L + GI+ K D          K PNLVNLNED  ++E L+Y LK G T VG     + S+ DI L G  +   HCV   EGE V ++  GDA  YVNG  I E T L   DR++ G +H FR N+P+  +  REK    +  E  P ES    D+ FA  EL + Q   ++ E+E             + +Q + EKE A +   KQK++YE K   L+
Sbjct:   18 FVYDQSLWSADSTNPDYIGQEKLYSLMGKPLLNSAFKGYNTCLFAYGQTGSGKSYSIMGQG---DELGILPRFCEELFERIVIF--------TELKFTVEISYFEIYNEKIHDLLVSSKTKDEKSRKKQLRVREHPILGPFVQDLSTYVVTSYADIESWLALGNKNRATACTGMNDKSSRSHSVFTIVMSQTQTEIFEDTEAQITKTSKINLIDLAGSERASHV----LNDEEGGSINKSLHTLGKVISLLS-----DKELNKKKKL-YIPYRDSILTWLLKDSLGGNSKTTMIANVSPANTHFGETLSTLRYAQRARTIVNRAIINEDPNAKIIRELRAEIERLNSLGGHT---VEESNKALEEVASLR---------------------NKLQETQRMLIESTRNWQEKLALSEKRKLEEAENLKKAGISFKVDN---------KLPNLVNLNEDPQLSEMLLYILKPGSTTVG-----HDSQEDIQLLGALVAESHCVIKNEGEIVNISPKGDAATYVNGILISELTVLHHGDRIVIGGDHFFRLNHPIEVKKRREKIRHGEVPEGLPPESAGAKDFEFARNELAQVQNARMQAELEEAREEARIQAQEEIMKQIQLEKEAAQERLLKQKEQYEQKTLQLQ 602          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Nematostella
Match: EDO35613 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL10])

HSP 1 Score: 388.267 bits (996), Expect = 2.753e-114
Identity = 261/645 (40.47%), Postives = 363/645 (56.28%), Query Frame = 2
Query:  107 SVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKP-SSKEPPKSFIFDYSYSS-----------ICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKN-KNNLRVREHPLLGP-YVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGI----PEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVG------QPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTL-TAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQG 1966
            SVKVAVRVRPFN RE  R +K  + M  + T I  P +   PPK F FD+SY S           + P D  + +Q++V+ DLG   L +A EG+N  + AYGQTGAGKSYSM+G   +   +GI+P  C  LFK++      N+D T  +++ +  S +EIY E+VRDLL   N K  L+VR++P  G  YV++L K  V S+++I    + G  +RTVAAT MN TSSR+H V TI   Q + +E G+ T +K S I+LVDLAGSERADSTGA G RLKEGANINKSL+ LG VISALA+LS         +K   +P+RDSVLT LL+  LGGNSKT M+ A+SPADINY+ETL +LRYADRAK+I  KAV+NE+P      +     LK       +++E G  LS       EI  +R+                  + E+++A   +  E   +W+DKLQ++ D  +   SE+ E+   + +             P++VNLNED L++  + ++++  E  +G      QP IV         SG  I   H V   +   +T+      A+  VNG  +   T LK  DR++FG NH++   NP      + K+  E  P + +DW+FA  E+ E +G
Sbjct:    5 SVKVAVRVRPFNSREKDRGSKVCLDMIDALTQIRDPENPNAPPKEFTFDFSYWSHDGFREDENGYLHPEDPKYADQRKVFDDLGAGVLRNAFEGFNCSLFAYGQTGAGKSYSMVGYGVN---KGIVPITCDELFKQM----ATNTDAT--VKYQVSFSMLEIYNEQVRDLLCKNNPKGGLQVRQNPKEGSFYVQNLKKVAVGSYEEIERRTEEGTANRTVAATQMNATSSRAHTVVTIAFDQIMKNESGQET-KKSSIINLVDLAGSERADSTGATGDRLKEGANINKSLSALGNVISALADLSL-------GKKKVLVPYRDSVLTKLLQNALGGNSKTIMIAALSPADINYDETLGTLRYADRAKKIKNKAVVNENP-----MDKLIRELKEENERLKKSMEGGIPLSAAGMSPEEIERMRK-----------------QMEEEIKAQLAMNNESMMSWDDKLQQSRD--EGSSSEVQEMQQKLNS------------VPHIVNLNEDPLLSGVVKHFIEQEEVTIGNKKAEPQPSIV--------FSGLSIQKQHAVITIKDSEITIKPGTSGAKTKVNGLPLTGETPLKHMDRILFGSNHMYYLFNP------KNKEKNEGSP-DRVDWDFAQKEIAEAKG 581          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Nematostella
Match: EDO33724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRC3])

HSP 1 Score: 359.762 bits (922), Expect = 2.222e-112
Identity = 184/327 (56.27%), Postives = 231/327 (70.64%), Query Frame = 2
Query:  224 EPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNP---KNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINE 1195
            E  K F FD+SY S    D +F +Q++V+ DLG D L  A EGYN CI AYGQTGAGKSYSMMG     + EG+IP++CR L+ R+     D +      +   EVSY+EIY E+VRDLL P   K+  NL+VREHP  GPYV+DL+K  V  ++ I  L+D+GN +RTVA+TNMN+ SSRSHA+FT+  +Q     D  +  E VSKI LVDLAGSERA+STGA G RLKEGANINKSL TLG VIS L ++     S K  +K  FIP+R+SVLTWLL+++LGGN+KT M+ AISPAD+NY ETLS+LRYA+RAK I+ K  +NE
Sbjct:    1 EDSKDFTFDHSYWSADSNDKHFASQEQVFDDLGTDVLGAAFEGYNACIFAYGQTGAGKSYSMMGMAVCTEAEGLIPRICRGLYSRMKSCADDKT------EFRTEVSYLEIYNEKVRDLLQPSKGKDHFNLKVREHPKEGPYVQDLTKHHVGDYEGIERLMDSGNSNRTVASTNMNDVSSRSHAIFTLSFTQAKFYTD--MPSETVSKIHLVDLAGSERANSTGATGDRLKEGANINKSLVTLGTVISNLGKVVDAGDSKKDAKKKLFIPYRNSVLTWLLKDSLGGNAKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNE 319          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Medaka
Match: kif1ab (kinesin-like protein KIF1A [Source:NCBI gene;Acc:101156771])

HSP 1 Score: 935.25 bits (2416), Expect = 0.000e+0
Identity = 520/950 (54.74%), Postives = 663/950 (69.79%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTD-FIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXN----IEVGEGLSGIPEISVIRECRXXXXXXX----XXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNC----EGEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            +SVKVAVRVRPFN REI +++KCII M G+TT I  P   +  KSF FD+SY S   P D N+ +Q +VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMG+  + DQEGIIP +C  LF      K+++S+    + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D + + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K + FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELKEEV +L+++L  +     IE+   ++G+     +    S +   S    +I    +++ IE+L+ +EK+IAELNETWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG TKVG+      ++ DI LSG  I   HC F+     +GE  V L     AE YVNGKR+   T L+S +R+I GK+HVFRFN+P  A++ RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q++KE+EEA  + E+Q+ +YE K++ L++QV    + S ++    +E      W++ + +LA WAF KW+ +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YS        +       S+A + E +                                +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE+    P   +     ++TGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I
Sbjct:    4 ASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTILNPKQPKENKSFNFDFSYWSHTTPEDLNYASQMQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGR-QEKDQEGIIPLMCEDLF-----TKINDSNNDNNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKKYDMETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSAPNKNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAASISNLHDRIYSPASEETIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITKVGRENA--KTRQDIVLSGHFIRDEHCTFSSTTGPQGEGCVILEPCEGAETYVNGKRVTSPTVLRSGNRIIMGKSHVFRFNDPEQARLERERTPCAETPVEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRKEREEASNLLEQQRLDYESKLEALQKQVDSRYLESPEEEEEPEEE---VPWTKHETELALWAFRKWRFYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYS-------PLPPDLLPPSVAKERERRP-----------------------------FPQTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEL----PSSAVEECDPAMTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAI 889          

HSP 2 Score: 359.377 bits (921), Expect = 2.908e-100
Identity = 194/427 (45.43%), Postives = 264/427 (61.83%), Query Frame = 2
Query: 3239 LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKL 4501
            LK+G TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN  V VT++F++YIK   I FE+F H  ++P   L   L + L+ S+R         PL  PVP+ K         G    +YDL+V+FEI EL ANG+Y+   VDH    PCHG F++HQ +QRR  VTI HE   D    E   L+         GR+R+ PE  +      +LSLN+L + Y     D++  +RFE+AWDSS+H S LLN +T   E I++T+S YL++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y++ L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL
Sbjct:  994 LKIGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNITVEVTKSFMEYIKTQPIVFEVFGHYQKQPFPPLCKDLISPLRPSRRQ---FPRVMPLSKPVPATKLNTMTRSTAGPCHAKYDLMVFFEICELEANGDYIPAVVDHRGGMPCHGTFLLHQGIQRRIRVTIAHETGNDIEWKEVKELVI--------GRIRNTPEADETIIDPNILSLNILSSGYFWPKHDDKTFYRFESAWDSSMHNSLLLNRVTPYGEKIYITLSAYLEMENCTQPTVITKDFCVVFYSRDAKLPASRSIRNL--------FSTGCLRPSESNRVTGVYEVTLCYVADNGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKL 1401          

HSP 3 Score: 93.5893 bits (231), Expect = 2.221e-18
Identity = 67/152 (44.08%), Postives = 96/152 (63.16%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKN 5521
             V +  EIR+SP++S+KGYL+ LE    + WV+R+VVVRRP++Y+Y  E+D VER +INL++A+++Y+                     + T  R+    + F++   HR  L+Q   D  KE+HDWLYAFNPLLAG IRSKL  RRKSV++
Sbjct: 1541 FVPDIQEIRVSPIVSKKGYLHFLEPHT-SGWVRRYVVVRRPYVYLYRSERDSVERAVINLSSAKVEYS-------------------EDKQTLLRTP---NTFAVCTEHRGILLQASND--KEMHDWLYAFNPLLAGTIRSKLS-RRKSVQS 1666          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Medaka
Match: kif1ab (kinesin-like protein KIF1A [Source:NCBI gene;Acc:101156771])

HSP 1 Score: 934.865 bits (2415), Expect = 0.000e+0
Identity = 520/950 (54.74%), Postives = 663/950 (69.79%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTD-FIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXN----IEVGEGLSGIPEISVIRECRXXXXXXX----XXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNC----EGEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            +SVKVAVRVRPFN REI +++KCII M G+TT I  P   +  KSF FD+SY S   P D N+ +Q +VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMG+  + DQEGIIP +C  LF      K+++S+    + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D + + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K + FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELKEEV +L+++L  +     IE+   ++G+     +    S +   S    +I    +++ IE+L+ +EK+IAELNETWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG TKVG+      ++ DI LSG  I   HC F+     +GE  V L     AE YVNGKR+   T L+S +R+I GK+HVFRFN+P  A++ RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q++KE+EEA  + E+Q+ +YE K++ L++QV    + S ++    +E      W++ + +LA WAF KW+ +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YS        +       S+A + E +                                +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE+    P   +     ++TGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I
Sbjct:    4 ASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTILNPKQPKENKSFNFDFSYWSHTTPEDLNYASQMQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGR-QEKDQEGIIPLMCEDLF-----TKINDSNNDNNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKKYDMETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSAPNKNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAASISNLHDRIYSPASEETIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITKVGRENA--KTRQDIVLSGHFIRDEHCTFSSTTGPQGEGCVILEPCEGAETYVNGKRVTSPTVLRSGNRIIMGKSHVFRFNDPEQARLERERTPCAETPVEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRKEREEASNLLEQQRLDYESKLEALQKQVDSRYLESPEEEEEPEEE---VPWTKHETELALWAFRKWRFYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYS-------PLPPDLLPPSVAKERERRP-----------------------------FPQTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEL----PSSAVEECDPAMTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAI 889          

HSP 2 Score: 355.525 bits (911), Expect = 4.728e-99
Identity = 197/435 (45.29%), Postives = 265/435 (60.92%), Query Frame = 2
Query: 3239 LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYI-----SNVG---DERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKL 4501
            LK+G TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN  V VT++F++YIK   I FE+F H  ++P   L   L + L+ S+R         PL  PVP+ K         G    +YDL+V+FEI EL ANG+Y+   VDH    PCHG F++HQ +QRR  VTI HE   D    E   L+         GR+R+ PE  +      +LSLN+L + Y       NV    D R  +RFE+AWDSS+H S LLN +T   E I++T+S YL++ENC +P  ITKDFC+V   RD++L   R  +N+        F     +  + NRVTG+Y++ L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL
Sbjct:  994 LKIGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNITVEVTKSFMEYIKTQPIVFEVFGHYQKQPFPPLCKDLISPLRPSRRQ---FPRVMPLSKPVPATKLNTMTRSTAGPCHAKYDLMVFFEICELEANGDYIPAVVDHRGGMPCHGTFLLHQGIQRRIRVTIAHETGNDIEWKEVKELVI--------GRIRNTPEADETIIDPNILSLNILSSGYFWPKHDDNVSLGVDHRTFYRFESAWDSSMHNSLLLNRVTPYGEKIYITLSAYLEMENCTQPTVITKDFCVVFYSRDAKLPASRSIRNL--------FSTGCLRPSESNRVTGVYEVTLCYVADNGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKL 1409          

HSP 3 Score: 93.2041 bits (230), Expect = 2.282e-18
Identity = 67/152 (44.08%), Postives = 96/152 (63.16%), Query Frame = 2
Query: 5066 LVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKN 5521
             V +  EIR+SP++S+KGYL+ LE    + WV+R+VVVRRP++Y+Y  E+D VER +INL++A+++Y+                     + T  R+    + F++   HR  L+Q   D  KE+HDWLYAFNPLLAG IRSKL  RRKSV++
Sbjct: 1549 FVPDIQEIRVSPIVSKKGYLHFLEPHT-SGWVRRYVVVRRPYVYLYRSERDSVERAVINLSSAKVEYS-------------------EDKQTLLRTP---NTFAVCTEHRGILLQASND--KEMHDWLYAFNPLLAGTIRSKLS-RRKSVQS 1674          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Medaka
Match: kif1ab (kinesin-like protein KIF1A [Source:NCBI gene;Acc:101156771])

HSP 1 Score: 923.309 bits (2385), Expect = 0.000e+0
Identity = 517/950 (54.42%), Postives = 660/950 (69.47%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTD-FIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXN----IEVGEGLSGIPEISVIRECRXXXXXXXXXX----XXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNC----EGEH-VTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPI 2908
            +SVKVAVRVRPFN REI +++KCII M G+TT I  P   +  KSF FD+SY S   P D N+ +Q +VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMG+  + DQEGIIP +C  LF      K+++S+    + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPLLGPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D + + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K + FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELKEEV +L+++L  +     IE+   ++G+     +    S +   S +        +++ IE+L+ +EK+IAELNETWE+KL++TE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG TKVG+      ++ DI LSG  I   HC F+     +GE  V L     AE YVNGKR+   T L+S +R+I GK+HVFRFN+P  A++ RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q++KE+EEA  + E+Q+ +YE K++ L++QV    + S ++    +E      W++ + +LA WAF KW+ +Q+TSLRD              LW N +FLKEANA+S EL KKV   F LLT+T YS        +       S+A + E +                                +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   AE+    P   +     ++TGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I
Sbjct:    4 ASVKVAVRVRPFNSREIGKESKCIIQMSGNTTTILNPKQPKENKSFNFDFSYWSHTTPEDLNYASQMQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGR-QEKDQEGIIPLMCEDLF-----TKINDSNNDNNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKKYDMETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDSAPNKNKKKKKVESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKEEVARLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAASISNLHDRIYSPASEETIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITKVGRENA--KTRQDIVLSGHFIRDEHCTFSSTTGPQGEGCVILEPCEGAETYVNGKRVTSPTVLRSGNRIIMGKSHVFRFNDPEQARLERERTPCAETPVEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRKEREEASNLLEQQRLDYESKLEALQKQVDSRYLESPEEEEEPEEE---VPWTKHETELALWAFRKWRFYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVC--FVLLTDTLYS-------PLPPDLLPPSVAKERERRP-----------------------------FPQTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEL----PSSAVEECDPAMTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAI 887          

HSP 2 Score: 283.878 bits (725), Expect = 1.114e-76
Identity = 173/427 (40.52%), Postives = 236/427 (55.27%), Query Frame = 2
Query: 3239 LKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKL 4501
            LK+G TF FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN  V VT++F++YIK   I FE+F H  ++P   L   L + L+ S+R         PL  PVP+ K         G    +YDL+V+FEI EL ANG+Y+   VDH    PCHG F++HQ +QRR  VTI HE   D    E   L+         GR+R+ PE  +      +LSLN+L + Y     D+       + W   LH              + L+   +L  EN          FC+V   RD++L   R  +N+        F     +  + NRVTG+Y++ L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK RH LLLREKL
Sbjct:  988 LKIGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNITVEVTKSFMEYIKTQPIVFEVFGHYQKQPFPPLCKDLISPLRPSRRQ---FPRVMPLSKPVPATKLNTMTRSTAGPCHAKYDLMVFFEICELEANGDYIPAVVDHRGGMPCHGTFLLHQGIQRRIRVTIAHETGNDIEWKEVKELVI--------GRIRNTPEADETIIDPNILSLNILSSGYFWPKHDDN-----HSIWREDLHHP------------LCLSGGTHLHWEN----------FCVVFYSRDAKLPASRSIRNL--------FSTGCLRPSESNRVTGVYEVTLCYVADNGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHYLLLREKL 1368          

HSP 3 Score: 75.0998 bits (183), Expect = 7.787e-13
Identity = 56/133 (42.11%), Postives = 81/133 (60.90%), Query Frame = 2
Query: 5087 IRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIR 5485
            I  SP++S+KGYL+ LE    + WV+R+VVVRRP++Y+Y  E+D VER +INL++A+++Y+                     + T  R+    + F++   HR  L+Q   D  KE+HDWLYAFNPLLAG IR
Sbjct: 1523 IICSPIVSKKGYLHFLEPHT-SGWVRRYVVVRRPYVYLYRSERDSVERAVINLSSAKVEYS-------------------EDKQTLLRTP---NTFAVCTEHRGILLQASND--KEMHDWLYAFNPLLAGTIR 1630          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Medaka
Match: kif1aa (kinesin-like protein KIF1A [Source:NCBI gene;Acc:101166041])

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 565/1426 (39.62%), Postives = 795/1426 (55.75%), Query Frame = 2
Query: 1379 VIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKSL---LTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDER---------IMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDK--DSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDS---HLFND-----------EGSMMT------NSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRR 5506
             IE+L+ +EK+IAELNETWE+KL+KTE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+  +  S   DI LSG  I   HC F       GE V L     AE YVNGKR+ E T L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA+ + E+Q+ +YE K++ L++QV +    ++++    +E  +   W+ER+ +LA W+F KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D                PE  Q+ +                         H  +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   A+    VP+        ++TGGDPFYDRFPWF+LVGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ F+D  Y  F  +S    L+R  TG+S +     + +  + +  P   +A++  +N        N        + +     L++G  F FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++FVDYIK   + FE+F H  ++P + L   + + L+  +R         PL  PVP+ K +    P  G    +YDL+V+FEI EL A GEY+   VDH    PCHG F++HQ LQRR +VTIVHE     G+ E     +  VRE+VVGR+R+ PE  +      +LSLN+L A Y+  + D+R           +RFEAAWDSS+H S LLN +T   E I++T+S YL++ENC +P  +TKD C+V   RD++LS  R  +N+F   S         +  D NRVTG+Y++ L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK +H LLL                     RE+++                                T+  G   + CG+++   +S    E D  A+        +I  E   R++ L ++C+ L+T S   +     +   +   SEM   SV+M+ DS   +  N            +GS +T        RP   +    +   +     S  K  + R V +  EIR+SP++S+KGYL+ LE +    WVKR+V VRRP++YIY  E+D VER I+NL++AQ++Y+                 +  A    P +      F++   HR  L+Q    + KE+HDWLYAFNPLLAG IRSKL RRR
Sbjct:  447 AIERLKETEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGMTRVGR--LDASKHQDIGLSGHFIQDEHCTFTSSTGPTGETVVLEPCEGAETYVNGKRVTEPTVLRSGNRIILGKSHVFRFNHPAQARAERERTPCAETPSEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEANNLLEQQRLDYESKLEALQKQVDRCHPEASEEDEEAEEEVQ---WTERERELAEWSFRKWKGYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDF-------------LPPEATQDREK-----------------------MHFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAD----VPNTATEECENAMTGGDPFYDRFPWFRLVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFEDQQYERFQSESCSAGLSR--TGISQEELRIVEGEGQNAEVGP---SADEVNNNTAGTDELENPLKACLDGASEATLEHLRIGNVFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFVDYIKTQPVVFEVFGHYQKQPFLPLCKDVMSPLRPCRRQ---FPQVMPLSKPVPATKLKAMARPQAGPCHCKYDLMVFFEICELEATGEYIPAVVDHRGGMPCHGTFLLHQGLQRRVAVTIVHE---SGGDVE-----WRDVRELVVGRLRNTPEADETIMDPNILSLNILSAGYVKPLLDDRQFLDSDMPRTFYRFEAAWDSSMHNSLLLNRVTPYGEKIYMTLSAYLEMENCTQPAVLTKDICMVFYSRDTKLSATRSIRNLFGTGS--------LRAADGNRVTGVYEVSLCYLADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQDVEKTKHYLLL---------------------REKLE-------------------------------STLLMGQESLQCGTSEDLCESPKPCEVDQEASC-----SSEITTE---RQRELAAKCLRLLTHSFNREYSHVCVSASESKISEM---SVTMLKDSPSTYALNTITPSSTCPSLVDGSYITADLRLPRPRPRADTQQEAAEAKAPVNGASDAKPATRRFVPDIQEIRVSPIVSKKGYLHFLEPNT-NGWVKRFVTVRRPYVYIYNSERDTVERAILNLSSAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQAA--NEKEMHDWLYAFNPLLAGTIRSKLSRRR 1685          

HSP 2 Score: 511.916 bits (1317), Expect = 3.426e-151
Identity = 262/369 (71.00%), Postives = 301/369 (81.57%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTD-FIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPN 1204
            +SVKVAVRVRPFN REI +++KCII M G+TT I  P   +  KSF FDYSY S   P D N+ +Q +VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMGK    DQ+GIIP LC  LF+++ D   DNS     + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPL+GPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D + + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K + FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN
Sbjct:    4 ASVKVAVRVRPFNSREIGKESKCIIQMTGNTTTISHPKQAKDVKSFNFDYSYWSHTSPEDVNYASQMQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQDVKDQQGIIPLLCEDLFRKISD-NTDNS-----MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKAESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPN 366          
BLAST of Kinesin-like protein KIF1A vs. Ensembl Medaka
Match: kif1aa (kinesin-like protein KIF1A [Source:NCBI gene;Acc:101166041])

HSP 1 Score: 906.36 bits (2341), Expect = 0.000e+0
Identity = 498/916 (54.37%), Postives = 633/916 (69.10%), Query Frame = 2
Query:  104 SSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSY-SSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTD-FIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXN----IEVGEGLSGI-----PEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCE----GEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVF 2806
            +SVKVAVRVRPFN REI +++KCII M G+TT I  P   +  KSF FDYSY S   P D N+ +Q +VY D+GE+ L HA EGYNVCI AYGQTGAGKSY+MMGK    DQ+GIIP LC  LF+++ D   DNS     + +++EVSYMEIYCERVRDLLNPKNK NLRVREHPL+GPYVEDLSK  V S+ DI +L+D+GNK+RTVAATNMNETSSRSHAVF II +Q+  D + + T EKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAE+ S     KKK+K + FIP+RDSVLTWLLRENLGGNS+TAM+ A+SPADINY+ETLS+LRYADRAKQI C AVINEDPN RLVRELK+EV +L+++L  +     IE+   ++G+           R     S+    +    +++ IE+L+ +EK+IAELNETWE+KL+KTE +R +R++ LAE+G+ ++ DGG  GVFS KK P+LVNLNED LM+ECL+YY+KDG T+VG+  +  S   DI LSG  I   HC F       GE V L     AE YVNGKR+ E T L+S +R+I GK+HVFRFN+P  A+  RE+    E P E +DW FA  ELLEKQG+D+++EME RL  LE+Q+++E+EEA+ + E+Q+ +YE K++ L++QV +    ++++    +E  +   W+ER+ +LA W+F KWK +Q+TSLRD              LW N +FLKEANA+S EL KKV FQF LLT+T YSP+  D                PE  Q+ +                         H  +T + +EV+D KNGA HYW L K R+RLDL+RE+Y   A+    VP+        ++TGGDPFYDRFPWF+LVGR+ +F
Sbjct:    4 ASVKVAVRVRPFNSREIGKESKCIIQMTGNTTTISHPKQAKDVKSFNFDYSYWSHTSPEDVNYASQMQVYKDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQDVKDQQGIIPLLCEDLFRKISD-NTDNS-----MSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLMGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETDNTSEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKAESFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVINEDPNNRLVRELKDEVSRLKDLLYAQGLGDIIEMTNAMTGMSPSPSLSALSSRAGSIASLHDRIMFSPGSEEAIERLKETEKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAMREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGMTRVGR--LDASKHQDIGLSGHFIQDEHCTFTSSTGPTGETVVLEPCEGAETYVNGKRVTEPTVLRSGNRIILGKSHVFRFNHPAQARAERERTPCAETPSEPVDWAFAQRELLEKQGIDMKQEMEQRLQELEDQYRREREEANNLLEQQRLDYESKLEALQKQVDRCHPEASEEDEEAEEEVQ---WTERERELAEWSFRKWKGYQFTSLRDL-------------LWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPPDF-------------LPPEATQDREK-----------------------MHFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAD----VPNTATEECENAMTGGDPFYDRFPWFRLVGRNPIF 855          

HSP 2 Score: 526.168 bits (1354), Expect = 1.310e-155
Identity = 359/970 (37.01%), Postives = 511/970 (52.68%), Query Frame = 2
Query: 2735 SVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTY--FLQKSL---LTRNSTGLSDK----TDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSH--QEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDER---------IMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRR-KNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQIL---SRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDK--DSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDS---HLFND-----------EGSMMT------NSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRR 5506
            S  G DPFYDR P F +VGR+FV+LSNLLY VPL+HRVA+V+EKGEVKG LRVA+Q I   E                 +  D  S    S   ++ F+D  Y  F  +S    L+R  TG+S +     + +  + +  P   +A++  +N        N        + +     L++G  F FRVT+LQ S +S++Y D FCQ++F+++ ++ +STEPLKN G+  P+GFYHVQN AV VT++FVDYIK   + FE+F H  ++P + L   + + L+  +R         PL  PVP+ K +    P  G    +YDL+V+FEI EL A GEY+   VDH    PCHG F++HQ LQRR +VTIVHE     G+ E     +  VRE+VVGR+R+ PE  +      +LSLN+L A Y+  + D+R           +RFEAAWDSS+H S LLN +T   E I++T+S YL++ENC +P  +TKD C+V   RD++LS  R  +N+F   S         +  D NRVTG+Y++ L  +    S    RR +R  + +  YVRGEEN+ GWRPRSDSLILDHQW+LEKL+ LQ VEK +H LLL                     RE+++                                T+  G   + CG+++   +S    E D  A+        +I  E   R++ L ++C+ L+T S   +     +   +   SEM   SV+M+ DS   +  N            +GS +T        RP   +    +   +     S  K  + R V +  EIR+SP++S+KGYL+ LE +    WVKR+V VRRP++YIY  E+D VER I+NL++AQ++Y+                 +  A    P +      F++   HR  L+Q    + KE+HDWLYAFNPLLAG IRSKL RRR
Sbjct:  931 SSEGQDPFYDRSPLFSVVGRAFVYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADE-----------------EAPDYGSGVRQSGTAKISFEDQQYERFQSESCSAGLSR--TGISQEELRIVEGEGQNAEVGP---SADEVNNNTAGTDELENPLKACLDGASEATLEHLRIGNVFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFSTEPLKNTGRGPPLGFYHVQNIAVEVTKSFVDYIKTQPVVFEVFGHYQKQPFLPLCKDVMSPLRPCRRQ---FPQVMPLSKPVPATKLKAMARPQAGPCHCKYDLMVFFEICELEATGEYIPAVVDHRGGMPCHGTFLLHQGLQRRVAVTIVHE---SGGDVE-----WRDVRELVVGRLRNTPEADETIMDPNILSLNILSAGYVKPLLDDRQFLDSDMPRTFYRFEAAWDSSMHNSLLLNRVTPYGEKIYMTLSAYLEMENCTQPAVLTKDICMVFYSRDTKLSATRSIRNLFGTGS--------LRAADGNRVTGVYEVSLCYLADAGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQDVEKTKHYLLL---------------------REKLE-------------------------------STLLMGQESLQCGTSEDLCESPKPCEVDQEASC-----SSEITTE---RQRELAAKCLRLLTHSFNREYSHVCVSASESKISEM---SVTMLKDSPSTYALNTITPSSTCPSLVDGSYITADLRLPRPRPRADTQQEAAEAKAPVNGASDAKPATRRFVPDIQEIRVSPIVSKKGYLHFLEPNT-NGWVKRFVTVRRPYVYIYNSERDTVERAILNLSSAQVEYSE----------------DQQAMLKTPNT------FAVCTEHRGILLQAA--NEKEMHDWLYAFNPLLAGTIRSKLSRRR 1771          
BLAST of Kinesin-like protein KIF1A vs. Planmine SMEST
Match: SMESG000071414.1 (SMESG000071414.1)

HSP 1 Score: 3422.48 bits (8873), Expect = 0.000e+0
Identity = 1812/1820 (99.56%), Postives = 1812/1820 (99.56%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 5560
            MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPR        SLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK
Sbjct:    1 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPR--------SLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 1812          
BLAST of Kinesin-like protein KIF1A vs. Planmine SMEST
Match: SMESG000071414.1 (SMESG000071414.1)

HSP 1 Score: 3392.82 bits (8796), Expect = 0.000e+0
Identity = 1798/1806 (99.56%), Postives = 1798/1806 (99.56%), Query Frame = 2
Query:  143 MREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 5560
            MREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPR        SLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK
Sbjct:    1 MREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPR--------SLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 1798          
BLAST of Kinesin-like protein KIF1A vs. Planmine SMEST
Match: SMESG000071414.1 (SMESG000071414.1)

HSP 1 Score: 3382.81 bits (8770), Expect = 0.000e+0
Identity = 1799/1820 (98.85%), Postives = 1799/1820 (98.85%), Query Frame = 2
Query:  101 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 5560
            MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRD             DLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPR        SLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK
Sbjct:    1 MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRD-------------DLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPR--------SLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 1799          
BLAST of Kinesin-like protein KIF1A vs. Planmine SMEST
Match: SMESG000071414.1 (SMESG000071414.1)

HSP 1 Score: 3380.5 bits (8764), Expect = 0.000e+0
Identity = 1793/1793 (100.00%), Postives = 1793/1793 (100.00%), Query Frame = 2
Query:  182 MEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 5560
            MEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIFSLRSLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK
Sbjct:    1 MEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIFSLRSLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 1793          
BLAST of Kinesin-like protein KIF1A vs. Planmine SMEST
Match: SMESG000071414.1 (SMESG000071414.1)

HSP 1 Score: 3367.79 bits (8731), Expect = 0.000e+0
Identity = 1785/1793 (99.55%), Postives = 1785/1793 (99.55%), Query Frame = 2
Query:  182 MEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTXXXXXXXXXXXXXXXXXXXXNIEVGEGLSGIPEISVIRECRXXXXXXXXXXXXXXXXVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKXXXXXXXXXXXXLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEXXXXXXXXXXXXXXXXXQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKXXXXXXXXXXXXXXXXXXXXXXXXTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSXXXXXXXXXXXXPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPRRKNIXXXXXXXXXXXXXCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKXXXXXXXXXXXXCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGXXXXXXXXXXXXNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 5560
            MEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPR        SLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK
Sbjct:    1 MEGSTTNIFKPSSKEPPKSFIFDYSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKSYSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYMEIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELIDAGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKKKRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRYADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGIPEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQKTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAECLVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTAIGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTVEEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKIFEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLAAWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELNKKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSDSSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRERLDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSFVFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSPPPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTDNDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLGQTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPIGFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSSKRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSANGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSSLLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMFRFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFCLVVCPRDSQLSIPR--------SLRSFLGSFCKTQDINRVTGIYDLQLKQILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTKLQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRNNCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMATSLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKSEMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWKNNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYIYAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPRSSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGRRRKSVKNNSIDVNQESDAVK 1785          
The following BLAST results are available for this feature:
BLAST of Kinesin-like protein KIF1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF1A3.111e-2748.84kinesin family member 1A [Source:HGNC Symbol;Acc:H... [more]
KIF1A3.111e-2748.84kinesin family member 1A [Source:HGNC Symbol;Acc:H... [more]
KIF1A2.939e-2748.58kinesin family member 1A [Source:HGNC Symbol;Acc:H... [more]
KIF1A2.990e-2748.55kinesin family member 1A [Source:HGNC Symbol;Acc:H... [more]
KIF1A4.153e-2747.69kinesin family member 1A [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1045.832e-8451.64Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1045.832e-8451.64Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1044.073e-8549.30Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
unc-1044.073e-8549.30Kinesin-like protein unc-104 [Source:UniProtKB/Sw... [more]
klp-42.834e-14034.25Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1042.661e-3248.43gene:FBgn0267002 transcript:FBtr0304680[more]
unc-1042.641e-3248.40gene:FBgn0267002 transcript:FBtr0113089[more]
unc-1042.617e-3148.40gene:FBgn0267002 transcript:FBtr0304679[more]
unc-1042.363e-3148.69gene:FBgn0267002 transcript:FBtr0330003[more]
unc-1042.562e-3248.69gene:FBgn0267002 transcript:FBtr0113088[more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1aa0.000e+045.16kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
kif1aa0.000e+045.11kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
kif1b6.416e-12257.90kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif1b5.088e-12257.90kinesin family member 1B [Source:ZFIN;Acc:ZDB-GENE... [more]
kif1ab1.125e-12249.42kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nos1ap3.278e-2848.54nitric oxide synthase 1 adaptor protein [Source:Xe... [more]
KIF1B1.492e-2848.81kinesin family member 1B [Source:NCBI gene;Acc:100... [more]
nos1ap2.941e-2848.38nitric oxide synthase 1 adaptor protein [Source:Xe... [more]
nos1ap2.527e-2848.26nitric oxide synthase 1 adaptor protein [Source:Xe... [more]
nos1ap2.998e-2848.10nitric oxide synthase 1 adaptor protein [Source:Xe... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif1a2.246e-2748.77kinesin family member 1A [Source:MGI Symbol;Acc:MG... [more]
Kif1a2.329e-2748.58kinesin family member 1A [Source:MGI Symbol;Acc:MG... [more]
Kif1a2.214e-2748.48kinesin family member 1A [Source:MGI Symbol;Acc:MG... [more]
Kif1b6.615e-12253.63kinesin family member 1B [Source:MGI Symbol;Acc:MG... [more]
Kif1a1.607e-15943.30kinesin family member 1A [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12756|KIF1A_HUMAN1.494e-2648.84Kinesin-like protein KIF1A OS=Homo sapiens OX=9606... [more]
sp|A1ZAJ2|KIF1A_DROME2.569e-3148.69Kinesin-like protein unc-104 OS=Drosophila melanog... [more]
sp|P33173|KIF1A_MOUSE1.587e-2648.52Kinesin-like protein KIF1A OS=Mus musculus OX=1009... [more]
sp|Q28WQ1|KIF1A_DROPS1.432e-9055.81Kinesin-like protein unc-104 OS=Drosophila pseudoo... [more]
sp|Q17BU3|KIF1A_AEDAE7.820e-9956.20Kinesin-like protein unc-104 OS=Aedes aegypti OX=7... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UUT00.000e+048.46Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A0L8FXM50.000e+047.44Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8FYA30.000e+047.14Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A0L8FX890.000e+047.40Uncharacterized protein OS=Octopus bimaculoides OX... [more]
B6RJZ40.000e+047.29Kinesin-3 OS=Doryteuthis pealeii OX=1051067 PE=2 S... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1aa0.000e+045.15kinesin family member 1Aa [Source:ZFIN;Acc:ZDB-GEN... [more]
kif1ab6.868e-2549.20kinesin family member 1Ab [Source:ZFIN;Acc:ZDB-GEN... [more]
kif1b7.858e-14058.33kinesin family member 1B [Source:NCBI gene;Acc:103... [more]
kif1b0.000e+060.44kinesin family member 1B [Source:NCBI gene;Acc:103... [more]
KIF1C0.000e+055.21kinesin-like protein KIF1C [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif16bb6.337e-13840.70kinesin family member 16Bb [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000009202.12.959e-10538.67pep scaffold:Pmarinus_7.0:GL476573:157904:241529:1... [more]
ENSPMAT00000009206.11.100e-10240.03pep scaffold:Pmarinus_7.0:GL476573:157919:195746:1... [more]
ENSPMAT00000005274.14.629e-9654.43pep scaffold:Pmarinus_7.0:GL482849:195:11973:-1 ge... [more]
ENSPMAT00000005277.12.290e-8951.64pep scaffold:Pmarinus_7.0:GL482849:207:11964:-1 ge... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP37.036e-5440.06Kinesin-related antiparallel sliding motor protein... [more]
KIP15.224e-4634.42Kinesin-related motor protein; required for mitoti... [more]
KAR31.707e-4234.04Minus-end-directed microtubule motor; functions in... [more]
CIN84.367e-3445.11Kinesin motor protein; involved in mitotic spindle... [more]
KIP25.251e-3231.07Kinesin-related motor protein involved in mitotic ... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO385918.056e-15138.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337401.985e-14644.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293923.327e-12440.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356132.753e-11440.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337242.222e-11256.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif1ab2.908e-10054.74kinesin-like protein KIF1A [Source:NCBI gene;Acc:1... [more]
kif1ab4.728e-9954.74kinesin-like protein KIF1A [Source:NCBI gene;Acc:1... [more]
kif1ab1.114e-7654.42kinesin-like protein KIF1A [Source:NCBI gene;Acc:1... [more]
kif1aa3.426e-15139.62kinesin-like protein KIF1A [Source:NCBI gene;Acc:1... [more]
kif1aa1.310e-15554.37kinesin-like protein KIF1A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Kinesin-like protein KIF1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071414.10.000e+099.56SMESG000071414.1[more]
SMESG000071414.10.000e+099.56SMESG000071414.1[more]
SMESG000071414.10.000e+098.85SMESG000071414.1[more]
SMESG000071414.10.000e+0100.00SMESG000071414.1[more]
SMESG000071414.10.000e+099.55SMESG000071414.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017722 ID=SMED30017722|Name=Kinesin-like protein KIF1A|organism=Schmidtea mediterranea sexual|type=transcript|length=5846bp
TAAATATTAGTTATTTAAAGCTGAAATTTAATATAATTTTGCCAAAAATT
TGAAATGAGATTGTTTCCCTAAATACTTTATAAAACCTAAAAAGCTATTA
ATGTCGTCGGTTAAAGTTGCTGTTCGTGTTCGCCCATTTAATATGCGTGA
AATATCACGCGATGCCAAATGTATAATCTCCATGGAAGGATCAACTACAA
ATATATTTAAACCATCTAGCAAGGAGCCTCCGAAAAGTTTCATATTTGAT
TATAGCTATTCGTCTATTTGTCCGACCGATTCTAATTTTGTAAATCAACA
AGAAGTTTATCATGATCTTGGAGAAGATTCTTTGGAGCATGCTTTAGAAG
GCTATAACGTATGTATATTGGCATACGGACAAACTGGTGCTGGAAAGTCG
TATAGTATGATGGGAAAACCTGGAGATTTCGATCAAGAAGGAATTATTCC
TCAACTATGTCGGTCTCTTTTCAAAAGACTGGACGATATCAAACTAGATA
ACTCTGATGAAACCGCATGGATTCAACATACACTAGAAGTGTCATACATG
GAGATATACTGTGAACGAGTTAGAGATTTATTAAATCCAAAAAATAAAAA
TAACCTCAGAGTGCGAGAACATCCTTTATTAGGACCATATGTTGAAGATC
TTTCCAAATCTATTGTAAGATCTTTTCAAGACATAAATGAGCTAATAGAT
GCAGGCAACAAATCGAGGACTGTCGCAGCAACAAATATGAATGAGACGAG
CAGCAGATCTCATGCTGTCTTCACTATTATTCTAAGTCAGAGAATTTTGG
ATGAGGATGGAGAATTGACTGGAGAAAAGGTCAGTAAGATCTCATTAGTA
GATTTAGCTGGCAGTGAAAGAGCTGATTCGACAGGTGCCAAAGGTACTCG
GTTGAAAGAAGGGGCTAATATTAATAAAAGTCTCACAACTCTTGGGAAAG
TGATTTCTGCCCTAGCGGAGCTGAGCAGCATGGACAAGTCGACTAAGAAG
AAAAGAAAAACCGACTTCATTCCATTTCGAGATTCAGTTTTAACTTGGCT
TCTCAGAGAGAATTTAGGGGGAAATTCAAAAACTGCTATGCTTGTTGCTA
TTAGTCCAGCAGATATTAATTATGAGGAGACTTTGAGTTCACTCCGATAC
GCAGATCGAGCTAAGCAAATTGTATGTAAAGCCGTGATCAATGAAGATCC
TAACACACGATTGGTGAGGGAGCTGAAAGAAGAAGTTCTGAAGTTGCGTG
AAATCCTAAAATTGGAAAACATTGAAGTCGGAGAAGGTCTGTCTGGAATA
CCAGAAATCAGTGTGATTCGTGAATGTCGCTCTAATAGCATGATATCATC
ACAAATAATTATCCAAGACAATCAAGATGTCATTGAGAAATTGCGAGCAT
CCGAAAAGCTTATCGCAGAACTCAACGAAACATGGGAAGACAAATTACAA
AAAACTGAAGATCTAAGAAAACAAAGAGACTCAGAGCTTGCAGAACTGGG
AATCACAATTAAAACGGATGGGGGTGCTTTCGGAGTTTTTTCATCCAAAA
AAAGACCAAATCTTGTTAATCTCAATGAGGATGCATTAATGGCCGAATGC
TTAGTGTATTATTTGAAAGACGGGGAAACCAAGGTCGGTCAACCAGAAAT
TGTGAATTCTTCTAAAATGGACATACATTTGAGTGGAGATTGCATTATGC
CAATGCATTGTGTCTTCAATTGTGAAGGAGAACATGTCACTCTGACTGCA
ATCGGAGACGCAGAATGCTATGTTAACGGAAAACGGATACATGAATCAAC
TTCATTGAAATCCTCAGATCGTTTAATTTTTGGCAAAAATCACGTTTTCA
GGTTCAACAATCCATTAACTGCACAAATATCGCGAGAAAAGAAAACAGTG
GAAGAATTTCCATGTGAATCGTTGGATTGGAATTTTGCAACAGCTGAACT
GCTCGAGAAACAAGGGGTCGATTTGAGAAAAGAAATGGAGACCAGATTGG
TGATGCTTGAGGAACAGTTTAAAAAAGAAAAAGAAGAAGCAGATAAAATA
TTTGAGAAACAGAAACAAGAATATGAAATCAAAATCCAAACGTTGGAACA
GCAAGTGGTGAAAGCCTCGATGATATCTGCCGATGATTACCTATCTGACG
ATGAAAATTATGAACCAACAGCTTGGTCCGAACGGCAATATCAGCTAGCC
GCATGGGCATTCAATAAATGGAAGCACCACCAATACACGAGTTTACGAGA
TTTCAGTATCAGTATCCAGCCGGCTTGGCAGATCAAGGACGACTTGTGGG
CTAACACGGTATTCCTGAAAGAAGCCAATGCCATGAGTCAAGAATTAAAC
AAAAAGGTAGTATTTCAATTTGCCTTATTAACGGAGACCCCATACAGTCC
TATAACGGCAGATATCGACACTATGGAAATGTCAACATCTAATATCAGCA
TTGCTACCCAGCCTGAAATCAAACAGAATCTCGACATGAATAAATCTGAT
AGTTCAGTAGTCATGGCCAGTTCAAACAGTTTGGCTACCATGGCAAATAG
CATTGGTAGTCATGGAAACAAAACAAAACTCGTTATTGAAGTTCGAGACA
TGAAAAATGGAGCCAATCATTATTGGGGCTTACCAAAGTTTAGAGAAAGA
TTAGATTTAATTCGAGAACTCTATCAAAATGAAGCGGAAATGTTTGAGGC
TGTGCCTGATTGTATGATCAACTCACAAATTGAATCCGTCACTGGAGGTG
ATCCGTTCTATGATAGGTTTCCATGGTTTCAATTAGTTGGGAGATCTTTC
GTGTTTTTATCTAATCTACTTTACAATGTGCCACTTATCCATCGAGTAGC
AGTTGTCAATGAGAAAGGAGAGGTGAAAGGGTTATTGAGAGTAGCAATAC
AACCAATTGGTAACATTGAACCTTCTTCTCTGCTGCTGCCATTGTCTCCT
CCACCAATAAGTCCATCAATTCAAAAACTGGATATTGATTCCAAAAACTA
CCATTCTGCTCTTACACAATTGGAATTCGATGATGACACTTACTTTCTTC
AAAAATCTCTATTGACTAGAAATTCTACCGGGTTGTCGGACAAAACAGAT
AATGATTCTGTAGATGTAGATCGTACACCTCGAAAATCAACCGCGGAAAA
AAGGAAAGATAATAATAATTCGGCATTCTTTGCTAATAATGATGGCCACG
ATTCATCTGGCGATTCTGGTGACTACGATACGGGACTTTTGAAGCTCGGT
CAAACATTCTGTTTCCGAGTGACAATCCTTCAAGTGTCTGGATTATCCTC
TGATTATACAGATACATTCTGCCAATATAGTTTCCTCAACAAGCCCAATG
ATTGTTACTCTACGGAACCGTTGAAAAATATCGGAAAAACGACTCCAATT
GGATTTTATCATGTACAGAATTTTGCAGTGGTGGTAACGCGTGCATTTGT
TGATTATATCAAAAATTATGCCATCAGATTCGAGTTATTTTCCCATCAAG
AACCTCGCATAAATCTCGAGCCTTATCTTGATACCGAATTGCAGTCGAGC
AAACGGGCCAAATCCTTTCTGCACACAAATCAGCCCCTCCCTACTCCGGT
CCCATCTCAAAAGGAAGAAATATACAATAATCCTTTGGAGGGTACAATTT
TGCATCGATATGATTTGTTGGTTTGGTTTGAAATTTTGGAATTATCAGCC
AATGGAGAGTATGTTTCTGTACCGGTTGATCATTCTCATAATGCACCATG
TCATGGAGTATTTATGATTCATCAAGCATTACAGAGAAGATTTTCTGTCA
CAATTGTCCATGAGCCGATCACAGACAATGGAGAAGCAGAAAATTCCTCT
CTTTTGTTTCATAGTGTTCGTGAGGTCGTTGTTGGCAGGGTTCGTGACAG
GCCTGAATATCTTGATTTGGATGATTATTCCAAAGTTCTTTCACTAAACT
TATTACCGGCTCATTATATATCTAATGTCGGTGATGAACGAATAATGTTT
CGATTTGAGGCTGCTTGGGACAGCAGCTTACACGAGTCCAACCTCCTCAA
TACTATCACAGAAAACAATGAGCACATATTTTTAACAATGTCTTGCTATC
TGGATGTTGAGAACTGTATAAAACCAGTATGTATTACGAAGGATTTCTGT
CTTGTTGTCTGTCCGAGAGACAGTCAACTGTCTATTCCCAGAAGAAAAAA
CATCTTTTCTCTCAGATCTCTTCGATCGTTTCTTGGTAGCTTTTGTAAGA
CTCAAGATATCAATAGAGTCACTGGAATATATGATTTACAATTGAAGCAA
ATATTAAGTAGAGCTAACCATCGGAGAACTAAACGATATCAAGAATATAA
CTCAATTTATGTTCGGGGTGAAGAAAATATCCGAGGCTGGAGGCCACGAA
GTGATTCTTTAATTTTGGATCATCAGTGGCAACTAGAAAAATTAACCAAG
CTCCAAATGGTCGAGAAGGTGCGGCATATCTTGCTGCTCAGAGAAAAGTT
ATCAGAAGCCGGCCGATATGATGAAATCAAACAACTTGACAAAGAAGCGA
GACGCGAACAAATCAAACAAAATCGTGCACAGCGAAATTTGCTGCGAAAC
AACTGTACAATGATGATAGAAAAGTATACAAATTCAAAATCCAGCAGTTT
AAATCAACTGGATACCATGAATTTCGGTGATAGTGGGGTGGTTTGTGGCT
CGAATGACAAGGATTCCGGCACGACTGGTGAGGATGATTTAATGGCAACG
AGCCTTATCATGCCTGGCGATGAAGATATCTTGAATGAAGAAGGAGGCAG
GGAAAAATTGTTGACTTCTCGTTGTGTTGAACTGATGACTGTGTCAAATA
AATCACAAACGTATCAGTCATCTATGGGAAAAGAAGATATGTTTAAATCT
GAAATGCTTGACAGCAGTGTATCAATGATCAACGATAGCCATCTCTTTAA
TGATGAAGGCTCCATGATGACCAATTCTAGACCAATGACTACATCGTTGA
TGACAGAATCCATCATGAGTTCCGAAGATGGTTGTCGATCAGCTTGGAAA
AATAATTCTCCACGACTTGTCGGGGAATGTGATGAAATACGAATCAGTCC
TGTTATTAGCAGAAAAGGTTATTTAAACTTATTAGAAGAAAGTAAACCTG
CCAATTGGGTTAAAAGATGGGTTGTTGTACGAAGACCATTTTTATACATA
TATGCACACGAAAAAGATCCAGTTGAAAGGGGAATAATAAATCTTGCTAC
AGCCCAAATTCAATACACTGGTTCATTGGAATTATTATCCCAGTCTGTTG
TGGAATCCAATAAGGCTGTTAATGGATCGGCACGCTATACTGCCCCACGA
TCTAGCATTAGTTGCTCAATGTTTTCGTTGGTGTTCCCTCATAGAACATG
GCTGATACAAACGATCATTGATGATCCTAAAGAAGTACATGACTGGCTCT
ATGCATTTAATCCATTATTAGCTGGTCAAATCAGATCAAAATTGGGTCGT
CGTCGGAAATCTGTAAAGAATAACAGTATTGATGTCAATCAGGAATCTGA
CGCTGTTAAATGAACCTTTCAATTTTAAGAGTTTTATTGCATTATTATTA
CATATATAGCTAATATTTATTCTGTCGAGATATTTGCCGAATTTTTGAGA
AACAATACGTAACTGTTCTTTTATTTCATTAATTTTTCTTTTGAATATTC
AGCATAATGTCGTATATAATTTTATTTTTAATGTTATTGTCTCTCTTTGC
TATTGTGTATTCTCCGTGACTTGATGTGATCCGGCTGTCATTAGTCCTGA
GTGGAATTAGTGATTTGTTTACAGTAAATATTACCTTCACTTTGTT
back to top

protein sequence of SMED30017722-orf-1

>SMED30017722-orf-1 ID=SMED30017722-orf-1|Name=SMED30017722-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1821bp
MSSVKVAVRVRPFNMREISRDAKCIISMEGSTTNIFKPSSKEPPKSFIFD
YSYSSICPTDSNFVNQQEVYHDLGEDSLEHALEGYNVCILAYGQTGAGKS
YSMMGKPGDFDQEGIIPQLCRSLFKRLDDIKLDNSDETAWIQHTLEVSYM
EIYCERVRDLLNPKNKNNLRVREHPLLGPYVEDLSKSIVRSFQDINELID
AGNKSRTVAATNMNETSSRSHAVFTIILSQRILDEDGELTGEKVSKISLV
DLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAELSSMDKSTKK
KRKTDFIPFRDSVLTWLLRENLGGNSKTAMLVAISPADINYEETLSSLRY
ADRAKQIVCKAVINEDPNTRLVRELKEEVLKLREILKLENIEVGEGLSGI
PEISVIRECRSNSMISSQIIIQDNQDVIEKLRASEKLIAELNETWEDKLQ
KTEDLRKQRDSELAELGITIKTDGGAFGVFSSKKRPNLVNLNEDALMAEC
LVYYLKDGETKVGQPEIVNSSKMDIHLSGDCIMPMHCVFNCEGEHVTLTA
IGDAECYVNGKRIHESTSLKSSDRLIFGKNHVFRFNNPLTAQISREKKTV
EEFPCESLDWNFATAELLEKQGVDLRKEMETRLVMLEEQFKKEKEEADKI
FEKQKQEYEIKIQTLEQQVVKASMISADDYLSDDENYEPTAWSERQYQLA
AWAFNKWKHHQYTSLRDFSISIQPAWQIKDDLWANTVFLKEANAMSQELN
KKVVFQFALLTETPYSPITADIDTMEMSTSNISIATQPEIKQNLDMNKSD
SSVVMASSNSLATMANSIGSHGNKTKLVIEVRDMKNGANHYWGLPKFRER
LDLIRELYQNEAEMFEAVPDCMINSQIESVTGGDPFYDRFPWFQLVGRSF
VFLSNLLYNVPLIHRVAVVNEKGEVKGLLRVAIQPIGNIEPSSLLLPLSP
PPISPSIQKLDIDSKNYHSALTQLEFDDDTYFLQKSLLTRNSTGLSDKTD
NDSVDVDRTPRKSTAEKRKDNNNSAFFANNDGHDSSGDSGDYDTGLLKLG
QTFCFRVTILQVSGLSSDYTDTFCQYSFLNKPNDCYSTEPLKNIGKTTPI
GFYHVQNFAVVVTRAFVDYIKNYAIRFELFSHQEPRINLEPYLDTELQSS
KRAKSFLHTNQPLPTPVPSQKEEIYNNPLEGTILHRYDLLVWFEILELSA
NGEYVSVPVDHSHNAPCHGVFMIHQALQRRFSVTIVHEPITDNGEAENSS
LLFHSVREVVVGRVRDRPEYLDLDDYSKVLSLNLLPAHYISNVGDERIMF
RFEAAWDSSLHESNLLNTITENNEHIFLTMSCYLDVENCIKPVCITKDFC
LVVCPRDSQLSIPRRKNIFSLRSLRSFLGSFCKTQDINRVTGIYDLQLKQ
ILSRANHRRTKRYQEYNSIYVRGEENIRGWRPRSDSLILDHQWQLEKLTK
LQMVEKVRHILLLREKLSEAGRYDEIKQLDKEARREQIKQNRAQRNLLRN
NCTMMIEKYTNSKSSSLNQLDTMNFGDSGVVCGSNDKDSGTTGEDDLMAT
SLIMPGDEDILNEEGGREKLLTSRCVELMTVSNKSQTYQSSMGKEDMFKS
EMLDSSVSMINDSHLFNDEGSMMTNSRPMTTSLMTESIMSSEDGCRSAWK
NNSPRLVGECDEIRISPVISRKGYLNLLEESKPANWVKRWVVVRRPFLYI
YAHEKDPVERGIINLATAQIQYTGSLELLSQSVVESNKAVNGSARYTAPR
SSISCSMFSLVFPHRTWLIQTIIDDPKEVHDWLYAFNPLLAGQIRSKLGR
RRKSVKNNSIDVNQESDAVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR001849PH_domain
IPR011993PH-like_dom_sf
IPR022140Kinesin-like_KIF1-typ
IPR022164Kinesin-like
IPR000253FHA_dom
IPR032405Kinesin_assoc
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
IPR008984SMAD_FHA_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003777microtubule motor activity
GO:0008017microtubule binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1476..1496
NoneNo IPR availableCOILSCoilCoilcoord: 424..444
NoneNo IPR availableCOILSCoilCoilcoord: 372..392
NoneNo IPR availableCOILSCoilCoilcoord: 626..675
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 475..592
e-value: 1.4E-36
score: 127.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 997..1032
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1000..1019
NoneNo IPR availablePANTHERPTHR24115:SF328KINESIN-LIKE PROTEIN KIF1Bcoord: 415..771
coord: 882..937
NoneNo IPR availablePANTHERPTHR24115:SF328KINESIN-LIKE PROTEIN KIF1Bcoord: 825..890
NoneNo IPR availablePANTHERPTHR24115:SF328KINESIN-LIKE PROTEIN KIF1Bcoord: 4..398
NoneNo IPR availableCDDcd01365KISc_KIF1A_KIF1Bcoord: 2..364
e-value: 0.0
score: 571.219
NoneNo IPR availableCDDcd01233PH_KIFIA_KIFIBcoord: 1664..1791
e-value: 1.28879E-36
score: 131.947
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 1624..1787
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 84..105
score: 64.77
coord: 211..228
score: 62.41
coord: 246..264
score: 60.92
coord: 307..328
score: 59.89
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 1..365
e-value: 8.4E-166
score: 566.8
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 9..357
e-value: 2.8E-105
score: 351.9
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 3..357
score: 117.981
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 1669..1793
e-value: 2.8E-10
score: 50.2
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 1671..1788
e-value: 2.4E-6
score: 28.0
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 1668..1791
score: 10.328
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 1..368
e-value: 9.1E-147
score: 490.6
IPR022140Kinesin-like KIF1-typePFAMPF12423KIF1Bcoord: 847..897
e-value: 3.6E-9
score: 36.9
IPR022164Kinesin-likePFAMPF12473DUF3694coord: 1203..1357
e-value: 1.5E-32
score: 113.4
IPR032405Kinesin-associatedPFAMPF16183Kinesin_assoccoord: 361..389
e-value: 3.4E-7
score: 30.6
coord: 409..508
e-value: 3.8E-38
score: 131.4
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 1666..1802
e-value: 9.0E-13
score: 49.8
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 415..771
coord: 825..890
coord: 882..937
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 4..398
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 245..256
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 485..587
e-value: 7.40909E-10
score: 55.8554
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 486..587
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 2..367