SMED30017721

Overview
NameSMED30017721
Smed IDSMED30017721
Length (bp)1915
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30017721 (SMED30017721) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30017721 (SMED30017721) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30017721 (SMED30017721) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30017721 (SMED30017721) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017721

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30017721SMESG000037259.1 SmedASXL_010385SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30017721SMESG000037259.1 dd_Smed_v4_4831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017721SMESG000037259.1 dd_Smed_v4_4831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017721SMESG000037259.1 dd_Smed_v4_4831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017721SMESG000037259.1 dd_Smed_v4_4831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017721SMESG000037259.1 dd_Smed_v4_4831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017721SMESG000037259.1 dd_Smed_v4_4831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017721SMESG000037259.1 dd_Smed_v4_4831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017721SMESG000037259.1 dd_Smed_v4_4831_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017721SMESG000037259.1 Contig39272newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017721SMESG000037259.1 Contig39272uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30017721 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.013531:6138..8643 +9437
Homology
BLAST of SMED30017721 vs. TrEMBL
Match: A0A5K3EQA0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 5.255e-11
Identity = 60/139 (43.17%), Postives = 84/139 (60.43%), Query Frame = 1
Query:  721 TSGSSTADSNASNISEFDINRNPV----KKRRKPAPTIATGRRNLKNETVAPXXXXXXXXXXXXXXKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIET 1125
            T+ SS+A    S+IS   +    V    ++ RKPAPT+ATGRRNLK+E V P+EA+RR KRRERNRKSAQ+CRERK+ + + LQ ++  +N ++ + L   E     W++  R   E L  H   P  +V     LIE+
Sbjct:  259 TTTSSSATRGTSSISTTAVGSTTVAAQQRRPRKPAPTLATGRRNLKSEPVDPDEADRRMKRRERNRKSAQKCRERKLHRTQELQAQVEGLNMEASRLLREVE----GWRDHARRCVELLRQHC--PGVAVPYLSCLIES 391          
BLAST of SMED30017721 vs. TrEMBL
Match: A0A0X3Q732 (Transforming protein v-Fos/v-Fox OS=Schistocephalus solidus OX=70667 GN=FOSX PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.010e-9
Identity = 54/136 (39.71%), Postives = 83/136 (61.03%), Query Frame = 1
Query:  715 LHTSGSSTADSNASNISEFDINRNPVKKRRKPAPTIATGRRNLKNETVAPXXXXXXXXXXXXXXKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIE 1122
            + ++ +S   S+    +    NR   KK RKPAPT+ATGRRNLK+E V  +EA+RR KRRERNRKSAQ+CRERK+ + + LQ +++ +N ++ + L   E    +W+++ R   + L  H   P  ++     L+E
Sbjct:  312 IGSTAASIVSSDGETTTSSSANRG-SKKTRKPAPTLATGRRNLKSEPVDADEADRRLKRRERNRKSAQKCRERKLHRTQELQAQVDGLNAEANRLLREVE----SWRDQARRCVQLLQQHC--PGVAIPYLTCLVE 440          
BLAST of SMED30017721 vs. TrEMBL
Match: A0A068WS25 (Basic leucine zipper bZIP transcription factor OS=Echinococcus granulosus OX=6210 GN=EgrG_001177300 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.132e-9
Identity = 51/110 (46.36%), Postives = 71/110 (64.55%), Query Frame = 1
Query:  793 KKRRKPAPTIATGRRNLKNETVAPXXXXXXXXXXXXXXKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIE 1122
            K+ RKPAPT+ATGRRNLK+E V P+EA+RR KRRERNRKSAQ+CRERK+ + + LQ ++ S+N ++ + L   E     W++  R     L  H   P  S+     ++E
Sbjct:  290 KRPRKPAPTLATGRRNLKSEPVDPDEADRRMKRRERNRKSAQKCRERKLHRTQELQAQVESLNMETTRLLREVE----VWRDYCRKCVALL--HQHCPGVSIPVLNCVVE 393          
BLAST of SMED30017721 vs. TrEMBL
Match: A0A068XU88 (Basic leucine zipper bZIP transcription factor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001177300 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.156e-9
Identity = 51/110 (46.36%), Postives = 71/110 (64.55%), Query Frame = 1
Query:  793 KKRRKPAPTIATGRRNLKNETVAPXXXXXXXXXXXXXXKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIE 1122
            K+ RKPAPT+ATGRRNLK+E V P+EA+RR KRRERNRKSAQ+CRERK+ + + LQ ++ S+N ++ + L   E     W++  R     L  H   P  S+     ++E
Sbjct:  290 KRPRKPAPTLATGRRNLKSEPVDPDEADRRMKRRERNRKSAQKCRERKLHRTQELQAQVESLNMETTRLLREVE----VWRDYCRKCVALL--HQHCPGVSIPVLNCVVE 393          
BLAST of SMED30017721 vs. TrEMBL
Match: W6UKC3 (Transcription factor kayak, isoforms A/B/F OS=Echinococcus granulosus OX=6210 GN=EGR_03435 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.624e-9
Identity = 51/110 (46.36%), Postives = 71/110 (64.55%), Query Frame = 1
Query:  793 KKRRKPAPTIATGRRNLKNETVAPXXXXXXXXXXXXXXKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIE 1122
            K+ RKPAPT+ATGRRNLK+E V P+EA+RR KRRERNRKSAQ+CRERK+ + + LQ ++ S+N ++ + L   E     W++  R     L  H   P  S+     ++E
Sbjct:  290 KRPRKPAPTLATGRRNLKSEPVDPDEADRRMKRRERNRKSAQKCRERKLHRTQELQAQVESLNMETTRLLREVE----VWRDYCRKCVALL--HQHCPGVSIPVLNCVVE 393          
BLAST of SMED30017721 vs. Planmine SMEST
Match: SMESG000037259.1 (SMESG000037259.1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 318/318 (100.00%), Postives = 318/318 (100.00%), Query Frame = 1
Query:  469 MQSQIGHNIPEPXXXXXXXXXXXMQMPSMYNQNSFSYPNNSTSNAHEMSNITSVPQQAYPGISMPSYQLEHNQYLSNVNQNKLHTSGSSTADSNASNISEFDINRNPVKKRRKPAPTIATGRRNLKNETVAPXXXXXXXXXXXXXXKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIETCSLRNTENSEAGDTGSPRSSVVDQIMNNPIKQEYVXXXXXXXXXXXXXXFMTCAKVEQYCQNSFTNDLLPPNTINSNYDPYXXXXXXXSFTSDNGMGYI 1422
            MQSQIGHNIPEPGYGGNSGYSYSMQMPSMYNQNSFSYPNNSTSNAHEMSNITSVPQQAYPGISMPSYQLEHNQYLSNVNQNKLHTSGSSTADSNASNISEFDINRNPVKKRRKPAPTIATGRRNLKNETVAPEEAERRDKRRERNRKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIETCSLRNTENSEAGDTGSPRSSVVDQIMNNPIKQEYVLGQNLGNQNAQNSNFMTCAKVEQYCQNSFTNDLLPPNTINSNYDPYHHHHHHHSFTSDNGMGYI
Sbjct:    1 MQSQIGHNIPEPGYGGNSGYSYSMQMPSMYNQNSFSYPNNSTSNAHEMSNITSVPQQAYPGISMPSYQLEHNQYLSNVNQNKLHTSGSSTADSNASNISEFDINRNPVKKRRKPAPTIATGRRNLKNETVAPEEAERRDKRRERNRKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIETCSLRNTENSEAGDTGSPRSSVVDQIMNNPIKQEYVLGQNLGNQNAQNSNFMTCAKVEQYCQNSFTNDLLPPNTINSNYDPYHHHHHHHSFTSDNGMGYI 318          
BLAST of SMED30017721 vs. Planmine SMEST
Match: SMESG000037259.1 (SMESG000037259.1)

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 318/321 (99.07%), Postives = 318/321 (99.07%), Query Frame = 1
Query:  469 MQSQIGHNIPEPXXXXXXXXXXXMQMPSMYNQNSFSYPNNSTSNAHEMSNITSVPQQAYPGISMPSYQLEHNQYLSNVNQNKLHTSGSSTADSNASNISEFDINRNPVKKRRKPAPTIATGRRNLKNET---VAPXXXXXXXXXXXXXXKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIETCSLRNTENSEAGDTGSPRSSVVDQIMNNPIKQEYVXXXXXXXXXXXXXXFMTCAKVEQYCQNSFTNDLLPPNTINSNYDPYXXXXXXXSFTSDNGMGYI 1422
            MQSQIGHNIPEPGYGGNSGYSYSMQMPSMYNQNSFSYPNNSTSNAHEMSNITSVPQQAYPGISMPSYQLEHNQYLSNVNQNKLHTSGSSTADSNASNISEFDINRNPVKKRRKPAPTIATGRRNLKNET   VAPEEAERRDKRRERNRKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIETCSLRNTENSEAGDTGSPRSSVVDQIMNNPIKQEYVLGQNLGNQNAQNSNFMTCAKVEQYCQNSFTNDLLPPNTINSNYDPYHHHHHHHSFTSDNGMGYI
Sbjct:    1 MQSQIGHNIPEPGYGGNSGYSYSMQMPSMYNQNSFSYPNNSTSNAHEMSNITSVPQQAYPGISMPSYQLEHNQYLSNVNQNKLHTSGSSTADSNASNISEFDINRNPVKKRRKPAPTIATGRRNLKNETMFQVAPEEAERRDKRRERNRKSAQRCRERKIEKKETLQKEINSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQLIETCSLRNTENSEAGDTGSPRSSVVDQIMNNPIKQEYVLGQNLGNQNAQNSNFMTCAKVEQYCQNSFTNDLLPPNTINSNYDPYHHHHHHHSFTSDNGMGYI 321          
The following BLAST results are available for this feature:
BLAST of SMED30017721 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EQA05.255e-1143.17Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3Q7321.010e-939.71Transforming protein v-Fos/v-Fox OS=Schistocephalu... [more]
A0A068WS251.132e-946.36Basic leucine zipper bZIP transcription factor OS=... [more]
A0A068XU881.156e-946.36Basic leucine zipper bZIP transcription factor OS=... [more]
W6UKC31.624e-946.36Transcription factor kayak, isoforms A/B/F OS=Echi... [more]
back to top
BLAST of SMED30017721 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017721 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000037259.10.000e+0100.00SMESG000037259.1[more]
SMESG000037259.10.000e+099.07SMESG000037259.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017721 ID=SMED30017721|Name=SMED30017721|organism=Schmidtea mediterranea sexual|type=transcript|length=1915bp
CTTCCGATCTTGAAAATATGTTAAGCAAATCGATATTTAAATTTGATTTA
ATGTTGAAACAGTAAACTCGAGTAATTACACACCAGCACGTGTACACACA
GCTTAAACGCATCCGAAAATTGCGACCAACTTTGTACAAACTCCACTTTC
TCTTCTGATAAAATGATGCCATAATCAAGAAAAAATATGTGTGTATGTAG
GAAATGTTCTGCCCGCACGTGCTGATTGAAATCAAGAATTGCATTTGTGT
GTATTGATTATATCAATCCATTTGATTGATCATTTTGTAAAAAGCATGTG
GATCGATATATTTCTGTGGTAACGCATTAATTCTATTATTGTTTCGAAGA
AATGAATCCCTAACCAATGGTTCAAGAATCTCAGTTTCATACAGCAACAG
ATTATTGGAAATTGAATTCAACATCAAAGTCTGACTGCATCAACAAACAG
AATCGTGAATCATATTCAATGCAATCCCAAATTGGACATAATATCCCTGA
ACCGGGCTATGGAGGAAATTCTGGTTACTCTTATTCAATGCAAATGCCAT
CTATGTACAATCAAAATTCCTTTTCTTATCCCAATAATTCCACTTCAAAT
GCTCATGAAATGTCAAATATCACATCAGTCCCCCAGCAAGCTTATCCTGG
CATTTCGATGCCTTCATATCAGCTTGAACACAATCAATACCTCTCAAATG
TTAACCAGAACAAGCTTCACACATCTGGATCAAGTACAGCCGACTCAAAC
GCCAGCAACATTTCAGAATTCGATATCAACCGAAATCCAGTGAAAAAGCG
CCGGAAGCCAGCTCCAACAATAGCAACTGGAAGACGAAATCTCAAAAATG
AAACTGTTGCTCCTGAAGAAGCAGAACGTCGCGATAAACGACGAGAAAGA
AACCGAAAATCCGCTCAAAGATGTCGCGAAAGAAAAATCGAGAAAAAAGA
AACTCTCCAGAAAGAAATCAACAGTGTCAACCAAAAGAGTCGAAAATATT
TGGAATTAGCAGAAGATATATTAAAAGCTTGGAAAGAAAGATTACGGACT
CTCGATGAAAAGTTACCCGGACATAGTTTTAAACCCCAGTTTTCCGTAAC
TGAATTTGAACAGTTAATAGAAACGTGTAGTTTGCGAAATACCGAAAACT
CTGAAGCTGGTGACACCGGTTCTCCGAGAAGTTCTGTCGTCGATCAAATT
ATGAATAATCCGATAAAACAAGAATATGTTCTTGGACAGAATCTTGGTAA
TCAAAATGCACAAAATAGCAACTTCATGACGTGTGCTAAAGTTGAGCAGT
ATTGTCAAAACTCATTCACCAACGATCTCCTGCCACCAAATACCATAAAC
TCAAACTATGATCCCTATCATCATCACCATCATCATCATTCTTTTACAAG
TGATAATGGAATGGGATATATTTGAATTGTAACCCTCCCTCAGACAATCC
GAATCACAGTCTTCTAGAGCCAAACCGCGAAGTAATATTGCATTTTTGTT
TTCGTTATAGTTTCCGCGGATAAAACAATTGACAGTGATTTTTTAGGCTG
AACCGGTTTTTATAAAGTTTTCTTTTTTTGGATAATATTTGCATTTGTTT
ATACTTTGGTTTTTGGTACGCTTTTTGTACAGGTCTTCCTTATCATGTCG
TTTACCGGTGCGATTGACGCAGTGGTAGCCGATCTTGTAAATCTCGCTCA
GCACTCCCAGAATCGGGATGCAATAATATTGCTTGTTATTTGTTTGTTTT
TTTTATTTTTCAAAGTTTTTTTTATTACGTAATTCTTATGGATAGACAAT
TTTGTAATTTGCGAATTTTAATTTATATTTTGATGTTTTAAAATGTAGAT
TATATTGCAATGTTTTGGATACAATGTACGTTTTATGAAATAAATAATTT
TACGATGAAAAAAAA
back to top

protein sequence of SMED30017721-orf-1

>SMED30017721-orf-1 ID=SMED30017721-orf-1|Name=SMED30017721-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=353bp
MVQESQFHTATDYWKLNSTSKSDCINKQNRESYSMQSQIGHNIPEPGYGG
NSGYSYSMQMPSMYNQNSFSYPNNSTSNAHEMSNITSVPQQAYPGISMPS
YQLEHNQYLSNVNQNKLHTSGSSTADSNASNISEFDINRNPVKKRRKPAP
TIATGRRNLKNETVAPEEAERRDKRRERNRKSAQRCRERKIEKKETLQKE
INSVNQKSRKYLELAEDILKAWKERLRTLDEKLPGHSFKPQFSVTEFEQL
IETCSLRNTENSEAGDTGSPRSSVVDQIMNNPIKQEYVLGQNLGNQNAQN
SNFMTCAKVEQYCQNSFTNDLLPPNTINSNYDPYHHHHHHHSFTSDNGMG
YI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000837AP-1
IPR004827bZIP
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 187..232
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 171..259
e-value: 3.5E-7
score: 32.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 161..177
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 119..191
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 119..137
NoneNo IPR availableSUPERFAMILYSSF57959Leucine zipper domaincoord: 171..214
IPR000837AP-1 transcription factorPANTHERPTHR23351FOS TRANSCRIPTION FACTOR-RELATEDcoord: 61..205
IPR004827Basic-leucine zipper domainPROSITEPS00036BZIP_BASICcoord: 174..189
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 169..220
score: 9.484