Basement membrane-specific heparan sulfate proteoglycan core protein

Overview
NameBasement membrane-specific heparan sulfate proteoglycan core protein
Smed IDSMED30017714
Length (bp)3624
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30017714) t-SNE clustered cells

Violin plots show distribution of expression levels for Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30017714) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30017714) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Basement membrane-specific heparan sulfate proteoglycan core protein (SMED30017714) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017714

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 28

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017714SMESG000075928.1 Contig7205newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30017714SMESG000075928.1 Contig7205uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017714SMESG000075928.1 Contig7205newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017714SMESG000075928.1 Contig7205uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parapharyngeal regionSMED30017714SMESG000075928.1 SmedASXL_016234SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30017714SMESG000075928.1 dd_Smed_v4_8356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017714SMESG000075928.1 dd_Smed_v4_8356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017714SMESG000075928.1 dd_Smed_v4_8356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30017714SMESG000075928.1 dd_Smed_v4_8356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 SMESG000066028.1 Contig43196newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 SMESG000066028.1 Contig43196uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 Contig36017newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 Contig36017uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 Contig7205newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 Contig7205uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 Contig16950newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 Contig16950uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 Contig39637newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017714SMESG000075928.1 Contig39637uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30017714SMESG000075928.1 dd_8356dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx musculatureSMED30017714SMESG000075928.1 dd_8356dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30017714SMESG000075928.1 dd_Smed_v6_8356_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017714SMESG000075928.1 DN293829.1ncbi_smed_estsPMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30017714SMESG000075928.1 DN293829.1ncbi_smed_estsPMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30017714SMESG000075928.1 DN293829.1ncbi_smed_estsPMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx musculatureSMED30017714SMESG000075928.1 dd_Smed_v6_8356_0dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx musculatureSMED30017714SMESG000075928.1 dd_Smed_v6_8356_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017714SMESG000075928.1 dd_Smed_v4_8356_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: HSPG2 (heparan sulfate proteoglycan 2 [Source:HGNC Symbol;Acc:HGNC:5273])

HSP 1 Score: 185.267 bits (469), Expect = 2.383e-46
Identity = 135/500 (27.00%), Postives = 215/500 (43.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDE-DRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVT--KGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNF------------KTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYG--YPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPV--YASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C   +  C+N  CI  +  CDG+ DC D SDE D      C PN   C        N  C +K W+CDG  DC +  DE NCP K  ++  G T + C + N+ IP S+ CD E DC    DE  C  PQ++ P +   I      T+T TC   G P P I+WR NW H+P +    +T+          +L ++++     G Y+CE ++ R ++   PD  + +   +G      FY     +   C+ C+C  +T  C S   +     L     +P D   VN              T+    P+         + ++ ++++++      P+ + G   +  G  L RY   Y L   ++   +  D      VV+ G           YRL    +   +    N R   + +++W   H    P  R + + VL+++  VL +  Y     +  +S I+M   +    S+  A  +E+C+CP GYSGLSCE+
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPR-ESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQSTRRFRDQIRL--RFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWAL----PEQFLGNKVDSYGGSL-RYNVRYELARGMLEPVQRPD------VVLMGAG---------YRLLSRGHTPTQPGALNQRQVQFSEEHWV--HESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 744          

HSP 2 Score: 63.929 bits (154), Expect = 2.343e-9
Identity = 64/263 (24.33%), Postives = 112/263 (42.59%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVNFK---------TKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKL-ILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+   ++  A  P  C+ C+C  +T +C+S+   A    LI +   P D    A+VN +         T E      +++F N A + +   E++Y +L   P+ Y        G  +  YG  L Y L   +G     L  P V I G +  +       + P   S E+     R   W + +         PATR   +  L ++  +L +  + +      +S +S++ A    ++   A ++E+C+CP GY GLSC++
Sbjct: 1307 CRPHHFHLSASNPDGCLPCFCMGITQQCASS---AYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAQLGH---ESFYWQL---PETY-------QGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPALQGPERRSYEIM---FREEFWRRPD-------GQPATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQD 1543          

HSP 3 Score: 60.8474 bits (146), Expect = 2.110e-8
Identity = 58/240 (24.17%), Postives = 102/240 (42.50%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLIL-SGENSDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            P  C++C+C  ++  C+S++   +   L  +S +P   ++ N  +        E  F+       F   + + +L+  P Y++       G  +T YG  L + +   S   S  L G PLVV++G +  + H   +   P   S   F    R   W++ +         PATR   +  L  +  +L +  Y       ++S ISM  A+        A ++E+C CP GY G SC++
Sbjct:  918 PDGCLKCFCMGVSRHCTSSSW--SRAQLHGASEEPGHFSLTNAASTH---TTNEGIFSPTPGELGF---SSFHRLLSGP-YFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQGNNIILEHHVAQEPSPGQPST--FIVPFREQAWQRPD-------GQPATREHLLMALAGIDTLLIRASYAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQD 1139          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: LRP2 (LDL receptor related protein 2 [Source:HGNC Symbol;Acc:HGNC:6694])

HSP 1 Score: 89.7373 bits (221), Expect = 3.569e-17
Identity = 50/140 (35.71%), Postives = 74/140 (52.86%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC----NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            E+C L    CKN  C+     CDG +DC DNSDE  + C    N CS ++  C        +  CI  HW+CD  +DC +  DE NCP      C+ T Y C+N+  I +++ CD + DC    DE++C++ +  +P +F
Sbjct: 1024 EQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDE--QLCGTLNNTCSSSAFTCG-------HGECIPAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETCQPSQF 1154          

HSP 2 Score: 82.4185 bits (202), Expect = 5.560e-15
Identity = 49/144 (34.03%), Postives = 70/144 (48.61%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTL 2526
            P+   +CKN  CI     CDG+NDCGDNSDE+     EC+ +   C        N++CI   W CD  +DCG+N DE +C ++    C   ++ C +   +     CDG  DC    DE DC       P +F P   +  +T+
Sbjct: 3721 PVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRC-------VNQQCIPSRWICDHYNDCGDNSDERDCEMRT---CHPEYFQCTSGHCVHSELKCDGSADCLDASDEADC-------PTRF-PDGAYCQATM 3846          

HSP 3 Score: 79.337 bits (194), Expect = 5.455e-14
Identity = 49/132 (37.12%), Postives = 65/132 (49.24%), Query Frame = 1
Query: 2077 YVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDED-RKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            + +  C  ++ KC    CI     CDG NDCGD SDED R +C    CS +   C  + D  P++RCI + W CDG  DC + +DE  NC    +  C    + C   L IP+ + CD   DC    DE  C
Sbjct: 2901 HSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDKRHQCQNQNCSDSEFLC--VNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNC---TRRTCSENEFTCGYGLCIPKIFRCDRHNDCGDYSDERGC 3027          

HSP 4 Score: 74.7146 bits (182), Expect = 1.123e-12
Identity = 46/129 (35.66%), Postives = 66/129 (51.16%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDC--SSMEDEEDC 2460
            E C  +   C N  CI E   CD  NDCGD SDE    C  + CSP +  C        N RC+   ++CD  +DCG+  DE  C  ++ +    T ++CNN   IPR + C+G  +C  ++  DE++C
Sbjct: 2698 ERCGASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTC-------ANGRCVQYSYRCDYYNDCGDGSDEAGCLFRDCNA--TTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNC 2817          

HSP 5 Score: 74.7146 bits (182), Expect = 1.274e-12
Identity = 45/124 (36.29%), Postives = 59/124 (47.58%), Query Frame = 1
Query: 2092 CPLNQRKCKNET-CIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C     KC N   CI     CDG NDCGDNSDE+   C  + CS +   C        + RCI +HW CD   DC +  DE      ++  C+   + C+    IP  + CDG+ DC  M DE+
Sbjct: 2822 CQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQC-------ASGRCIPQHWYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDED 2938          

HSP 6 Score: 74.3294 bits (181), Expect = 1.546e-12
Identity = 52/156 (33.33%), Postives = 76/156 (48.72%), Query Frame = 1
Query: 2059 TDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE--EDC-SNPQIIEPVKFTPISIFTN 2517
            +D + L  +  C L Q +C +  C      C+   +C D SDEDR  C      + HCD  +    NKRCI + WQCD  +DC +N DE +    ++  C    + C N   IP+++ CD + DC    DE  E+C S+  + +   FT  S  TN
Sbjct: 3542 SDELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCE-----NHHCDSNEWQCANKRCIPESWQCDTFNDCEDNSDEDSSHCASR-TCRPGQFRCANGRCIPQAWKCDVDNDCGDHSDEPIEECMSSAHLCD--NFTEFSCKTN 3689          

HSP 7 Score: 73.559 bits (179), Expect = 3.137e-12
Identity = 49/132 (37.12%), Postives = 68/132 (51.52%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKD--ANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            C   Q +C N  CI +   CD  NDCGD+SDE  +   EC  ++  CD   +     N RCI K   C+G+DDC +N DE  C  +     +G  + C N+  IP  + CDG+ DC    DEE+C+  +  E
Sbjct: 3635 CRPGQFRCANGRCIPQAWKCDVDNDCGDHSDEPIE---ECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCHP-VGD-FRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTE 3761          

HSP 8 Score: 72.7886 bits (177), Expect = 5.201e-12
Identity = 48/136 (35.29%), Postives = 67/136 (49.26%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEEDC 2460
              C  N+ +C N+ CI E+  CD  NDC DNSDED   C    C P    C        N RCI + W+CD  +DCG++ DE   P++   +C+ + +LC+N            IP+   C+G  DC    DE+ C
Sbjct: 3592 HHCDSNEWQCANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRC-------ANGRCIPQAWKCDVDNDCGDHSDE---PIE---ECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGC 3714          

HSP 9 Score: 69.3218 bits (168), Expect = 6.239e-11
Identity = 45/130 (34.62%), Postives = 60/130 (46.15%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCN-NNLLIPRSYWCDGEPDCSSMEDEEDCSNPQ 2472
            E C  +Q  C N  CID +  CDG  DC D SDE     N C+ +   C          +CI    +CDG+ DC +N DE  CP +    C    + C  + + IP  + CDG PDC    DE +   P+
Sbjct: 1147 ETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLN-CTASQFKC------ASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPK 1269          

HSP 10 Score: 67.0106 bits (162), Expect = 2.724e-10
Identity = 46/124 (37.10%), Postives = 60/124 (48.39%), Query Frame = 1
Query: 2092 CPLNQRKCKN-ETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C  +Q KC + + CI     CDG  DC DNSDE    C    P   H D  +    +  CI   W+CDG  DC    DE N  V     C  +++ C+N   I R++ CD + DC  M DE+DC
Sbjct: 1187 CTASQFKCASGDKCIGVTNRCDGVFDCSDNSDE--AGCPTRPPGMCHSDEFQ-CQEDGICIPNFWECDGHPDCLYGSDEHNACVPKT--CPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDC 1305          

HSP 11 Score: 64.6994 bits (156), Expect = 1.272e-9
Identity = 39/110 (35.45%), Postives = 53/110 (48.18%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK--CIGTHYLCNNNLLIPRSYW 2412
            EC  ++ +C N+ CI     CD  NDCGDNSDE   +   C P    C        +  C+    +CDG  DC +  DE +CP +  D   C  T + C N++ IP  YW
Sbjct: 3758 ECTESEFRCVNQQCIPSRWICDHYNDCGDNSDERDCEMRTCHPEYFQC-------TSGHCVHSELKCDGSADCLDASDEADCPTRFPDGAYCQATMFECKNHVCIP-PYW 3859          

HSP 12 Score: 61.6178 bits (148), Expect = 1.098e-8
Identity = 47/129 (36.43%), Postives = 55/129 (42.64%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKD--KCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            E C  N+  C N  CI     CD  NDC D SDE       C      C       P+ RCI ++W CDG DDC +N DE  C     D  KC    + C  +   I     CDG  DC   EDE + S
Sbjct:  181 EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTC-------PSGRCIYQNWVCDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENNTS 302          

HSP 13 Score: 59.6918 bits (143), Expect = 4.996e-8
Identity = 58/191 (30.37%), Postives = 80/191 (41.88%), Query Frame = 1
Query: 2104 QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSV-ITSSLTVQ 2670
            Q  C N  C + ++ CD K DC D+SDE    C E C  N   C        N  CI + + CD  +DC +  DE  C   N   C G  + C +   I +++ CDGE DC    DE+ C +          P  +   S    +C  SGR +            P   D N T+T   CS+ + S+L  Q
Sbjct:  149 QLTCDNGACYNTSQKCDWKVDCRDSSDE--INCTEICLHNEFSCG-------NGECIPRAYVCDHDNDCQDGSDEHAC---NYPTCGGYQFTCPSGRCIYQNWVCDGEDDCKDNGDEDGCES---------GPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENNTSTGKYCSMTLCSALNCQ 318          

HSP 14 Score: 59.3066 bits (142), Expect = 6.821e-8
Identity = 45/131 (34.35%), Postives = 59/131 (45.04%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN----ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCI-GTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            + C  NQ  C+N  CI +   CD  NDCGD SDE    C+     C P+   CD       N RCI     C+ +DDC +N DE  C +    D  I G  + C + L    S++C   P    M D+  C
Sbjct: 3030 QTCQQNQFTCQNGRCISKTFVCDEDNDCGDGSDELMHLCHTPEPTCPPHEFKCD-------NGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSISGCDHNCTDTLT---SFYCSCRPGYKLMSDKRTC 3150          

HSP 15 Score: 58.5362 bits (140), Expect = 1.066e-7
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            +  C  +Q  C N  CI     CD   DC D +DE+   C   +   + CD       N  C     +CD   DC ++ DE+NC     + C+   + C N   IPR+Y CD + DC    DE  C+ P
Sbjct:  105 QSTCSSHQITCSNGQCIPSEYRCDHVRDCPDGADEN--DCQYPTCEQLTCD-------NGACYNTSQKCDWKVDCRDSSDEINC----TEICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYP 220          

HSP 16 Score: 51.9878 bits (123), Expect = 9.704e-6
Identity = 42/136 (30.88%), Postives = 55/136 (40.44%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKD-KCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
             +  C  N+  C    CI +   CD  NDCGD SDE       C  N   C        N RCI K + CD  +DCG+  DEL       +  C    + C+N   I     C+   DC    DE+ C   +  +P
Sbjct: 2989 TRRTCSENEFTCGYGLCIPKIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQ-------NGRCISKTFVCDEDNDCGDGSDELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDP 3117          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: LRP2 (LDL receptor related protein 2 [Source:HGNC Symbol;Acc:HGNC:6694])

HSP 1 Score: 86.6557 bits (213), Expect = 2.511e-16
Identity = 50/140 (35.71%), Postives = 74/140 (52.86%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC----NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            E+C L    CKN  C+     CDG +DC DNSDE  + C    N CS ++  C        +  CI  HW+CD  +DC +  DE NCP      C+ T Y C+N+  I +++ CD + DC    DE++C++ +  +P +F
Sbjct:  887 EQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDE--QLCGTLNNTCSSSAFTCG-------HGECIPAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTETCQPSQF 1017          

HSP 2 Score: 65.4698 bits (158), Expect = 6.309e-10
Identity = 46/137 (33.58%), Postives = 61/137 (44.53%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCN-NNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            E C  +Q  C N  CID +  CDG  DC D SDE     N C+ +   C          +CI    +CDG+ DC +N DE  CP +    C    + C  + + IP  + CDG PDC    DE +   P+      F
Sbjct: 1010 ETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLN-CTASQFKC------ASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYF 1139          

HSP 3 Score: 63.5438 bits (153), Expect = 2.848e-9
Identity = 46/124 (37.10%), Postives = 59/124 (47.58%), Query Frame = 1
Query: 2092 CPLNQRKC-KNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C  +Q KC   + CI     CDG  DC DNSDE    C    P   H D  +    +  CI   W+CDG  DC    DE N  V     C  +++ C+N   I R++ CD + DC  M DE+DC
Sbjct: 1050 CTASQFKCASGDKCIGVTNRCDGVFDCSDNSDE--AGCPTRPPGMCHSDEFQ-CQEDGICIPNFWECDGHPDCLYGSDEHNACVPKT--CPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDC 1168          

HSP 4 Score: 58.151 bits (139), Expect = 1.231e-7
Identity = 47/129 (36.43%), Postives = 55/129 (42.64%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKD--KCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            E C  N+  C N  CI     CD  NDC D SDE       C      C       P+ RCI ++W CDG DDC +N DE  C     D  KC    + C  +   I     CDG  DC   EDE + S
Sbjct:  181 EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTC-------PSGRCIYQNWVCDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENNTS 302          

HSP 5 Score: 56.9954 bits (136), Expect = 2.444e-7
Identity = 58/191 (30.37%), Postives = 80/191 (41.88%), Query Frame = 1
Query: 2104 QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSV-ITSSLTVQ 2670
            Q  C N  C + ++ CD K DC D+SDE    C E C  N   C        N  CI + + CD  +DC +  DE  C   N   C G  + C +   I +++ CDGE DC    DE+ C +          P  +   S    +C  SGR +            P   D N T+T   CS+ + S+L  Q
Sbjct:  149 QLTCDNGACYNTSQKCDWKVDCRDSSDE--INCTEICLHNEFSCG-------NGECIPRAYVCDHDNDCQDGSDEHAC---NYPTCGGYQFTCPSGRCIYQNWVCDGEDDCKDNGDEDGCES---------GPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENNTSTGKYCSMTLCSALNCQ 318          

HSP 6 Score: 54.6842 bits (130), Expect = 1.339e-6
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            +  C  +Q  C N  CI     CD   DC D +DE+   C   +   + CD       N  C     +CD   DC ++ DE+NC     + C+   + C N   IPR+Y CD + DC    DE  C+ P
Sbjct:  105 QSTCSSHQITCSNGQCIPSEYRCDHVRDCPDGADEN--DCQYPTCEQLTCD-------NGACYNTSQKCDWKVDCRDSSDEINC----TEICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYP 220          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: LRP1 (LDL receptor related protein 1 [Source:HGNC Symbol;Acc:HGNC:6692])

HSP 1 Score: 82.4185 bits (202), Expect = 5.596e-15
Identity = 47/127 (37.01%), Postives = 70/127 (55.12%), Query Frame = 1
Query: 2092 CPLNQRKCKNET-CIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            C +++ +CK+   CI     CDG++DCGD SDE +++C+E  C P    C        N RC+   WQCD  +DCG+N DE +C  +    C  + + C N   I   + CDG+ DC+   DE+DC+
Sbjct: 3494 CGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRC-------KNNRCVPGRWQCDYDNDCGDNSDEESCTPR---PCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCT 3610          

HSP 2 Score: 81.2629 bits (199), Expect = 1.165e-14
Identity = 63/211 (29.86%), Postives = 86/211 (40.76%), Query Frame = 1
Query: 2071 TLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN--------------ECSPNSIHCDFLKDANP----------------------NKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE--EDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWD 2589
             L  +  CP ++ KC+N  CI     CDG NDCG++ DE    C+               C P S  CD   D                         N RCI  +W+CD  +DCG+N DE  C       C  T + CN+   IP  + CDG+ DC    DE   +C+N Q   P    P    T+      C++ G  +P + WR + D
Sbjct:  888 ALCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGC----SHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTN-QATRP----PGGCHTDE---FQCRLDGLCIP-LRWRCDGD 1085          

HSP 3 Score: 76.2554 bits (186), Expect = 4.078e-13
Identity = 54/154 (35.06%), Postives = 69/154 (44.81%), Query Frame = 1
Query: 2083 KEECPLN-----QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFT-NSTL 2526
            KEEC        Q +CKN  C+     CD  NDCGDNSDE+      CS +   C        N RCI   W+CDG  DC +  DE +C      +C    + C +   IP  + CD + DC    DEE C        V+  P+  F  N+TL
Sbjct: 3528 KEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSC-------ANGRCIAGRWKCDGDHDCADGSDEKDC----TPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGT-----GVRTCPLDEFQCNNTL 3665          

HSP 4 Score: 76.2554 bits (186), Expect = 4.399e-13
Identity = 50/139 (35.97%), Postives = 65/139 (46.76%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE-DCSNPQIIEPVKFT 2496
            +C   +  C N  CI E   CDG NDC DNSDE    C++  C  +   C+       N RCI   W CDG +DCGN+ DE N     +  C    + C +   IP S+ CD + DC    DE   C+ P      +FT
Sbjct:  853 QCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCE-------NNRCIPNRWLCDGDNDCGNSEDESNATCSAR-TCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFT 983          

HSP 5 Score: 71.633 bits (174), Expect = 1.099e-11
Identity = 48/130 (36.92%), Postives = 66/130 (50.77%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNS-IHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC--PVKNKDKCIG-THYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            CPL++ +C N  C      CDG++DCGDNSDE+ ++C    C PN    C        ++ C+    QCDG D+CG+  DE +C  P  +   C     +LC N   +  S  C+   DC    DEEDCS
Sbjct: 3654 CPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRC------KNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAHTTHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCS 3777          

HSP 6 Score: 69.3218 bits (168), Expect = 4.798e-11
Identity = 41/130 (31.54%), Postives = 61/130 (46.92%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPN---SIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            K  C + + +C++ TCI  +  C+   DC D SDE      +CS      +     +       C    W CDG +DCG+  DE +CP   + +C   ++ C +   IP S+ CD E DC   EDE  C+
Sbjct: 2602 KTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCSATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCEHGEDETHCN 2731          

HSP 7 Score: 67.3958 bits (163), Expect = 2.077e-10
Identity = 41/123 (33.33%), Postives = 57/123 (46.34%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRK-KCNECSPNSIHCDFLKDANPNKR-CIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE 2451
            C   Q +C+N  CI +   CDG +DCGD SDE    +   C P+S  C       P    C+ + W CDG  DC +  DE +         C    ++C N   IP+ + CD + DC+   DE
Sbjct: 2734 CSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAAHCEGKTCGPSSFSC-------PGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDDREFMCQNRQCIPKHFVCDHDRDCADGSDE 2849          

HSP 8 Score: 65.855 bits (159), Expect = 6.640e-10
Identity = 47/126 (37.30%), Postives = 63/126 (50.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C  +Q  CKN+ CI     CD ++DCGD+SDE    C E  C P    C      NP        + CDG +DC +N DE NC +     C+ + + C N N  IP  + C+G+ +C   EDE DC
Sbjct: 3334 CTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEP-PDCPEFKCRPGQFQCSTGICTNPA-------FICDGDNDCQDNSDEANCDIH---VCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDC 3448          

HSP 9 Score: 65.4698 bits (158), Expect = 7.662e-10
Identity = 45/135 (33.33%), Postives = 64/135 (47.41%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECS---PNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEEDC 2460
            C   Q KC +  CI E+  CDG NDCGD SDE    C   +   P   H D  +    +  CI   W+CDG  DC ++ DE +C         G  ++C+ ++          I +++ CDG+ DC    DEE+C
Sbjct: 1015 CSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQ-CRLDGLCIPLRWRCDGDTDCMDSSDEKSCE--------GVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENC 1140          

HSP 10 Score: 64.3142 bits (155), Expect = 1.662e-9
Identity = 51/160 (31.87%), Postives = 71/160 (44.38%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCN-NNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPT 2565
            +C   Q +C    C +    CDG NDC DNSDE     + C P+   C      N N RCI   ++C+G D+CG+  DE +CP   +  C    + C+     IPR + CD + DC    D          EP   T ++   +      CK SGR +P 
Sbjct: 3373 KCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC-----TNTN-RCIPGIFRCNGQDNCGDGEDERDCP---EVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSD----------EPANCTQMTCGVDE---FRCKDSGRCIPA 3510          

HSP 11 Score: 58.5362 bits (140), Expect = 9.380e-8
Identity = 37/123 (30.08%), Postives = 57/123 (46.34%), Query Frame = 1
Query: 2113 CKNETCIDENKFCDGKNDCGDNSDEDRKKCN--ECSPNSIHCDFLKDANPNKRCII-KHWQCDGIDDCGNNFDEL----NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C+N  CI ++  CD   DC D SDE   +C    C P+   C        N RC+  + W+CDG +DC +  DE     +C  +       + +LC++   +  +  C+G+ DC    DE  C
Sbjct: 2825 CQNRQCIPKHFVCDHDRDCADGSDES-PECEYPTCGPSEFRC-------ANGRCLSSRQWECDGENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDSSDERGC 2939          

HSP 12 Score: 56.9954 bits (136), Expect = 2.732e-7
Identity = 41/121 (33.88%), Postives = 54/121 (44.63%), Query Frame = 1
Query: 2101 NQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            ++ +C N  CI+ +  CDG   C D SDE    CN     S  C        N RC+     C+G DDCG+  DE+ C   NK  C    + C +   I  S  C+   DC    DE +CS
Sbjct: 2528 DEFECANGECINFSLTCDGVPHCKDKSDEKPSYCN-----SRRCKKTFRQCSNGRCVSNMLWCNGADDCGDGSDEIPC---NKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCS 2640          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 81.6481 bits (200), Expect = 8.930e-15
Identity = 65/260 (25.00%), Postives = 123/260 (47.31%), Query Frame = 1
Query: 2773 CQRPFYN--NDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESS---IKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVF----ENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTN-FQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+  F+N   D W  + C  C+CS +++ C S+  Y T   + + S   +      I     ++     ++I+ +N  A +   +  Y+    P    Y G      G  LT   + ++Y L    E+++ +   +++++G   SI            A +EV+    E +  + L ++++ FT H    P  R++F+ VL N++ VL ++ Y  G    F++S ++++ A+      S AA +E C+CP GY+G SCE+
Sbjct:  500 CKSGFFNLQEDNW--KGCDECFCSGVSNRCQSS--YWTYGKIQDMSGWYLTDLPGRIRVAPQQDDLDSPQQISISNAEARQALPHSYYWSAPAP----YLGNKLPAVGGQLT---FTISYDLEEEEEDTERVLQLMIILEGNDLSIS----------TAQDEVYLHPSEEHTNVLLLKEES-FTIHGTHFPVRRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAAVEVCQCPPGYTGSSCES 737          

HSP 2 Score: 80.8777 bits (198), Expect = 1.724e-14
Identity = 74/257 (28.79%), Postives = 106/257 (41.25%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLI--ESSIKP-SDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLP--GPLVVIKGESDSIYHCSVKY-RLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQ--EAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            C+   +  DA  P  C  CYC   T +CS A G     V +  E +I P  D A+ +  TK       EI        +    E +Y KL   P+ +        G  L  YG  L Y +              P V+I+G + +     V++   P+       E  M    W+   +  D R     TR DF+++L ++  +L K  Y N     ++S+ISM+  E    T     A  +EKC CP GYSGLSCE
Sbjct: 1148 CRPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDEALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKL---PEQF-------EGKKLMAYGGKLKYAIYFEAREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKY--YGDDPRVHRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMEVAEQGRGTTMTPPADLIEKCDCPLGYSGLSCE 1392          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 148.288 bits (373), Expect = 1.955e-35
Identity = 142/539 (26.35%), Postives = 229/539 (42.49%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR--KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK-NKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS-RRRIIA-PDFSVSV----------------------TKGQICQRPFYNN--------------------DAWY-----PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETY--YKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYH------CSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            +C  +++ C N  C+  +  CDG+ DC D SDE         C PN   C+       N +C+ K W CDG DDCG+N DELNC  K +   C  T + C++    +P S+ CDG  DC    DE  C  P +++P + T + +   +T ++TCK    P P I+WR NW  + E         +        +LT+ +      G Y+CE I+ + R++A PD  V V                      T+G +   P+ NN                     A++     P+ C++C+C  ++++C S+  Y T   L+ +     DA  V     E     R   F+       F    Y  +         Y+       G  +T YG  + +++  SG +  +   P+VV+KG  + + H        ++   PV  + E +E N     +EQ N          ATR D + VL ++   L +  +   QT+  +  +S + A++       A ++E+C CP GY G SCE+
Sbjct:  148 QCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEP-----PRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVT--PYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFA----GDAEGVTISDIEERTIDRNTPFS-------FFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN-----YEQLNGAA-------ATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED 647          

HSP 2 Score: 74.7146 bits (182), Expect = 4.524e-13
Identity = 69/244 (28.28%), Postives = 112/244 (45.90%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA-AIVNFKTKEYYKPAREITFANKA----AMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGE-NSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            PQ CI C+CS +T +CS A+ Y    V I+ +    D   +    +++ Y P      + +A    + +    +T Y KL   P+ + G         +T YG  L Y    SG  NSD      V+++G   ++ +   K+R P YA  E   N ++I + E      D +    ATR   +  L ++  +L K  Y +  T+ Q+   +++ A E       AA++E+C CP GY G SCE+
Sbjct:  715 PQGCIPCFCSGVTQQCS-ASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKL---PEKFLG-------DKVTSYGGTLEYTFKFSGNGNSDQSAD--VILRGNDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA-EPYGQGLTAAEVEQCICPPGYVGTSCED 935          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 147.517 bits (371), Expect = 2.989e-35
Identity = 143/539 (26.53%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK-NKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS-RRRIIA-PDFSVSV----------------------TKGQICQRPFYNN--------------------DAWY-----PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETY--YKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYH------CSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            +C  +++ C N  C+  +  CDG+ DC D SDE         C PN   C+       N +C+ K W CDG DDCG+N DELNC  K +   C  T + C++    +P S+ CDG  DC    DE  C  P +++P + T + +   +T ++TCK    P P I+WR NW  + E      T+          +LT+ +      G Y+CE I+ + R++A PD  V V                      T+G +   P+ NN                     A++     P+ C++C+C  ++++C S+  Y T   L+ +     DA  V     E     R   F+       F    Y  +         Y+       G  +T YG  + +++  SG +  +   P+VV+KG  + + H        ++   PV  + E +E N     +EQ N          ATR D + VL ++   L +  +   QT+  +  +S + A++       A ++E+C CP GY G SCE+
Sbjct:  937 QCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGG-----YGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAV--TPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFA----GDAEGVTISDIEERTIDRNTPFS-------FFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN-----YEQLNGAA-------ATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED 1436          

HSP 2 Score: 75.0998 bits (183), Expect = 3.809e-13
Identity = 69/244 (28.28%), Postives = 112/244 (45.90%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA-AIVNFKTKEYYKPAREITFANKA----AMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGE-NSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            PQ CI C+CS +T +CS A+ Y    V I+ +    D   +    +++ Y P      + +A    + +    +T Y KL   P+ + G         +T YG  L Y    SG  NSD      V+++G   ++ +   K+R P YA  E   N ++I + E      D +    ATR   +  L ++  +L K  Y +  T+ Q+   +++ A E       AA++E+C CP GY G SCE+
Sbjct: 1504 PQGCIPCFCSGVTQQCS-ASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKL---PEKFLG-------DKVTSYGGTLEYTFKFSGNGNSDQSAD--VILRGNDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA-EPYGQGLTAAEVEQCICPPGYVGTSCED 1724          

HSP 3 Score: 52.373 bits (124), Expect = 3.036e-6
Identity = 44/156 (28.21%), Postives = 64/156 (41.03%), Query Frame = 1
Query: 1894 LIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTV--------YECAFN-KLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC 2334
            L+GV    L    +   +TV+K  + D   L ++   DA   DDGT          E  F  ++T        +ECP  +R CK+  C+   +FCD +  C D  DE+     +C  N   C+          C+     CDG  DC +  DE  C
Sbjct:  208 LLGVGSMTL---AEDGRVTVYK--KGDKHHLHIINATDA---DDGTYKMIVQGINVEADFEVRITSDRVATESDECPSGERACKSGHCLPVAQFCDRRVQCPDGDDEEHCSEVQCKSNEFRCES------TNVCVPTVVVCDGWKDCHDGSDEKKC 349          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 147.132 bits (370), Expect = 3.275e-35
Identity = 144/544 (26.47%), Postives = 231/544 (42.46%), Query Frame = 1
Query: 2074 LYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR--KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK-NKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS-RRRIIA-PDFSVSV----------------------TKGQICQRPFYNN--------------------DAWY-----PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETY--YKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYH------CSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            L    +C  +++ C N  C+  +  CDG+ DC D SDE         C PN   C+       N +C+ K W CDG DDCG+N DELNC  K +   C  T + C++    +P S+ CDG  DC    DE  C  P +++P + T + +   +T ++TCK    P P I+WR NW  + E      T+          +LT+ +      G Y+CE I+ + R++A PD  V V                      T+G +   P+ NN                     A++     P+ C++C+C  ++++C S+  Y T   L+ +     DA  V     E     R   F+       F    Y  +         Y+       G  +T YG  + +++  SG +  +   P+VV+KG  + + H        ++   PV  + E +E N     +EQ N          ATR D + VL ++   L +  +   QT+  +  +S + A++       A ++E+C CP GY G SCE+
Sbjct:  143 LRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGG-----YGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAV--TPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFA----GDAEGVTISDIEERTIDRNTPFS-------FFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN-----YEQLNGAA-------ATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED 647          

HSP 2 Score: 74.3294 bits (181), Expect = 5.994e-13
Identity = 69/244 (28.28%), Postives = 112/244 (45.90%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA-AIVNFKTKEYYKPAREITFANKA----AMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGE-NSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            PQ CI C+CS +T +CS A+ Y    V I+ +    D   +    +++ Y P      + +A    + +    +T Y KL   P+ + G         +T YG  L Y    SG  NSD      V+++G   ++ +   K+R P YA  E   N ++I + E      D +    ATR   +  L ++  +L K  Y +  T+ Q+   +++ A E       AA++E+C CP GY G SCE+
Sbjct:  715 PQGCIPCFCSGVTQQCS-ASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKL---PEKFLGDK-------VTSYGGTLEYTFKFSGNGNSDQSAD--VILRGNDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA-EPYGQGLTAAEVEQCICPPGYVGTSCED 935          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 147.132 bits (370), Expect = 3.300e-35
Identity = 144/544 (26.47%), Postives = 231/544 (42.46%), Query Frame = 1
Query: 2074 LYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR--KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK-NKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS-RRRIIA-PDFSVSV----------------------TKGQICQRPFYNN--------------------DAWY-----PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETY--YKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYH------CSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            L    +C  +++ C N  C+  +  CDG+ DC D SDE         C PN   C+       N +C+ K W CDG DDCG+N DELNC  K +   C  T + C++    +P S+ CDG  DC    DE  C  P +++P + T + +   +T ++TCK    P P I+WR NW  + E      T+          +LT+ +      G Y+CE I+ + R++A PD  V V                      T+G +   P+ NN                     A++     P+ C++C+C  ++++C S+  Y T   L+ +     DA  V     E     R   F+       F    Y  +         Y+       G  +T YG  + +++  SG +  +   P+VV+KG  + + H        ++   PV  + E +E N     +EQ N          ATR D + VL ++   L +  +   QT+  +  +S + A++       A ++E+C CP GY G SCE+
Sbjct:  143 LRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGG-----YGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAV--TPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFA----GDAEGVTISDIEERTIDRNTPFS-------FFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN-----YEQLNGAA-------ATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED 647          

HSP 2 Score: 74.3294 bits (181), Expect = 5.972e-13
Identity = 69/244 (28.28%), Postives = 112/244 (45.90%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA-AIVNFKTKEYYKPAREITFANKA----AMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGE-NSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            PQ CI C+CS +T +CS A+ Y    V I+ +    D   +    +++ Y P      + +A    + +    +T Y KL   P+ + G         +T YG  L Y    SG  NSD      V+++G   ++ +   K+R P YA  E   N ++I + E      D +    ATR   +  L ++  +L K  Y +  T+ Q+   +++ A E       AA++E+C CP GY G SCE+
Sbjct:  715 PQGCIPCFCSGVTQQCS-ASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKL---PEKFLG-------DKVTSYGGTLEYTFKFSGNGNSDQSAD--VILRGNDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA-EPYGQGLTAAEVEQCICPPGYVGTSCED 935          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Match: unc-52 (Basement membrane proteoglycan [Source:UniProtKB/Swiss-Prot;Acc:Q06561])

HSP 1 Score: 147.132 bits (370), Expect = 3.595e-35
Identity = 144/544 (26.47%), Postives = 231/544 (42.46%), Query Frame = 1
Query: 2074 LYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR--KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK-NKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS-RRRIIA-PDFSVSV----------------------TKGQICQRPFYNN--------------------DAWY-----PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETY--YKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYH------CSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            L    +C  +++ C N  C+  +  CDG+ DC D SDE         C PN   C+       N +C+ K W CDG DDCG+N DELNC  K +   C  T + C++    +P S+ CDG  DC    DE  C  P +++P + T + +   +T ++TCK    P P I+WR NW  + E      T+          +LT+ +      G Y+CE I+ + R++A PD  V V                      T+G +   P+ NN                     A++     P+ C++C+C  ++++C S+  Y T   L+ +     DA  V     E     R   F+       F    Y  +         Y+       G  +T YG  + +++  SG +  +   P+VV+KG  + + H        ++   PV  + E +E N     +EQ N          ATR D + VL ++   L +  +   QT+  +  +S + A++       A ++E+C CP GY G SCE+
Sbjct:  143 LRQAGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGG-----YGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAV--TPYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFA----GDAEGVTISDIEERTIDRNTPFS-------FFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN-----YEQLNGAA-------ATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED 647          

HSP 2 Score: 74.3294 bits (181), Expect = 6.242e-13
Identity = 69/244 (28.28%), Postives = 112/244 (45.90%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA-AIVNFKTKEYYKPAREITFANKA----AMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGE-NSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            PQ CI C+CS +T +CS A+ Y    V I+ +    D   +    +++ Y P      + +A    + +    +T Y KL   P+ + G         +T YG  L Y    SG  NSD      V+++G   ++ +   K+R P YA  E   N ++I + E      D +    ATR   +  L ++  +L K  Y +  T+ Q+   +++ A E       AA++E+C CP GY G SCE+
Sbjct:  715 PQGCIPCFCSGVTQQCS-ASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKL---PEKFLGDK-------VTSYGGTLEYTFKFSGNGNSDQSAD--VILRGNDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA-EPYGQGLTAAEVEQCICPPGYVGTSCED 935          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342811)

HSP 1 Score: 191.045 bits (484), Expect = 1.867e-48
Identity = 161/594 (27.10%), Postives = 248/594 (41.75%), Query Frame = 1
Query: 1831 LKVSPKVVTVKPGGGARFVCELIG-VQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDY-----VTLYVKEE------------CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN---ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC-PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRR--RIIAPDFSVSV--TKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSAT--GYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFT-DHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQT-NFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            LK  P    +K      F C   G  + KV W R   + L      R        LE+ +   +D GT Y C       Y     VT+ +  E            C   Q  C N  CID++  CDG  DC D SDE  + C+   +C PN   C        N +C+ + W+CDG +DCG+N DE +C P  +   C    + C +   IP+S+ CD  PDC+   DE  C  P  I P   + +S+     L +TC  +G P PTI WR NW H+P+  +       S     T +L   ++    SG YSCE I+ R    + PD  V+V   +  +C+  F+N  A   + C++C+C  +   C SA    YA +P ++   +   + + +         P +++            N  +  +  P    Y     +  G+ L  YG  L Y++   G     + GP V+I G          ++ L      +  +NN     +    W   D R    A+R + + +L NV  +L ++ Y +       +  I++  A         A+ +EKC+CP GY G SCE+
Sbjct:  617 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN-----GRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDGR---KASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1170          

HSP 2 Score: 74.3294 bits (181), Expect = 7.216e-13
Identity = 58/219 (26.48%), Postives = 89/219 (40.64%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS------NPQIIEPVKFTPISIFTNSTLTI-TCKMSGRPVPTISW-RYNWDHLPENL-DYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS 2718
            EC  N+ +C N  CID  K C+  +DC +  DE+ ++C  C  N   C+       N  C+     C+G  +C ++ DELNC      +C+   + CN+   +  S  C+G  DC    DE++C+       P  +    +    I   S   I  C+  G     + W R     LP    D N              L + NI  + +G Y CE + 
Sbjct:  491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EEC-RCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN------------GRLEIPNIRVEDAGTYVCEAVG 686          

HSP 3 Score: 66.2402 bits (160), Expect = 2.520e-10
Identity = 70/286 (24.48%), Postives = 121/286 (42.31%), Query Frame = 1
Query: 2692 GIYSCEG---ISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSD----AAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWF-TDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIET-TNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            GIY C G   + +R +I         +   C+   Y   A     C  CYCS L  +C SA  Y          + P D    A ++  ++         I   ++  M  + + +Y  K       Y+    ++ G+ L  YG  L+Y LI+     +Y  G  +V+ G    +      +  P    N+  E N+R++  E + W   D     PA+R DF+ VL +++ +L +        +  +  + ++ A+ T T   + A+ +E C+CP+GY G SCE+
Sbjct: 1638 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY--------RQLIPVDFILNAPLITDESGAVQDTENLIPDISRN-MYTYTHTSYLPK-------YWSLRGSVLGNQLFSYGGRLSYSLIVE-SYGNYERGHDIVLIGNGLKLI-----WSRPDGNENQE-EYNVRLH--EDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 1891          

HSP 4 Score: 60.8474 bits (146), Expect = 9.751e-9
Identity = 56/235 (23.83%), Postives = 90/235 (38.30%), Query Frame = 1
Query: 2818 CIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYY-FGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            CI C+CS +  +C S+T Y      + S+   S           Y +P  +    + AA    ++         N  Y+    AF   G+ L+ YG  LTY L  S      LP  ++      D +       RL  Y  ++V  +    Y  E           + A R   +  L ++  +  K  Y        + ++++  A  T      A ++E+C+CP GY GLSCE
Sbjct: 1316 CIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAF--LGNKLSSYGGKLTYTLSYSP-----LPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1540          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342825)

HSP 1 Score: 191.045 bits (484), Expect = 1.968e-48
Identity = 161/594 (27.10%), Postives = 248/594 (41.75%), Query Frame = 1
Query: 1831 LKVSPKVVTVKPGGGARFVCELIG-VQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDY-----VTLYVKEE------------CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN---ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC-PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRR--RIIAPDFSVSV--TKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSAT--GYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFT-DHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQT-NFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            LK  P    +K      F C   G  + KV W R   + L      R        LE+ +   +D GT Y C       Y     VT+ +  E            C   Q  C N  CID++  CDG  DC D SDE  + C+   +C PN   C        N +C+ + W+CDG +DCG+N DE +C P  +   C    + C +   IP+S+ CD  PDC+   DE  C  P  I P   + +S+     L +TC  +G P PTI WR NW H+P+  +       S     T +L   ++    SG YSCE I+ R    + PD  V+V   +  +C+  F+N  A   + C++C+C  +   C SA    YA +P ++   +   + + +         P +++            N  +  +  P    Y     +  G+ L  YG  L Y++   G     + GP V+I G          ++ L      +  +NN     +    W   D R    A+R + + +L NV  +L ++ Y +       +  I++  A         A+ +EKC+CP GY G SCE+
Sbjct:  878 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN-----GRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDGR---KASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1431          

HSP 2 Score: 67.3958 bits (163), Expect = 1.037e-10
Identity = 56/217 (25.81%), Postives = 83/217 (38.25%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS------NPQIIEPVKFTPISIFTNSTLTI-TCKMSGRPVPTISW-RYNWDHLPENL-DYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS 2718
            P  Q +C +  C  E++ CD    C D SDE     N C  N   C+       N  C+     C+G  +C ++ DELNC      +C+   + CN+   +  S  C+G  DC    DE++C+       P  +    +    I   S   I  C+  G     + W R     LP    D N              L + NI  + +G Y CE + 
Sbjct:  756 PCPQHQCPSGRCYTESERCDRHRHCEDGSDE----ANCCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN------------GRLEIPNIRVEDAGTYVCEAVG 947          

HSP 3 Score: 66.2402 bits (160), Expect = 2.554e-10
Identity = 70/286 (24.48%), Postives = 121/286 (42.31%), Query Frame = 1
Query: 2692 GIYSCEG---ISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSD----AAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWF-TDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIET-TNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            GIY C G   + +R +I         +   C+   Y   A     C  CYCS L  +C SA  Y          + P D    A ++  ++         I   ++  M  + + +Y  K       Y+    ++ G+ L  YG  L+Y LI+     +Y  G  +V+ G    +      +  P    N+  E N+R++  E + W   D     PA+R DF+ VL +++ +L +        +  +  + ++ A+ T T   + A+ +E C+CP+GY G SCE+
Sbjct: 1899 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY--------RQLIPVDFILNAPLITDESGAVQDTENLIPDISRN-MYTYTHTSYLPK-------YWSLRGSVLGNQLFSYGGRLSYSLIVE-SYGNYERGHDIVLIGNGLKLI-----WSRPDGNENQE-EYNVRLH--EDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 2152          

HSP 4 Score: 60.8474 bits (146), Expect = 9.632e-9
Identity = 56/235 (23.83%), Postives = 90/235 (38.30%), Query Frame = 1
Query: 2818 CIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYY-FGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            CI C+CS +  +C S+T Y      + S+   S           Y +P  +    + AA    ++         N  Y+    AF   G+ L+ YG  LTY L  S      LP  ++      D +       RL  Y  ++V  +    Y  E           + A R   +  L ++  +  K  Y        + ++++  A  T      A ++E+C+CP GY GLSCE
Sbjct: 1577 CIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAF--LGNKLSSYGGKLTYTLSYSP-----LPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1801          

HSP 5 Score: 51.6026 bits (122), Expect = 5.890e-6
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDE-DRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK 2355
            C  NQ +C N  C+  +  C+G ++C D+SDE +     EC PN   C+       + +C+    +C+G  DC ++ DE NC   + D+
Sbjct:  790 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 871          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342824)

HSP 1 Score: 190.66 bits (483), Expect = 2.158e-48
Identity = 161/594 (27.10%), Postives = 248/594 (41.75%), Query Frame = 1
Query: 1831 LKVSPKVVTVKPGGGARFVCELIG-VQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDY-----VTLYVKEE------------CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN---ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC-PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRR--RIIAPDFSVSV--TKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSAT--GYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFT-DHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQT-NFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            LK  P    +K      F C   G  + KV W R   + L      R        LE+ +   +D GT Y C       Y     VT+ +  E            C   Q  C N  CID++  CDG  DC D SDE  + C+   +C PN   C        N +C+ + W+CDG +DCG+N DE +C P  +   C    + C +   IP+S+ CD  PDC+   DE  C  P  I P   + +S+     L +TC  +G P PTI WR NW H+P+  +       S     T +L   ++    SG YSCE I+ R    + PD  V+V   +  +C+  F+N  A   + C++C+C  +   C SA    YA +P ++   +   + + +         P +++            N  +  +  P    Y     +  G+ L  YG  L Y++   G     + GP V+I G          ++ L      +  +NN     +    W   D R    A+R + + +L NV  +L ++ Y +       +  I++  A         A+ +EKC+CP GY G SCE+
Sbjct:  722 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN-----GRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDGR---KASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1275          

HSP 2 Score: 67.3958 bits (163), Expect = 1.134e-10
Identity = 56/217 (25.81%), Postives = 83/217 (38.25%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS------NPQIIEPVKFTPISIFTNSTLTI-TCKMSGRPVPTISW-RYNWDHLPENL-DYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS 2718
            P  Q +C +  C  E++ CD    C D SDE     N C  N   C+       N  C+     C+G  +C ++ DELNC      +C+   + CN+   +  S  C+G  DC    DE++C+       P  +    +    I   S   I  C+  G     + W R     LP    D N              L + NI  + +G Y CE + 
Sbjct:  600 PCPQHQCPSGRCYTESERCDRHRHCEDGSDE----ANCCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN------------GRLEIPNIRVEDAGTYVCEAVG 791          

HSP 3 Score: 65.855 bits (159), Expect = 2.771e-10
Identity = 70/286 (24.48%), Postives = 121/286 (42.31%), Query Frame = 1
Query: 2692 GIYSCEG---ISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSD----AAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWF-TDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIET-TNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            GIY C G   + +R +I         +   C+   Y   A     C  CYCS L  +C SA  Y          + P D    A ++  ++         I   ++  M  + + +Y  K       Y+    ++ G+ L  YG  L+Y LI+     +Y  G  +V+ G    +      +  P    N+  E N+R++  E + W   D     PA+R DF+ VL +++ +L +        +  +  + ++ A+ T T   + A+ +E C+CP+GY G SCE+
Sbjct: 1743 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY--------RQLIPVDFILNAPLITDESGAVQDTENLIPDISRN-MYTYTHTSYLPK-------YWSLRGSVLGNQLFSYGGRLSYSLIVE-SYGNYERGHDIVLIGNGLKLI-----WSRPDGNENQE-EYNVRLH--EDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 1996          

HSP 4 Score: 63.1586 bits (152), Expect = 2.145e-9
Identity = 47/169 (27.81%), Postives = 67/169 (39.64%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDED------RKKCNECSPNSIHCDF--------------LKDAN--------------PNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            EC  N+ +C N  CID  K C+  +DC +  DE+      R K ++CSP   +CD                 D +              P+ RC  +  +CD    C +  DE NC       C    + CNN   +  S  C+G  +CS   DE +C   Q   P +F
Sbjct:  518 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPTTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANC-------CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQF 679          

HSP 5 Score: 60.8474 bits (146), Expect = 9.446e-9
Identity = 56/235 (23.83%), Postives = 90/235 (38.30%), Query Frame = 1
Query: 2818 CIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYY-FGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            CI C+CS +  +C S+T Y      + S+   S           Y +P  +    + AA    ++         N  Y+    AF   G+ L+ YG  LTY L  S      LP  ++      D +       RL  Y  ++V  +    Y  E           + A R   +  L ++  +  K  Y        + ++++  A  T      A ++E+C+CP GY GLSCE
Sbjct: 1421 CIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAF--LGNKLSSYGGKLTYTLSYSP-----LPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1645          

HSP 6 Score: 51.6026 bits (122), Expect = 6.339e-6
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDE-DRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK 2355
            C  NQ +C N  C+  +  C+G ++C D+SDE +     EC PN   C+       + +C+    +C+G  DC ++ DE NC   + D+
Sbjct:  634 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 715          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342815)

HSP 1 Score: 190.66 bits (483), Expect = 2.366e-48
Identity = 161/594 (27.10%), Postives = 248/594 (41.75%), Query Frame = 1
Query: 1831 LKVSPKVVTVKPGGGARFVCELIG-VQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDY-----VTLYVKEE------------CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN---ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC-PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRR--RIIAPDFSVSV--TKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSAT--GYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFT-DHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQT-NFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            LK  P    +K      F C   G  + KV W R   + L      R        LE+ +   +D GT Y C       Y     VT+ +  E            C   Q  C N  CID++  CDG  DC D SDE  + C+   +C PN   C        N +C+ + W+CDG +DCG+N DE +C P  +   C    + C +   IP+S+ CD  PDC+   DE  C  P  I P   + +S+     L +TC  +G P PTI WR NW H+P+  +       S     T +L   ++    SG YSCE I+ R    + PD  V+V   +  +C+  F+N  A   + C++C+C  +   C SA    YA +P ++   +   + + +         P +++            N  +  +  P    Y     +  G+ L  YG  L Y++   G     + GP V+I G          ++ L      +  +NN     +    W   D R    A+R + + +L NV  +L ++ Y +       +  I++  A         A+ +EKC+CP GY G SCE+
Sbjct:  695 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN-----GRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDGR---KASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1248          

HSP 2 Score: 67.0106 bits (162), Expect = 1.173e-10
Identity = 56/217 (25.81%), Postives = 83/217 (38.25%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS------NPQIIEPVKFTPISIFTNSTLTI-TCKMSGRPVPTISW-RYNWDHLPENL-DYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS 2718
            P  Q +C +  C  E++ CD    C D SDE     N C  N   C+       N  C+     C+G  +C ++ DELNC      +C+   + CN+   +  S  C+G  DC    DE++C+       P  +    +    I   S   I  C+  G     + W R     LP    D N              L + NI  + +G Y CE + 
Sbjct:  573 PCPQHQCPSGRCYTESERCDRHRHCEDGSDE----ANCCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN------------GRLEIPNIRVEDAGTYVCEAVG 764          

HSP 3 Score: 65.855 bits (159), Expect = 2.816e-10
Identity = 70/286 (24.48%), Postives = 121/286 (42.31%), Query Frame = 1
Query: 2692 GIYSCEG---ISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSD----AAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWF-TDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIET-TNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            GIY C G   + +R +I         +   C+   Y   A     C  CYCS L  +C SA  Y          + P D    A ++  ++         I   ++  M  + + +Y  K       Y+    ++ G+ L  YG  L+Y LI+     +Y  G  +V+ G    +      +  P    N+  E N+R++  E + W   D     PA+R DF+ VL +++ +L +        +  +  + ++ A+ T T   + A+ +E C+CP+GY G SCE+
Sbjct: 1716 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY--------RQLIPVDFILNAPLITDESGAVQDTENLIPDISRN-MYTYTHTSYLPK-------YWSLRGSVLGNQLFSYGGRLSYSLIVE-SYGNYERGHDIVLIGNGLKLI-----WSRPDGNENQE-EYNVRLH--EDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 1969          

HSP 4 Score: 62.7734 bits (151), Expect = 2.218e-9
Identity = 47/169 (27.81%), Postives = 67/169 (39.64%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDED------RKKCNECSPNSIHCDF--------------LKDAN--------------PNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            EC  N+ +C N  CID  K C+  +DC +  DE+      R K ++CSP   +CD                 D +              P+ RC  +  +CD    C +  DE NC       C    + CNN   +  S  C+G  +CS   DE +C   Q   P +F
Sbjct:  491 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPTTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSLPCPQHQCPSGRCYTESERCDRHRHCEDGSDEANC-------CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQF 652          

HSP 5 Score: 60.8474 bits (146), Expect = 9.765e-9
Identity = 56/235 (23.83%), Postives = 90/235 (38.30%), Query Frame = 1
Query: 2818 CIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYY-FGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            CI C+CS +  +C S+T Y      + S+   S           Y +P  +    + AA    ++         N  Y+    AF   G+ L+ YG  LTY L  S      LP  ++      D +       RL  Y  ++V  +    Y  E           + A R   +  L ++  +  K  Y        + ++++  A  T      A ++E+C+CP GY GLSCE
Sbjct: 1394 CIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAF--LGNKLSSYGGKLTYTLSYSP-----LPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1618          

HSP 6 Score: 51.6026 bits (122), Expect = 6.445e-6
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDE-DRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK 2355
            C  NQ +C N  C+  +  C+G ++C D+SDE +     EC PN   C+       + +C+    +C+G  DC ++ DE NC   + D+
Sbjct:  607 CYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPNQFRCN-------SGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDR 688          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342823)

HSP 1 Score: 190.274 bits (482), Expect = 2.398e-48
Identity = 161/594 (27.10%), Postives = 248/594 (41.75%), Query Frame = 1
Query: 1831 LKVSPKVVTVKPGGGARFVCELIG-VQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDY-----VTLYVKEE------------CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN---ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC-PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRR--RIIAPDFSVSV--TKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSAT--GYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFT-DHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQT-NFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            LK  P    +K      F C   G  + KV W R   + L      R        LE+ +   +D GT Y C       Y     VT+ +  E            C   Q  C N  CID++  CDG  DC D SDE  + C+   +C PN   C        N +C+ + W+CDG +DCG+N DE +C P  +   C    + C +   IP+S+ CD  PDC+   DE  C  P  I P   + +S+     L +TC  +G P PTI WR NW H+P+  +       S     T +L   ++    SG YSCE I+ R    + PD  V+V   +  +C+  F+N  A   + C++C+C  +   C SA    YA +P ++   +   + + +         P +++            N  +  +  P    Y     +  G+ L  YG  L Y++   G     + GP V+I G          ++ L      +  +NN     +    W   D R    A+R + + +L NV  +L ++ Y +       +  I++  A         A+ +EKC+CP GY G SCE+
Sbjct:  644 LKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN-----GRLEIPNIRVEDAGT-YVCEAVGYASYIPGQQVTVNLNVERYNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDE--QSCSLGLKCQPNQFMCS-------NSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHCIPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQS-VSLLEYEVLELTCVATGTPTPTIVWRLNWGHVPDKCE-------SKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRTDVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQIVINEAAPGQDLLTLLHGVQFRATNVHFSGRETP----YLALPADYMGNQLKSYGGNLRYEVNYRGSGRP-VNGPDVIITGN---------RFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDGR---KASREEIMMILANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCES 1197          

HSP 2 Score: 73.559 bits (179), Expect = 1.287e-12
Identity = 58/219 (26.48%), Postives = 89/219 (40.64%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS------NPQIIEPVKFTPISIFTNSTLTI-TCKMSGRPVPTISW-RYNWDHLPENL-DYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS 2718
            EC  N+ +C N  CID  K C+  +DC +  DE+ ++C  C  N   C+       N  C+     C+G  +C ++ DELNC      +C+   + CN+   +  S  C+G  DC    DE++C+       P  +    +    I   S   I  C+  G     + W R     LP    D N              L + NI  + +G Y CE + 
Sbjct:  518 ECQANEFRCNNGDCIDARKRCNNVSDCSEGEDEN-EEC-RCYANQFRCN-------NGDCVSGSAPCNGYSECSDHSDELNC--GGTQECLPNQFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCAADSNDRRPNQLNLKTYPDSQIIKESREVIFRCRDEGPARAKVKWSRPGGRPLPPGFTDRN------------GRLEIPNIRVEDAGTYVCEAVG 713          

HSP 3 Score: 66.2402 bits (160), Expect = 2.439e-10
Identity = 70/286 (24.48%), Postives = 121/286 (42.31%), Query Frame = 1
Query: 2692 GIYSCEG---ISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSD----AAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWF-TDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIET-TNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            GIY C G   + +R +I         +   C+   Y   A     C  CYCS L  +C SA  Y          + P D    A ++  ++         I   ++  M  + + +Y  K       Y+    ++ G+ L  YG  L+Y LI+     +Y  G  +V+ G    +      +  P    N+  E N+R++  E + W   D     PA+R DF+ VL +++ +L +        +  +  + ++ A+ T T   + A+ +E C+CP+GY G SCE+
Sbjct: 1665 GIYDCRGNECLCKRNVIG-------DQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALY--------RQLIPVDFILNAPLITDESGAVQDTENLIPDISRN-MYTYTHTSYLPK-------YWSLRGSVLGNQLFSYGGRLSYSLIVE-SYGNYERGHDIVLIGNGLKLI-----WSRPDGNENQE-EYNVRLH--EDEQWTRQDRESARPASRSDFMTVLSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES 1918          

HSP 4 Score: 60.8474 bits (146), Expect = 8.994e-9
Identity = 56/235 (23.83%), Postives = 90/235 (38.30%), Query Frame = 1
Query: 2818 CIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYY-FGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            CI C+CS +  +C S+T Y      + S+   S           Y +P  +    + AA    ++         N  Y+    AF   G+ L+ YG  LTY L  S      LP  ++      D +       RL  Y  ++V  +    Y  E           + A R   +  L ++  +  K  Y        + ++++  A  T      A ++E+C+CP GY GLSCE
Sbjct: 1343 CIECFCSGVGLDCDSSTWYRDQ---VTSTFGRSRVDHGFVLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAF--LGNKLSSYGGKLTYTLSYSP-----LPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDEVVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCPEGYLGLSCE 1567          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 197.593 bits (501), Expect = 2.090e-50
Identity = 148/501 (29.54%), Postives = 232/501 (46.31%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR-KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK-CIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQI-IEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVTKGQ---ICQRPFY------NNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFIN-ETYYKKLVP------NPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPG--PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C  +Q  C+N  CI     CDG++DC D SDE R    + C PN   C        N RC +K W+CDG +DC +N DE+NCP K     C    ++C ++   IP SY CD EPDC+   DE  C+ P + + P +   I+     T+T TC   G PVP I+WR NW H+P N   N  T +S       +LT++++     G Y+CE I+ + ++   PD  +S+++     +   PF       +        C+ C+C  +T +C S TG   N + +  + +       +FK      P+R       ++ +  IN ET   +LV       + D ++       G+ +  YG  L +K+  S +     P   P VV+ G      +   +   P     + F  N R   + ++NW  +H      TR D +  L N+  +  +  Y N   +  +S ISM    +  + +    ++E+C+CPAGYSGLSCE+
Sbjct:  199 CRADQATCQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEE--SITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPAN---NRITMISENG--QGTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLSLSQKPNPVVSSSPFILAGNCRDGHFSVGGHCMPCFCFGITKKCQS-TGRYRNQITLRFTEEE------DFKGVNVSFPSRPGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDSYGGYLKFKVSYSLQRGGSEPKVRPDVVLTGSGQKFIYRRGEPTFP-----DTF--NSREIRFTEENW--EHSNGRAVTRDDLMMTLANLESIHIRTIYDNRMASVGLSDISMDTTTKEFSQHGNPREVEECRCPAGYSGLSCES 669          

HSP 2 Score: 71.633 bits (174), Expect = 7.301e-12
Identity = 66/289 (22.84%), Postives = 115/289 (39.79%), Query Frame = 1
Query: 2683 DHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYY-FGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPL--------VVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            D SG   C G    R      +V       C++  ++        C+ C+C  +T +C+S+  Y      + S       A+VN +          +  + +     + N  Y   L   P Y+    A+   G  +  YG  L Y +        Y+PGP         V I G   ++    +  R      ++ FE   R   W++ +        +PATR   + VL ++  +L +  Y+    +  +S + M  A+    S + A ++E+C+CP GYSGLSC++
Sbjct: 1195 DQSGSEGCSGTGVCRC---KMNVEGPTCSSCKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQRTNRIDNGFSVELSTEGTQLSYTNFNY---LGQEPHYWQLPKAYQ--GDKVGAYGGKLKYTI-------SYVPGPRGSPIEDADVQIIGNDITLVARQIWQRGHGARESQDFEIVFREEHWQRPDG-------MPATREHLMMVLADLDDILIRASYHTEMRSSSISGVHMDVAVPEYTSLAQALEVEQCQCPPGYSGLSCQD 1461          

HSP 3 Score: 62.7734 bits (151), Expect = 3.071e-9
Identity = 57/261 (21.84%), Postives = 106/261 (40.61%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKL--VPNPDYYFGGAFNMAGSWLTRYGYPLTYK---------LILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+   ++  A  P+ C++C+C  +T +C+S+T ++ + V             VN +       A   T + +   +    E  Y+    + N  +Y+    N  G  +T YG  L Y+         +++ G+       P VV++G    + H S    LP   +        R   W + +         P TR   +  L ++ + + +  Y +      +S I M  A+  +     A ++E+C CP GYSG SC++
Sbjct:  830 CKTGAFHLTADNPEGCLQCFCMGVTKQCASST-WSRDQV----------RGGVNGQLFTLSNAANTRTIS-EGITQRGSTEVVYRSFTNIHNDIFYWVLPQNFRGDKVTAYGGELKYRVRYEPHARSMVIDGQ-------PDVVLQGSGIFLEHYSQIKPLPRVPA--TITVTFRESAWRRADG-------QPCTREHLLMALADINVFMIRATYADNMAETSLSNIQMDIAVPHSTGNERAMEVEECACPQGYSGPSCQD 1062          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 197.593 bits (501), Expect = 2.224e-50
Identity = 148/501 (29.54%), Postives = 232/501 (46.31%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR-KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK-CIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQI-IEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVTKGQ---ICQRPFY------NNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFIN-ETYYKKLVP------NPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPG--PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C  +Q  C+N  CI     CDG++DC D SDE R    + C PN   C        N RC +K W+CDG +DC +N DE+NCP K     C    ++C ++   IP SY CD EPDC+   DE  C+ P + + P +   I+     T+T TC   G PVP I+WR NW H+P N   N  T +S       +LT++++     G Y+CE I+ + ++   PD  +S+++     +   PF       +        C+ C+C  +T +C S TG   N + +  + +       +FK      P+R       ++ +  IN ET   +LV       + D ++       G+ +  YG  L +K+  S +     P   P VV+ G      +   +   P     + F  N R   + ++NW  +H      TR D +  L N+  +  +  Y N   +  +S ISM    +  + +    ++E+C+CPAGYSGLSCE+
Sbjct:  199 CRADQATCQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEE--SITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPAN---NRITMISENG--QGTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLSLSQKPNPVVSSSPFILAGNCRDGHFSVGGHCMPCFCFGITKKCQS-TGRYRNQITLRFTEEE------DFKGVNVSFPSRPGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDSYGGYLKFKVSYSLQRGGSEPKVRPDVVLTGSGQKFIYRRGEPTFP-----DTF--NSREIRFTEENW--EHSNGRAVTRDDLMMTLANLESIHIRTIYDNRMASVGLSDISMDTTTKEFSQHGNPREVEECRCPAGYSGLSCES 669          

HSP 2 Score: 71.2478 bits (173), Expect = 8.574e-12
Identity = 66/289 (22.84%), Postives = 115/289 (39.79%), Query Frame = 1
Query: 2683 DHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYY-FGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPL--------VVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            D SG   C G    R      +V       C++  ++        C+ C+C  +T +C+S+  Y      + S       A+VN +          +  + +     + N  Y   L   P Y+    A+   G  +  YG  L Y +        Y+PGP         V I G   ++    +  R      ++ FE   R   W++ +        +PATR   + VL ++  +L +  Y+    +  +S + M  A+    S + A ++E+C+CP GYSGLSC++
Sbjct: 1195 DQSGSEGCSGTGVCRC---KMNVEGPTCSSCKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQRTNRIDNGFSVELSTEGTQLSYTNFNY---LGQEPHYWQLPKAYQ--GDKVGAYGGKLKYTI-------SYVPGPRGSPIEDADVQIIGNDITLVARQIWQRGHGARESQDFEIVFREEHWQRPDG-------MPATREHLMMVLADLDDILIRASYHTEMRSSSISGVHMDVAVPEYTSLAQALEVEQCQCPPGYSGLSCQD 1461          

HSP 3 Score: 62.7734 bits (151), Expect = 3.667e-9
Identity = 53/259 (20.46%), Postives = 100/259 (38.61%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYK---------LILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+   ++  A  P+ C++C+C  +T +C+S+T        +   +      + N               + +   + F N       + N  +Y+    N  G  +T YG  L Y+         +++ G+       P VV++G    + H S    LP   +        R   W + +         P TR   +  L ++ + + +  Y +      +S I M  A+  +     A ++E+C CP GYSG SC++
Sbjct:  830 CKTGAFHLTADNPEGCLQCFCMGVTKQCASSTWSRDQ---VRGGVNGQLFTLSNAANTRTISEGITQRGSTEVVYRSFTN-------IHNDIFYWVLPQNFRGDKVTAYGGELKYRVRYEPHARSMVIDGQ-------PDVVLQGSGIFLEHYSQIKPLPRVPA--TITVTFRESAWRRADG-------QPCTREHLLMALADINVFMIRATYADNMAETSLSNIQMDIAVPHSTGNERAMEVEECACPQGYSGPSCQD 1062          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 197.593 bits (501), Expect = 2.371e-50
Identity = 148/501 (29.54%), Postives = 232/501 (46.31%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR-KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK-CIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQI-IEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVTKGQ---ICQRPFY------NNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFIN-ETYYKKLVP------NPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPG--PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C  +Q  C+N  CI     CDG++DC D SDE R    + C PN   C        N RC +K W+CDG +DC +N DE+NCP K     C    ++C ++   IP SY CD EPDC+   DE  C+ P + + P +   I+     T+T TC   G PVP I+WR NW H+P N   N  T +S       +LT++++     G Y+CE I+ + ++   PD  +S+++     +   PF       +        C+ C+C  +T +C S TG   N + +  + +       +FK      P+R       ++ +  IN ET   +LV       + D ++       G+ +  YG  L +K+  S +     P   P VV+ G      +   +   P     + F  N R   + ++NW  +H      TR D +  L N+  +  +  Y N   +  +S ISM    +  + +    ++E+C+CPAGYSGLSCE+
Sbjct:  264 CRADQATCQNGQCISREYLCDGESDCTDGSDESRCGTPSPCEPNEFKCQ-------NGRCALKLWRCDGDNDCQDNSDEMNCPTKRPGAACAPEQFVCLSDRKCIPASYQCDEEPDCADRSDEFGCAPPTVTVSPEE--SITASRGDTVTFTCSAIGVPVPIITWRLNWGHIPAN---NRITMISENG--QGTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLSLSQKPNPVVSSSPFILAGNCRDGHFSVGGHCMPCFCFGITKKCQS-TGRYRNQITLRFTEEE------DFKGVNVSFPSRPGLPQPLSSTQMLINPETEEFQLVDLSRRFLDQDSFWSLPRQFLGNKVDSYGGYLKFKVSYSLQRGGSEPKVRPDVVLTGSGQKFIYRRGEPTFP-----DTF--NSREIRFTEENW--EHSNGRAVTRDDLMMTLANLESIHIRTIYDNRMASVGLSDISMDTTTKEFSQHGNPREVEECRCPAGYSGLSCES 734          

HSP 2 Score: 71.2478 bits (173), Expect = 8.441e-12
Identity = 66/289 (22.84%), Postives = 115/289 (39.79%), Query Frame = 1
Query: 2683 DHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYY-FGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPL--------VVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            D SG   C G    R      +V       C++  ++        C+ C+C  +T +C+S+  Y      + S       A+VN +          +  + +     + N  Y   L   P Y+    A+   G  +  YG  L Y +        Y+PGP         V I G   ++    +  R      ++ FE   R   W++ +        +PATR   + VL ++  +L +  Y+    +  +S + M  A+    S + A ++E+C+CP GYSGLSC++
Sbjct: 1260 DQSGSEGCSGTGVCRC---KMNVEGPTCSSCKQGTFHLSPANKDGCLSCFCMGVTQQCTSSRHYRDVVSTMFSPGNYQGFALVNRQRTNRIDNGFSVELSTEGTQLSYTNFNY---LGQEPHYWQLPKAYQ--GDKVGAYGGKLKYTI-------SYVPGPRGSPIEDADVQIIGNDITLVARQIWQRGHGARESQDFEIVFREEHWQRPDG-------MPATREHLMMVLADLDDILIRASYHTEMRSSSISGVHMDVAVPEYTSLAQALEVEQCQCPPGYSGLSCQD 1526          

HSP 3 Score: 62.7734 bits (151), Expect = 3.460e-9
Identity = 57/261 (21.84%), Postives = 106/261 (40.61%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKL--VPNPDYYFGGAFNMAGSWLTRYGYPLTYK---------LILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+   ++  A  P+ C++C+C  +T +C+S+T ++ + V             VN +       A   T + +   +    E  Y+    + N  +Y+    N  G  +T YG  L Y+         +++ G+       P VV++G    + H S    LP   +        R   W + +         P TR   +  L ++ + + +  Y +      +S I M  A+  +     A ++E+C CP GYSG SC++
Sbjct:  895 CKTGAFHLTADNPEGCLQCFCMGVTKQCASST-WSRDQV----------RGGVNGQLFTLSNAANTRTIS-EGITQRGSTEVVYRSFTNIHNDIFYWVLPQNFRGDKVTAYGGELKYRVRYEPHARSMVIDGQ-------PDVVLQGSGIFLEHYSQIKPLPRVPA--TITVTFRESAWRRADG-------QPCTREHLLMALADINVFMIRATYADNMAETSLSNIQMDIAVPHSTGNERAMEVEECACPQGYSGPSCQD 1127          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 91.2781 bits (225), Expect = 6.467e-18
Identity = 48/137 (35.04%), Postives = 69/137 (50.36%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR--KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            +C  N   C N  C+  +  CDG +DC DNSDE       N CSP +  C        N+RC+ + W CDG +DC +  DE +CP +    C    ++C N+  IPR++ CD + DC    DE +C +     P +F
Sbjct: 1017 QCGSNSFSCSNGKCVPHSYQCDGVDDCHDNSDEAHCGAHNNTCSPLAFTC-------ANQRCVPRSWHCDGHNDCFDGSDERDCPTQTPGTCPADQFICANHYCIPRTWLCDTDNDCGDGSDENNCDSIGTCYPGQF 1146          

HSP 2 Score: 83.9593 bits (206), Expect = 1.309e-15
Identity = 51/128 (39.84%), Postives = 60/128 (46.88%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECS---PNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL--NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            CP    +CKN  C+ ++  CDG NDCGDNSDE+   C + S   P    CD       N RCI  H  C+ IDDCG+  DE   +C       C    Y C N   IP  Y CD   DC    DE  C
Sbjct: 3859 CPPFLFECKNHVCVQQHWICDGDNDCGDNSDEELHLCLDISCDPPFRFRCD-------NNRCIYSHEVCNSIDDCGDGTDERAEHCVTPTHGPCSADEYKCGNGQCIPLQYACDDYDDCEDQSDELGC 3979          

HSP 3 Score: 83.1889 bits (204), Expect = 2.189e-15
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 2068 VTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEEDC 2460
              L    +C  +Q +C N+ CI E   CDG+NDCGD SDED   C+   C P    C        N RCI   W+CD  DDCG+N DE   P++   +C+G  Y C+N+           +P    C+G  DC    DE++C
Sbjct: 3603 TVLCATHQCESHQWQCANKRCISEAWQCDGENDCGDGSDEDPAHCSSRTCRPGQFKCR-------NGRCIPNTWKCDVDDDCGDNSDE---PIE---ECMGPAYRCDNHTEFDCRTNYRCVPLWAVCNGHNDCRDNSDEQNC 3731          

HSP 4 Score: 82.4185 bits (202), Expect = 4.152e-15
Identity = 51/128 (39.84%), Postives = 64/128 (50.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDED-RKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            C   Q +C +  CI  +  CDG NDCGD SDED R  C    CS     C  + +  P ++CI + W CDG  DC + FDE  NC    +  C    + CNN L I  SY CD   DC    DE+ C+
Sbjct: 2924 CNSEQFRCDDGRCIASSWICDGDNDCGDMSDEDQRHNCANRTCSAQEFTC--VNNRPPQRKCIPRDWVCDGDADCSDAFDEHQNC---TRRSCSTNEFTCNNGLCIRSSYRCDRRNDCGDSSDEQGCT 3046          

HSP 5 Score: 76.6406 bits (187), Expect = 2.160e-13
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
             +  C  N+  C N  CI  +  CD +NDCGD+SDE       C  +   C        N RCI + + CDG +DCG+  DEL+   +     C   H+ C+N   +P+S  CD   DCS   DE+ C   +  +P
Sbjct: 3007 TRRSCSTNEFTCNNGLCIRSSYRCDRRNDCGDSSDEQGCTYQPCQQHQFTCQ-------NGRCISRDFLCDGDNDCGDESDELDHLCRMPAPTCPSGHFRCDNGNCVPQSQVCDRNDDCSDNSDEKGCGINECTDP 3135          

HSP 6 Score: 74.7146 bits (182), Expect = 8.106e-13
Identity = 46/127 (36.22%), Postives = 59/127 (46.46%), Query Frame = 1
Query: 2083 KEECPLNQRKCKN-ETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            +  C     KC++   CI  +  CDG NDCGDNSDE    C  + CS N   C        + RCI  HW CDG  DC +  DE          C    + C++   I  S+ CDG+ DC  M DE+
Sbjct: 2837 ERTCQPEHTKCQSTNICIPRSYLCDGDNDCGDNSDESPTHCATSTCSHNEFRCS-------SGRCIPGHWYCDGGTDCNDGSDEPITCTSLVRTCNSEQFRCDDGRCIASSWICDGDNDCGDMSDED 2956          

HSP 7 Score: 73.559 bits (179), Expect = 2.013e-12
Identity = 50/133 (37.59%), Postives = 67/133 (50.38%), Query Frame = 1
Query: 2065 YVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNS-IHCDFLKDANPNKRCIIKHWQCDGIDDCGNNF--DELNCPVKNKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDE 2451
            +++L     C      C N  C+  +  CD  NDCGDNSDE       C PN+   C+       N RCI + + C+GI++C +N   DE NCP +    C   H  C + N+ IPRSY CDG+ DC    DE
Sbjct: 2750 FISLSAFHTCEPTVFTCGNGRCVPYHYRCDHYNDCGDNSDETGCIFRPCDPNTEFSCN-------NGRCIAREYICNGINNCYDNGTSDEQNCPERT---CQPEHTKCQSTNICIPRSYLCDGDNDCGDNSDE 2872          

HSP 8 Score: 72.0182 bits (175), Expect = 5.304e-12
Identity = 45/132 (34.09%), Postives = 62/132 (46.97%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE--EDCSNP 2469
              C L Q +C +  C   +  C+   DC D SDED   C  ++C  +   C        NKRCI + WQCDG +DCG+  DE      ++  C    + C N   IP ++ CD + DC    DE  E+C  P
Sbjct: 3568 RHCRLGQFQCNDGNCTSPHFLCNSNQDCPDGSDEDTVLCATHQCESHQWQC-------ANKRCISEAWQCDGENDCGDGSDEDPAHCSSR-TCRPGQFKCRNGRCIPNTWKCDVDDDCGDNSDEPIEECMGP 3691          

HSP 9 Score: 71.2478 bits (173), Expect = 9.170e-12
Identity = 46/125 (36.80%), Postives = 58/125 (46.40%), Query Frame = 1
Query: 2110 KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            +C    CI  ++ CDG NDC DNSDE       C      C  L D      CI +HW CD  +DC +  DE  +CP +    C  + + C N   IP  Y CD  PDC    DE +C  P+  E
Sbjct:   29 RCGTGRCIPVSQRCDGTNDCSDNSDEIGCPQPTCESAQFQC--LSDG----ECIPQHWVCDDEEDCEDGSDERQHCPGRT---CSSSQFTCTNGACIPGGYRCDRVPDCLDGADERNCFYPECSE 144          

HSP 10 Score: 68.5514 bits (166), Expect = 6.049e-11
Identity = 42/122 (34.43%), Postives = 54/122 (44.26%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            P    +C N  CI     CDG NDCGD SDE       C+ +   CD       N  CI   W CD  +DC +N DE +C ++    C   ++ C +   I   + CDG  DC    DE  C
Sbjct: 3738 PSGDFRCDNHQCIPLRWRCDGDNDCGDGSDELNCSPRPCTESEYRCD-------NLHCIPDRWVCDHDNDCEDNSDERDCELRT---CHPGYFQCASGHCIAERFKCDGNADCLDFTDESSC 3849          

HSP 11 Score: 68.1662 bits (165), Expect = 8.762e-11
Identity = 41/123 (33.33%), Postives = 60/123 (48.78%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK--NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C  ++ +C N  CI +   CD  NDC DNSDE   +   C P    C        +  CI + ++CDG  DC +  DE +CP +  N   C    + C N++ + + + CDG+ DC    DEE
Sbjct: 3776 CTESEYRCDNLHCIPDRWVCDHDNDCEDNSDERDCELRTCHPGYFQC-------ASGHCIAERFKCDGNADCLDFTDESSCPTRYPNSTYCPPFLFECKNHVCVQQHWICDGDNDCGDNSDEE 3891          

HSP 12 Score: 67.0106 bits (162), Expect = 1.733e-10
Identity = 44/136 (32.35%), Postives = 65/136 (47.79%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            C   Q +C +  CID N  CDG  DC D +DE       C  N    +F K AN   +C+  +++CDG+ DC +  DE  CP +    C   + + C ++   +P ++ CDG PDC    DE     P+     +F
Sbjct: 1141 CYPGQFQCPDHRCIDPNYVCDGDRDCADGADE-----QGCVYNCTAYEF-KCAN-GHQCVNSYYRCDGVFDCNDRSDESGCPTRPPGMCHHESEFQCQSDGSCVPVNWECDGHPDCEDGSDEHHACPPRTCPTTQF 1269          

HSP 13 Score: 66.2402 bits (160), Expect = 2.848e-10
Identity = 43/123 (34.96%), Postives = 56/123 (45.53%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            + C   Q +C N  CI     CD  +DCGD SDE       C      C       P+ RCI + W CDG DDC +N DE  C    + +C    + C ++ + IP  + CDG   C   EDE
Sbjct:  176 QRCSSGQFQCSNGECIPRGYICDHDDDCGDRSDEQNCTYPTCRGTYFTC-------PSGRCIHQVWLCDGEDDCEDNADEKGCDNVQR-ECYPGEWPCPSSGVCIPFDHLCDGTVHCPDGEDE 290          

HSP 14 Score: 66.2402 bits (160), Expect = 2.921e-10
Identity = 43/122 (35.25%), Postives = 58/122 (47.54%), Query Frame = 1
Query: 2110 KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQ 2472
            +C N  C + ++ CD   +C D SDE    C + CS     C        N  CI + + CD  DDCG+  DE NC       C GT++ C +   I + + CDGE DC    DE+ C N Q
Sbjct:  146 RCANGACFNRSQRCDQVLNCRDGSDE--ANCTQRCSSGQFQCS-------NGECIPRGYICDHDDDCGDRSDEQNCTYPT---CRGTYFTCPSGRCIHQVWLCDGEDDCEDNADEKGCDNVQ 255          

HSP 15 Score: 60.077 bits (144), Expect = 2.087e-8
Identity = 41/126 (32.54%), Postives = 56/126 (44.44%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            C  +Q  C N  CI     CD   DC D +DE      ECS   + C        N  C  +  +CD + +C +  DE NC      +C    + C+N   IPR Y CD + DC    DE++C+ P
Sbjct:  103 CSSSQFTCTNGACIPGGYRCDRVPDCLDGADERNCFYPECS--ELRC-------ANGACFNRSQRCDQVLNCRDGSDEANC----TQRCSSGQFQCSNGECIPRGYICDHDDDCGDRSDEQNCTYP 215          

HSP 16 Score: 55.4546 bits (132), Expect = 5.515e-7
Identity = 44/138 (31.88%), Postives = 60/138 (43.48%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTP 2499
            + C  +Q  C+N  CI  +  CDG NDCGD SDE    C   +P      F  D   N  C+ +   CD  DDC +N DE  C + N+      H+  +N      S+ C   P    M D + C +   I+    TP
Sbjct: 3048 QPCQQHQFTCQNGRCISRDFLCDGDNDCGDESDELDHLCRMPAPTCPSGHFRCD---NGNCVPQSQVCDRNDDCSDNSDEKGCGI-NECTDPSMHHCDHNCTDTLTSFICTCRPGYRLMSDNKTCDD---IDECSVTP 3178          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 91.2781 bits (225), Expect = 6.686e-18
Identity = 48/137 (35.04%), Postives = 69/137 (50.36%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR--KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            +C  N   C N  C+  +  CDG +DC DNSDE       N CSP +  C        N+RC+ + W CDG +DC +  DE +CP +    C    ++C N+  IPR++ CD + DC    DE +C +     P +F
Sbjct:  996 QCGSNSFSCSNGKCVPHSYQCDGVDDCHDNSDEAHCGAHNNTCSPLAFTC-------ANQRCVPRSWHCDGHNDCFDGSDERDCPTQTPGTCPADQFICANHYCIPRTWLCDTDNDCGDGSDENNCDSIGTCYPGQF 1125          

HSP 2 Score: 83.9593 bits (206), Expect = 1.287e-15
Identity = 51/128 (39.84%), Postives = 60/128 (46.88%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECS---PNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL--NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            CP    +CKN  C+ ++  CDG NDCGDNSDE+   C + S   P    CD       N RCI  H  C+ IDDCG+  DE   +C       C    Y C N   IP  Y CD   DC    DE  C
Sbjct: 3838 CPPFLFECKNHVCVQQHWICDGDNDCGDNSDEELHLCLDISCDPPFRFRCD-------NNRCIYSHEVCNSIDDCGDGTDERAEHCVTPTHGPCSADEYKCGNGQCIPLQYACDDYDDCEDQSDELGC 3958          

HSP 3 Score: 83.1889 bits (204), Expect = 2.225e-15
Identity = 52/142 (36.62%), Postives = 70/142 (49.30%), Query Frame = 1
Query: 2068 VTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEEDC 2460
              L    +C  +Q +C N+ CI E   CDG+NDCGD SDED   C+   C P    C        N RCI   W+CD  DDCG+N DE   P++   +C+G  Y C+N+           +P    C+G  DC    DE++C
Sbjct: 3582 TVLCATHQCESHQWQCANKRCISEAWQCDGENDCGDGSDEDPAHCSSRTCRPGQFKCR-------NGRCIPNTWKCDVDDDCGDNSDE---PIE---ECMGPAYRCDNHTEFDCRTNYRCVPLWAVCNGHNDCRDNSDEQNC 3710          

HSP 4 Score: 82.4185 bits (202), Expect = 4.151e-15
Identity = 51/128 (39.84%), Postives = 64/128 (50.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDED-RKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            C   Q +C +  CI  +  CDG NDCGD SDED R  C    CS     C  + +  P ++CI + W CDG  DC + FDE  NC    +  C    + CNN L I  SY CD   DC    DE+ C+
Sbjct: 2903 CNSEQFRCDDGRCIASSWICDGDNDCGDMSDEDQRHNCANRTCSAQEFTC--VNNRPPQRKCIPRDWVCDGDADCSDAFDEHQNC---TRRSCSTNEFTCNNGLCIRSSYRCDRRNDCGDSSDEQGCT 3025          

HSP 5 Score: 76.6406 bits (187), Expect = 2.088e-13
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
             +  C  N+  C N  CI  +  CD +NDCGD+SDE       C  +   C        N RCI + + CDG +DCG+  DEL+   +     C   H+ C+N   +P+S  CD   DCS   DE+ C   +  +P
Sbjct: 2986 TRRSCSTNEFTCNNGLCIRSSYRCDRRNDCGDSSDEQGCTYQPCQQHQFTCQ-------NGRCISRDFLCDGDNDCGDESDELDHLCRMPAPTCPSGHFRCDNGNCVPQSQVCDRNDDCSDNSDEKGCGINECTDP 3114          

HSP 6 Score: 74.7146 bits (182), Expect = 8.172e-13
Identity = 46/127 (36.22%), Postives = 59/127 (46.46%), Query Frame = 1
Query: 2083 KEECPLNQRKCKN-ETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            +  C     KC++   CI  +  CDG NDCGDNSDE    C  + CS N   C        + RCI  HW CDG  DC +  DE          C    + C++   I  S+ CDG+ DC  M DE+
Sbjct: 2816 ERTCQPEHTKCQSTNICIPRSYLCDGDNDCGDNSDESPTHCATSTCSHNEFRCS-------SGRCIPGHWYCDGGTDCNDGSDEPITCTSLVRTCNSEQFRCDDGRCIASSWICDGDNDCGDMSDED 2935          

HSP 7 Score: 73.559 bits (179), Expect = 2.013e-12
Identity = 50/133 (37.59%), Postives = 67/133 (50.38%), Query Frame = 1
Query: 2065 YVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNS-IHCDFLKDANPNKRCIIKHWQCDGIDDCGNNF--DELNCPVKNKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDE 2451
            +++L     C      C N  C+  +  CD  NDCGDNSDE       C PN+   C+       N RCI + + C+GI++C +N   DE NCP +    C   H  C + N+ IPRSY CDG+ DC    DE
Sbjct: 2729 FISLSAFHTCEPTVFTCGNGRCVPYHYRCDHYNDCGDNSDETGCIFRPCDPNTEFSCN-------NGRCIAREYICNGINNCYDNGTSDEQNCPER---TCQPEHTKCQSTNICIPRSYLCDGDNDCGDNSDE 2851          

HSP 8 Score: 72.0182 bits (175), Expect = 5.214e-12
Identity = 45/132 (34.09%), Postives = 62/132 (46.97%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE--EDCSNP 2469
              C L Q +C +  C   +  C+   DC D SDED   C  ++C  +   C        NKRCI + WQCDG +DCG+  DE      ++  C    + C N   IP ++ CD + DC    DE  E+C  P
Sbjct: 3547 RHCRLGQFQCNDGNCTSPHFLCNSNQDCPDGSDEDTVLCATHQCESHQWQC-------ANKRCISEAWQCDGENDCGDGSDEDPAHCSSR-TCRPGQFKCRNGRCIPNTWKCDVDDDCGDNSDEPIEECMGP 3670          

HSP 9 Score: 71.2478 bits (173), Expect = 9.244e-12
Identity = 46/125 (36.80%), Postives = 58/125 (46.40%), Query Frame = 1
Query: 2110 KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            +C    CI  ++ CDG NDC DNSDE       C      C  L D      CI +HW CD  +DC +  DE  +CP +    C  + + C N   IP  Y CD  PDC    DE +C  P+  E
Sbjct:    8 RCGTGRCIPVSQRCDGTNDCSDNSDEIGCPQPTCESAQFQC--LSDG----ECIPQHWVCDDEEDCEDGSDERQHCPGRT---CSSSQFTCTNGACIPGGYRCDRVPDCLDGADERNCFYPECSE 123          

HSP 10 Score: 68.5514 bits (166), Expect = 6.047e-11
Identity = 42/122 (34.43%), Postives = 54/122 (44.26%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            P    +C N  CI     CDG NDCGD SDE       C+ +   CD       N  CI   W CD  +DC +N DE +C ++    C   ++ C +   I   + CDG  DC    DE  C
Sbjct: 3717 PSGDFRCDNHQCIPLRWRCDGDNDCGDGSDELNCSPRPCTESEYRCD-------NLHCIPDRWVCDHDNDCEDNSDERDCELR---TCHPGYFQCASGHCIAERFKCDGNADCLDFTDESSC 3828          

HSP 11 Score: 68.1662 bits (165), Expect = 8.833e-11
Identity = 41/123 (33.33%), Postives = 60/123 (48.78%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK--NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C  ++ +C N  CI +   CD  NDC DNSDE   +   C P    C        +  CI + ++CDG  DC +  DE +CP +  N   C    + C N++ + + + CDG+ DC    DEE
Sbjct: 3755 CTESEYRCDNLHCIPDRWVCDHDNDCEDNSDERDCELRTCHPGYFQC-------ASGHCIAERFKCDGNADCLDFTDESSCPTRYPNSTYCPPFLFECKNHVCVQQHWICDGDNDCGDNSDEE 3870          

HSP 12 Score: 67.0106 bits (162), Expect = 1.777e-10
Identity = 44/136 (32.35%), Postives = 65/136 (47.79%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            C   Q +C +  CID N  CDG  DC D +DE       C  N    +F K AN   +C+  +++CDG+ DC +  DE  CP +    C   + + C ++   +P ++ CDG PDC    DE     P+     +F
Sbjct: 1120 CYPGQFQCPDHRCIDPNYVCDGDRDCADGADE-----QGCVYNCTAYEF-KCAN-GHQCVNSYYRCDGVFDCNDRSDESGCPTRPPGMCHHESEFQCQSDGSCVPVNWECDGHPDCEDGSDEHHACPPRTCPTTQF 1248          

HSP 13 Score: 66.2402 bits (160), Expect = 2.707e-10
Identity = 43/123 (34.96%), Postives = 56/123 (45.53%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            + C   Q +C N  CI     CD  +DCGD SDE       C      C       P+ RCI + W CDG DDC +N DE  C    + +C    + C ++ + IP  + CDG   C   EDE
Sbjct:  155 QRCSSGQFQCSNGECIPRGYICDHDDDCGDRSDEQNCTYPTCRGTYFTC-------PSGRCIHQVWLCDGEDDCEDNADEKGCDNVQR-ECYPGEWPCPSSGVCIPFDHLCDGTVHCPDGEDE 269          

HSP 14 Score: 66.2402 bits (160), Expect = 2.920e-10
Identity = 43/122 (35.25%), Postives = 58/122 (47.54%), Query Frame = 1
Query: 2110 KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQ 2472
            +C N  C + ++ CD   +C D SDE    C + CS     C        N  CI + + CD  DDCG+  DE NC       C GT++ C +   I + + CDGE DC    DE+ C N Q
Sbjct:  125 RCANGACFNRSQRCDQVLNCRDGSDE--ANCTQRCSSGQFQCS-------NGECIPRGYICDHDDDCGDRSDEQNCTYPT---CRGTYFTCPSGRCIHQVWLCDGEDDCEDNADEKGCDNVQ 234          

HSP 15 Score: 60.077 bits (144), Expect = 2.086e-8
Identity = 41/126 (32.54%), Postives = 56/126 (44.44%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            C  +Q  C N  CI     CD   DC D +DE      ECS   + C        N  C  +  +CD + +C +  DE NC      +C    + C+N   IPR Y CD + DC    DE++C+ P
Sbjct:   82 CSSSQFTCTNGACIPGGYRCDRVPDCLDGADERNCFYPECS--ELRC-------ANGACFNRSQRCDQVLNCRDGSDEANC----TQRCSSGQFQCSNGECIPRGYICDHDDDCGDRSDEQNCTYP 194          

HSP 16 Score: 55.4546 bits (132), Expect = 5.560e-7
Identity = 44/138 (31.88%), Postives = 60/138 (43.48%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTP 2499
            + C  +Q  C+N  CI  +  CDG NDCGD SDE    C   +P      F  D   N  C+ +   CD  DDC +N DE  C + N+      H+  +N      S+ C   P    M D + C +   I+    TP
Sbjct: 3027 QPCQQHQFTCQNGRCISRDFLCDGDNDCGDESDELDHLCRMPAPTCPSGHFRCD---NGNCVPQSQVCDRNDDCSDNSDEKGCGI-NECTDPSMHHCDHNCTDTLTSFICTCRPGYRLMSDNKTCDD---IDECSVTP 3157          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 193.356 bits (490), Expect = 5.586e-49
Identity = 138/489 (28.22%), Postives = 220/489 (44.99%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR-KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APD--FSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYK--PAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKL--ILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
             +C  ++ +C N  CI  +  CDG+ DC D SDE      + C PN   C        N RC +K W+CDG +DCG+  DELNCP K   D C    ++C      IP SY CD E DC    DE  C+ PQ+I P + + I      T+  TC   G P P I+WR NW H+P +   ++T+   +      +L ++++     G Y+CE I+ + ++   PD    +   +G   +  FY  ++     CI C+C  +T  C   TG   N + +   + P D   VNF    +    P          +++ F      ++ + + D ++       G+ +  YG  L++K+   L+   S+ +  P V++ G    +      YR  V  S +    N R   + ++NW   H      TR D +  L+N+  ++ +  Y N   +  +S I M            A  +E+C+CP GY+G SCE
Sbjct:  250 RQCRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEES-IMASRGDTVRFTCVAIGVPTPIITWRLNWGHIPTSSRVSMTSENGH-----GTLIIRDVKEADQGAYTCEAINAKGMVFGIPDGVLILKPHRGPCPEGSFYVENS---ARCIPCFCFGVTKVCQQ-TGRYRNQIRLRFDV-PEDFKGVNFTVPSHVGIPPLSSNQLQIDTSVEEFQLVDLSRRFL-SIDSFWTLPGQFLGNKVDSYGGSLSFKVRYGLTRGQSEPVRKPDVILVGNGRKLI-----YR--VQTSTQPSIVNQRKIQFTEENW--QHESGASVTREDLLMTLQNLEAIMIQTVYDNKMASVGISDIVMDTTSVEYTQLGPAVGVEECRCPGGYAGPSCE 710          

HSP 2 Score: 67.781 bits (164), Expect = 1.396e-10
Identity = 62/252 (24.60%), Postives = 112/252 (44.44%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVNFK---------TKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSI--YHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            P  C+ C+C  +T +C+S+T +     LI +   P +    A+VN +         T E  +   ++T    ++      E+YY +L   P+ Y G   +   S+  +  Y LTY    +G     LP   V I G   ++  Y   ++ R      ++ FE   R   W++ +         PATR   +  L ++  +L +  Y     +  ++ +SM+ A  +  +   A ++E+C+CP GY GLSC++
Sbjct: 1230 PDGCLPCFCMGVTQQCTSSTYHRK---LISTPFLPGNFQNFALVNRQRSSRITSGFTVEMSRHGPQLT---HSSFDQLGQESYYWQL---PEGYQG---DKVASYGGKLRYTLTYN---AGIRGSALPDADVQITGNDITLVAYQHDLRPR-----ESKSFEIVFRESSWKRPDG-------QPATREHLMMALADLDEILVRASYSTDMLSSSITGVSMETAGPSYTNLPQALEVEECRCPPGYQGLSCQD 1454          

HSP 3 Score: 59.6918 bits (143), Expect = 4.443e-8
Identity = 66/278 (23.74%), Postives = 105/278 (37.77%), Query Frame = 1
Query: 2725 RIIAPDFSVSVTKGQICQR----PFYNNDAWYPQMCIRCYCSNLTDECSSA-------TGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSG-ENSDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            R   P  S S  +G  C       FY ++   P  C++C+C  +T +CSS+       +G    P  I ++      +              E+TF+N      F+N       VP   Y++       G  +T YG  L Y +       S  L G P VV++G    + H +     P +          R   W + +          ATR   +  L ++ L++ +  Y       ++S I M  A+        A ++E C CP GYSG SC+
Sbjct:  835 RCEPPLLSQSHVEGNFCNECKSGTFYLSEK-NPDGCLKCFCMGITRQCSSSFWNRDQVSGCYRVPFTISNA-----GSTRTLSESIRVTGQSELTFSN------FLN-------VPQDVYFWVLPDRFKGDKVTSYGGELRYTITFEAPAGSQPLFGQPDVVLQGNGIFLEHSANTRTAPGFPITITVP--FRERAWRRADGQD-------ATREHLLMALADIDLLMIRASYAERMVETRISNIHMDVAVPYPTDRQRAVEVEHCVCPPGYSGPSCQ 1084          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 191.045 bits (484), Expect = 3.324e-48
Identity = 139/488 (28.48%), Postives = 216/488 (44.26%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR-KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APD--FSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYK--PAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLI--LSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            +C  ++ +C N  CI  +  CDG+ DC D SDE      + C PN   C        N RC +K W+CDG +DCG+  DELNCP K   D C    ++C      IP SY CD E DC    DE  C+ PQ+I P + + I      T+  TC   G P P I+WR NW H+P +   N   T          L ++++     G Y+CE I+ + ++   PD    +   +G   +  FY  ++     CI C+C  +T  C   TG   N + +   + P D   VNF    +    P          +++ F      ++ + + D ++       G+ +  YG  L++K+   L+   S+ +  P V++ G    +      YR  V  S +    N R   + ++NW   H      TR D +  L+N+  ++ +  Y N   +  +S I M            A  +E+C+CP GY+G SCE
Sbjct:  194 QCRRDEARCPNGQCIPRDYLCDGEKDCKDGSDEMHCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPEES-IMASRGDTVRFTCVAIGVPTPIITWRLNWGHIPTSSSENGHGT----------LIIRDVKEADQGAYTCEAINAKGMVFGIPDGVLILKPHRGPCPEGSFYVENS---ARCIPCFCFGVTKVCQQ-TGRYRNQIRLRFDV-PEDFKGVNFTVPSHVGIPPLSSNQLQIDTSVEEFQLVDLSRRFL-SIDSFWTLPGQFLGNKVDSYGGSLSFKVRYGLTRGQSEPVRKPDVILVGNGRKLI-----YR--VQTSTQPSIVNQRKIQFTEENW--QHESGASVTREDLLMTLQNLEAIMIQTVYDNKMASVGISDIVMDTTSVEYTQLGPAVGVEECRCPGGYAGPSCE 648          

HSP 2 Score: 67.781 bits (164), Expect = 1.469e-10
Identity = 62/252 (24.60%), Postives = 112/252 (44.44%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVNFK---------TKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSI--YHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            P  C+ C+C  +T +C+S+T +     LI +   P +    A+VN +         T E  +   ++T    ++      E+YY +L   P+ Y G   +   S+  +  Y LTY    +G     LP   V I G   ++  Y   ++ R      ++ FE   R   W++ +         PATR   +  L ++  +L +  Y     +  ++ +SM+ A  +  +   A ++E+C+CP GY GLSC++
Sbjct: 1134 PDGCLPCFCMGVTQQCTSSTYHRK---LISTPFLPGNFQNFALVNRQRSSRITSGFTVEMSRHGPQLT---HSSFDQLGQESYYWQL---PEGYQG---DKVASYGGKLRYTLTYN---AGIRGSALPDADVQITGNDITLVAYQHDLRPR-----ESKSFEIVFRESSWKRPDG-------QPATREHLMMALADLDEILVRASYSTDMLSSSITGVSMETAGPSYTNLPQALEVEECRCPPGYQGLSCQD 1358          

HSP 3 Score: 60.4622 bits (145), Expect = 2.193e-8
Identity = 67/278 (24.10%), Postives = 106/278 (38.13%), Query Frame = 1
Query: 2725 RIIAPDFSVSVTKGQICQR----PFYNNDAWYPQMCIRCYCSNLTDECSSA-------TGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSG-ENSDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            R   P  S S  +G  C       FY ++   P  C++C+C  +T +CSS+       +GY   P  I ++      +              E+TF+N      F+N       VP   Y++       G  +T YG  L Y +       S  L G P VV++G    + H +     P +          R   W + +          ATR   +  L ++ L++ +  Y       ++S I M  A+        A ++E C CP GYSG SC+
Sbjct:  773 RCEPPLLSQSHVEGNFCNECKSGTFYLSEK-NPDGCLKCFCMGITRQCSSSFWNRDQVSGYRV-PFTISNA-----GSTRTLSESIRVTGQSELTFSN------FLN-------VPQDVYFWVLPDRFKGDKVTSYGGELRYTITFEAPAGSQPLFGQPDVVLQGNGIFLEHSANTRTAPGFPITITVP--FRERAWRRADGQD-------ATREHLLMALADIDLLMIRASYAERMVETRISNIHMDVAVPYPTDRQRAVEVEHCVCPPGYSGPSCQ 1021          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: sel1l (SEL1L adaptor subunit of ERAD E3 ubiquitin ligase [Source:Xenbase;Acc:XB-GENE-973992])

HSP 1 Score: 189.504 bits (480), Expect = 8.149e-48
Identity = 139/490 (28.37%), Postives = 220/490 (44.90%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC---NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APD--FSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYY--KPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLI--LSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            +C  ++ +C N  CI  +  CDG+ DC D SDE    C   + C PN   C        N RC +K W+CDG +DCG+  DELNCP K   D C    ++C      IP SY CD E DC    DE  C+ PQ+I P +   I      T+  TC   G P P I+WR NW H+P +   ++T+   +      +L ++++     G Y+CE I+ + ++   PD    +   +G   +  FY  ++     CI C+C  +T  C   TG   N + +   + P D   VNF    +    P          +++ F      ++ + + D ++       G+ +  YG  L++K+   L+   S+ +  P V++ G    +      YR  V  S +    N R   + ++NW   H      TR D +  L+N+  ++ +  Y N   +  +S I M            A  +E+C+CP GY+G SCE
Sbjct:  218 QCRRDEARCPNGQCIPRDYLCDGEKDCKDGSDE--MHCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCGDGSDELNCPTKGPSDTCAPDQFVCVQARTCIPASYQCDDEADCPDRSDEVGCNPPQVITPPE-ESIMASRGDTVRFTCVAIGVPTPIITWRLNWGHIPTSSRVSMTSENGH-----GTLIIRDVKEADQGAYTCEAINAKGMVFGIPDGVLILKPHRGPCPEGSFYVENS---ARCIPCFCFGVTKVCQQ-TGRYRNQIRLRFDV-PEDFKGVNFTVPSHVGIPPLSSNQLQIDTSVEEFQLVDLSRRFL-SIDSFWTLPGQFLGNKVDSYGGSLSFKVRYGLTRGQSEPVRKPDVILVGNGRKLI-----YR--VQTSTQPSIVNQRKIQFTEENW--QHESGASVTREDLLMTLQNLEAIMIQTVYDNKMASVGISDIVMDTTSVEYTQLGPAVGVEECRCPGGYAGPSCE 677          

HSP 2 Score: 61.6178 bits (148), Expect = 1.137e-8
Identity = 62/252 (24.60%), Postives = 112/252 (44.44%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKP---SDAAIVNFK---------TKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSI--YHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            P  C+ C+C  +T +C+S+T +     LI +   P    + A+VN +         T E  +   ++T    ++      E+YY +L   P+ Y G   +   S+  +  Y LTY    +G     LP   V I G   ++  Y   ++ R      ++ FE   R   W++ +         PATR   +  L ++  +L +  Y     +  ++ +SM+ A  +  +   A ++E+C+CP GY GLSC++
Sbjct: 1180 PDGCLPCFCMGVTQQCTSSTYHRK---LISTPFLPGNFQNFALVNRQRSSRITSGFTVEMSRHGPQLT---HSSFDQLGQESYYWQL---PEGYQG---DKVASYGGKLRYTLTYN---AGIRGSALPDADVQITGNDITLVAYQHDLRPR-----ESKSFEIVFRESSWKRPD-------GQPATREHLMMALADLDEILVRASYSTDMLSSSITGVSMETAGPSYTNLPQALEVEECRCPPGYQGLSCQD 1404          

HSP 3 Score: 55.8398 bits (133), Expect = 6.244e-7
Identity = 67/278 (24.10%), Postives = 106/278 (38.13%), Query Frame = 1
Query: 2725 RIIAPDFSVSVTKGQICQR----PFYNNDAWYPQMCIRCYCSNLTDECSSA-------TGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSG-ENSDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            R   P  S S  +G  C       FY ++   P  C++C+C  +T +CSS+       +GY   P  I ++      +              E+TF+N      F+N       VP   Y++       G  +T YG  L Y +       S  L G P VV++G    + H +     P +          R   W + +          ATR   +  L ++ L++ +  Y       ++S I M  A+        A ++E C CP GYSG SC+
Sbjct:  800 RCEPPLLSQSHVEGNFCNECKSGTFYLSEK-NPDGCLKCFCMGITRQCSSSFWNRDQVSGYRV-PFTISNA-----GSTRTLSESIRVTGQSELTFSN------FLN-------VPQDVYFWVLPDRFKGDKVTSYGGELRYTITFEAPAGSQPLFGQPDVVLQGNGIFLEHSANTRTAPGFPITITVP--FRERAWRRAD-------GQDATREHLLMALADIDLLMIRASYAERMVETRISNIHMDVAVPYPTDRQRAVEVEHCVCPPGYSGPSCQ 1048          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: lpp (LIM domain containing preferred translocation partner in lipoma [Source:Xenbase;Acc:XB-GENE-951633])

HSP 1 Score: 82.8037 bits (203), Expect = 1.316e-15
Identity = 50/155 (32.26%), Postives = 72/155 (46.45%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL--NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSG 2550
            CP  +  C+N  CI     C+G+NDC D SDE      +CSP    C  L        C+ +   CDG  DC    DEL   C  +++  C    + C+ +  +P+++ CDG PDC    DEE C  P     V+  P  +  NS+  I   ++G
Sbjct:   21 CPSFKFHCRNRQCIAAELACNGQNDCTDGSDEVGCPPQQCSPEEFRCGSL--------CLSRSLLCDGKIDCAGGLDELKEKCKGQSRLHCPTDEFECDGH-CVPKAWRCDGHPDCEDQSDEELCEVPT----VELEPFLLTFNSSEIIKGDLTG 162          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Match: LRP1 (LDL receptor related protein 1 [Source:NCBI gene;Acc:100485788])

HSP 1 Score: 83.5741 bits (205), Expect = 2.142e-15
Identity = 52/133 (39.10%), Postives = 64/133 (48.12%), Query Frame = 1
Query: 2083 KEECPLN-----QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN 2466
            KEEC        Q +CKN  C+     CD  NDCGDNSDE+      CS +   C        N RCI   W+CDG  DC +  DE +C V    +C    + CNN   IP  + CD + DC    DEE+C N
Sbjct: 3510 KEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEETCTPRPCSESEFSC-------ANGRCIAGRWKCDGDHDCIDGSDEKDCKV----RCEPDQFQCNNGHCIPHRWHCDADADCMDGSDEENCHN 3631          

HSP 2 Score: 79.337 bits (194), Expect = 4.761e-14
Identity = 58/169 (34.32%), Postives = 76/169 (44.97%), Query Frame = 1
Query: 1999 VKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEED-CSNPQIIEPVKFT 2496
             +D   DDDG    C  N      +     +C   +  CKN  CI E   CDG NDC DNSDE  + C++  C  +   C+       N RCI   W CDG +DCGN+ DE N     +  C    + C +   IP S+ CD + DC    DE   C+ P      +FT
Sbjct:  828 AEDQILDDDGVT--CKANP-----SYIPPPQCQPGEFACKNSRCIQERWKCDGDNDCLDNSDEAPELCHQHTCPSDRFKCE-------NNRCIPNRWLCDGDNDCGNSEDESNSTCSAR-TCPSNQFSCASGRCIPLSWTCDLDDDCGDRSDESSKCAYPTCFPLTQFT 981          

HSP 3 Score: 77.0258 bits (188), Expect = 2.244e-13
Identity = 62/210 (29.52%), Postives = 85/210 (40.48%), Query Frame = 1
Query: 2074 LYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN--------------ECSPNSIHCDFLKDANP----------------------NKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE--EDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWD 2589
            L  +  CP ++ KC+N  CI     CDG NDCG++ DE    C+               C P S  CD   D                         + RCI  +W+CD  +DCG+N DE  C       C  T + CN+   IP  + CDG+ DC    DE   +C+N Q   P    P    T+      C++ G  +P   WR + D
Sbjct:  887 LCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNSEDESNSTCSARTCPSNQFSCASGRCIPLSWTCDLDDDCGDRSDESSKCAYPTCFPLTQFTCNSGRCININWRCDNDNDCGDNSDEDGC----SHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTN-QATRP----PGGCHTDE---FQCRLDGLCIPN-RWRCDGD 1083          

HSP 4 Score: 70.4774 bits (171), Expect = 2.194e-11
Identity = 45/127 (35.43%), Postives = 62/127 (48.82%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECS---PNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL-LIPRSYWCDGEPDCSSMEDEEDC 2460
            C   Q KC +  CI E+  CDG NDCGD SDE    C   +   P   H D  +    +  CI   W+CDG  DC +  DE NC  + +       + C ++   I +++ CDG+ DC    DEE+C
Sbjct: 1013 CSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQ-CRLDGLCIPNRWRCDGDTDCMDTSDEKNCDGETRPCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENC 1138          

HSP 5 Score: 68.9366 bits (167), Expect = 6.235e-11
Identity = 44/126 (34.92%), Postives = 63/126 (50.00%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCD----FLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            +CP+N   C N  CI  +  CD ++DC + +DE            +HCD     ++    N RCI KHW CDG DDCG+  DE    +   + C    + C + ++ IPR + CDG+ DC    DE
Sbjct: 2688 KCPVNYFACPNGHCIPMSWTCDKESDCENGADE------------MHCDKFCTSMQFECSNHRCISKHWVCDGSDDCGDKSDEG--AICQSNTCSPESFRCPSTHVCIPRRWLCDGDIDCQDGADE 2799          

HSP 6 Score: 67.3958 bits (163), Expect = 1.670e-10
Identity = 45/126 (35.71%), Postives = 58/126 (46.03%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN--ECSPNSIHCDFLKDANPNKRCII-KHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C   +  C+N  CI +   CD   DC D SDE   +C    C P+   C        N RC++ K W+CDG  DC +  DE   P   + KC  T +LC N   IP +  CD   DC    DE +C
Sbjct: 2811 CDAKEFMCQNRQCIPKQFVCDHDADCSDGSDE-SPECEYPTCGPDEFRC-------ANGRCLVNKQWECDGEFDCHDKSDEA--PKNPQSKCNETFFLCKNGTCIPDNLLCDNNDDCGDGSDELNC 2926          

HSP 7 Score: 65.855 bits (159), Expect = 5.664e-10
Identity = 52/160 (32.50%), Postives = 69/160 (43.12%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCN-NNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPT 2565
            +C   Q +C    C +    CDG NDC DNSDE     + C P+   C      N N RCI   ++C+G D+CG+  DE +CP   +  C    + C  N   IPR + CD + DC    DE D               +  T       CK SGR +P 
Sbjct: 3355 KCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC-----TNTN-RCIPGIFRCNGQDNCGDGDDEKDCP---EVTCAPNQFQCAVNKRCIPRVWVCDRDNDCVDASDEPD-------------NCTQMTCGVDEFRCKDSGRCIPA 3492          

HSP 8 Score: 65.4698 bits (158), Expect = 6.703e-10
Identity = 44/130 (33.85%), Postives = 60/130 (46.15%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPN---SIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            K  C   + +C++ TCI  +  C+   DC D SDE      +CS      +     K+      C    W CDG +DCG+  DE NCP +    KC   ++ C N   IP S+ CD E DC +  DE  C
Sbjct: 2594 KTNCTSEEYRCRDGTCIGNSSRCNQFIDCEDASDEMNCNITDCSSYFKLGVKGVTFKNCERTSLCYAPSWVCDGSNDCGDFSDEKNCPGEGWSPKCPVNYFACPNGHCIPMSWTCDKESDCENGADEMHC 2723          

HSP 9 Score: 64.3142 bits (155), Expect = 1.467e-9
Identity = 46/126 (36.51%), Postives = 63/126 (50.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C  +Q  CKN+ CI     CD ++DCGD SDE    C E  C P    C      NP        + CDG +DC +N DE NC +     C+ + + C N N  IP  + C+G+ +C   +DE+DC
Sbjct: 3316 CTASQFVCKNDKCIPFWWKCDTEDDCGDRSDEP-SDCPEFKCRPGQFQCSTGICTNP-------AFICDGDNDCQDNSDEANCDIH---VCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGDDEKDC 3430          

HSP 10 Score: 63.5438 bits (153), Expect = 2.901e-9
Identity = 53/175 (30.29%), Postives = 74/175 (42.29%), Query Frame = 1
Query: 1975 SKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKC-KNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK-CIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            S+    ++ +DA+ + +  + +C     + Y  L VK    +  + C +   C   +  CDG NDCGD SDE        SP    C     A PN  CI   W CD   DC N  DE++C     DK C    + C+N+  I + + CDG  DC    DE          P  F
Sbjct: 2614 SRCNQFIDCEDASDEMNCNITDC-----SSYFKLGVK---GVTFKNCERTSLCYAPSWVCDGSNDCGDFSDEKNCPGEGWSPK---CPVNYFACPNGHCIPMSWTCDKESDCENGADEMHC-----DKFCTSMQFECSNHRCISKHWVCDGSDDCGDKSDEGAICQSNTCSPESF 2772          

HSP 11 Score: 61.6178 bits (148), Expect = 1.174e-8
Identity = 42/123 (34.15%), Postives = 58/123 (47.15%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            CP+++ +C N  C      CDG++DCGDNSDE  ++C +C        F      ++ C+     CDGID+CG+  DE +             + C NN  I  S  CD   DC    DEE C
Sbjct: 3636 CPMDEFQCHNTLCKPLAWKCDGEDDCGDNSDEKPEECCKCFTCPPFRQFR--CRNDRVCLSMARVCDGIDNCGDGTDEEHYTKPKSCDMEKEEFQCKNNKCISSSRRCDLFDDCGDGSDEESC 3756          

HSP 12 Score: 55.8398 bits (133), Expect = 6.566e-7
Identity = 40/123 (32.52%), Postives = 54/123 (43.90%), Query Frame = 1
Query: 2101 NQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            ++ +C N  CI+ +  CDG   C D +DE    C    C     HC        N RCI     C+ +DDCG+N DE+ C    K  C    Y C +   I  S  C+   DC    DE +C+
Sbjct: 2520 DEFECGNGDCINYSMTCDGVPHCKDKADEKLSYCRTRHCRKGFKHC-------MNGRCISSSSWCNELDDCGDNSDEIAC---KKTNCTSEEYRCRDGTCIGNSSRCNQFIDCEDASDEMNCN 2632          

HSP 13 Score: 53.5286 bits (127), Expect = 3.361e-6
Identity = 42/140 (30.00%), Postives = 57/140 (40.71%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDED--RKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE--------LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQ 2472
            K  C  +Q +C N  CI     CD   DC D SDE+        C  +   C        N  C    W+CDG DDCG+N DE          CP   + +C       N+ + +  +  CDG  +C    DEE  + P+
Sbjct: 3592 KVRCEPDQFQCNNGHCIPHRWHCDADADCMDGSDEENCHNTVRTCPMDEFQCH-------NTLCKPLAWKCDGEDDCGDNSDEKPEECCKCFTCPPFRQFRCR------NDRVCLSMARVCDGIDNCGDGTDEEHYTKPK 3718          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 181.03 bits (458), Expect = 2.817e-45
Identity = 135/490 (27.55%), Postives = 215/490 (43.88%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE---CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVT--KGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVN--FKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLI--LSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C   +  C +  CI  +  CDG+ DC D SDE    C     C PN   C+       N  C +K W+CDG  DC +  DE NC VK   +  G TH+ C + N  IP S+ CD E DC    DE  C  PQ++ P +   I      T+T TC  +G P P I+WR NW H+P +    +T+          +L ++++     G Y+CE ++ R ++   PD  + +   +G      FY  D+     C+ C+C  +T+ C S+  +     L  S  +P+D   VN    ++    P          A++ F      ++ + + D ++       G+ +  YG  L YK+   L+    + +  P V++ G     Y    +   P +        N R     +++W   H    P  R + +  L ++  VL +  Y     +  +S I M   +  T  +  A  +E+C+CP GYSGLSCE+
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQ-QSIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGGR-----GTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDS---ASCLPCFCFGVTNVCQSSLRFRDQIRL--SFDQPNDFKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFLVH-DAFWALPKQFLGNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGAG---YRLHSRGHTPTHPGTL----NQRQVQLSEEHWV--HESGRPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGRAHSVEECRCPIGYSGLSCES 744          

HSP 2 Score: 62.7734 bits (151), Expect = 3.702e-9
Identity = 65/264 (24.62%), Postives = 116/264 (43.94%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVN----------FKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKL-ILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+   ++  A  P+ C+ C+C  +T +C+S++ Y+    LI +   P D    A+VN          F  +  +  AR ++F+N A +     E++Y +L   P+ Y        G  +  YG  L Y L   +G     L  P + I G +  +       + P   S E+     R   W + +         PATR   +  L ++  +L +  + +      +S +S++ A    +S   A ++E+C+CP GY GLSC++
Sbjct: 1307 CRPHHFHLSASNPEGCLPCFCMGVTQQCASSS-YSRQ--LISTHFAPGDFQGFALVNPQRNSQLTGGFTVEPVHDGAR-LSFSNFAHLG---QESFYWQL---PEIY-------QGDKVAAYGGKLRYTLSYTAGPQGSPLLDPDIQITGNNIMLVASQPALQGPERRSYEII---FREEFWRRPD-------GQPATREHLLMALADLDELLVRATFSSVPRAASISAVSLEVAQPGPSSGPRALEVEECRCPPGYVGLSCQD 1543          

HSP 3 Score: 58.9214 bits (141), Expect = 5.340e-8
Identity = 57/248 (22.98%), Postives = 103/248 (41.53%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDEC-------SSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAR-EITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSD--YLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            P  C++C+C  ++ +C       +   G +  P    S    S+AA  +  ++    PA  E++F++            +  L+  P Y++    +  G  +T YG  L + +      S       PLVV++G +  + H + +   P   SN  F    +   W++ +         PATR   +  L  +  +L +  Y       ++S ISM  A+        A ++E+C CP GY G SC++
Sbjct:  918 PDGCLKCFCMGVSRQCSSSSWSRAQVLGASEQP----SQFSLSNAAGTHTTSEGVSSPAPGELSFSS------------FHNLLSEP-YFWSLPASFRGDKVTSYGGELRFTVTQRPRPSSAPLHRQPLVVLQGNNIVLEHHASRDPSPGQPSN--FIVPFQEQAWQRPD-------GQPATREHLLMALAGIDALLIQASYTQQPAESRVSGISMDVAVPENTGQDSAREVEQCTCPPGYRGPSCQD 1139          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Hspg2 (perlecan (heparan sulfate proteoglycan 2) [Source:MGI Symbol;Acc:MGI:96257])

HSP 1 Score: 181.03 bits (458), Expect = 2.818e-45
Identity = 135/490 (27.55%), Postives = 215/490 (43.88%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE---CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVT--KGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVN--FKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLI--LSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C   +  C +  CI  +  CDG+ DC D SDE    C     C PN   C+       N  C +K W+CDG  DC +  DE NC VK   +  G TH+ C + N  IP S+ CD E DC    DE  C  PQ++ P +   I      T+T TC  +G P P I+WR NW H+P +    +T+          +L ++++     G Y+CE ++ R ++   PD  + +   +G      FY  D+     C+ C+C  +T+ C S+  +     L  S  +P+D   VN    ++    P          A++ F      ++ + + D ++       G+ +  YG  L YK+   L+    + +  P V++ G     Y    +   P +        N R     +++W   H    P  R + +  L ++  VL +  Y     +  +S I M   +  T  +  A  +E+C+CP GYSGLSCE+
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQ-QSIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGGR-----GTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDS---ASCLPCFCFGVTNVCQSSLRFRDQIRL--SFDQPNDFKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFLVH-DAFWALPKQFLGNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGAG---YRLHSRGHTPTHPGTL----NQRQVQLSEEHWV--HESGRPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGRAHSVEECRCPIGYSGLSCES 744          

HSP 2 Score: 62.7734 bits (151), Expect = 3.702e-9
Identity = 65/264 (24.62%), Postives = 116/264 (43.94%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVN----------FKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKL-ILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+   ++  A  P+ C+ C+C  +T +C+S++ Y+    LI +   P D    A+VN          F  +  +  AR ++F+N A +     E++Y +L   P+ Y        G  +  YG  L Y L   +G     L  P + I G +  +       + P   S E+     R   W + +         PATR   +  L ++  +L +  + +      +S +S++ A    +S   A ++E+C+CP GY GLSC++
Sbjct: 1307 CRPHHFHLSASNPEGCLPCFCMGVTQQCASSS-YSRQ--LISTHFAPGDFQGFALVNPQRNSQLTGGFTVEPVHDGAR-LSFSNFAHLG---QESFYWQL---PEIY-------QGDKVAAYGGKLRYTLSYTAGPQGSPLLDPDIQITGNNIMLVASQPALQGPERRSYEII---FREEFWRRPD-------GQPATREHLLMALADLDELLVRATFSSVPRAASISAVSLEVAQPGPSSGPRALEVEECRCPPGYVGLSCQD 1543          

HSP 3 Score: 58.9214 bits (141), Expect = 5.341e-8
Identity = 57/248 (22.98%), Postives = 103/248 (41.53%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDEC-------SSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAR-EITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSD--YLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            P  C++C+C  ++ +C       +   G +  P    S    S+AA  +  ++    PA  E++F++            +  L+  P Y++    +  G  +T YG  L + +      S       PLVV++G +  + H + +   P   SN  F    +   W++ +         PATR   +  L  +  +L +  Y       ++S ISM  A+        A ++E+C CP GY G SC++
Sbjct:  918 PDGCLKCFCMGVSRQCSSSSWSRAQVLGASEQP----SQFSLSNAAGTHTTSEGVSSPAPGELSFSS------------FHNLLSEP-YFWSLPASFRGDKVTSYGGELRFTVTQRPRPSSAPLHRQPLVVLQGNNIVLEHHASRDPSPGQPSN--FIVPFQEQAWQRPD-------GQPATREHLLMALAGIDALLIQASYTQQPAESRVSGISMDVAVPENTGQDSAREVEQCTCPPGYRGPSCQD 1139          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Lrp2 (low density lipoprotein receptor-related protein 2 [Source:MGI Symbol;Acc:MGI:95794])

HSP 1 Score: 90.1225 bits (222), Expect = 1.581e-17
Identity = 54/130 (41.54%), Postives = 66/130 (50.77%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE---CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL-NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            C  NQ  C N  CI  +  CDG NDCGD SDED++   E   CS     C  +    PN+RCI +HW CDG  DC +  DEL NC ++    C    + C N   I +S+ CD   DC    DE  CS P
Sbjct: 2908 CSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHHCELQNCSSTEFTC--INSRPPNRRCIPQHWVCDGDADCADALDELQNCTMR---ACSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYP 3032          

HSP 2 Score: 82.8037 bits (203), Expect = 3.336e-15
Identity = 54/163 (33.13%), Postives = 72/163 (44.17%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNEC---SPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL--NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS---NPQIIEPVKFTPISIFTNSTLTITCKMSGRP 2556
            CP    +CKN  CI     CDG+NDC D SDE+   C      SP    CD       N RCI  H  C+G+DDCG+  DE   +C       C  T Y C+N   + + Y CD   DC  + DE  C+   N    E +     +  +N     +C+   +P
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRFRCD-------NSRCIYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTCAEKICEQNCTQLSNGGFICSCRPGFKP 3999          

HSP 3 Score: 81.6481 bits (200), Expect = 7.182e-15
Identity = 46/122 (37.70%), Postives = 62/122 (50.82%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE 2451
            C L Q +C++  C      C+ + DC D SDEDR  C  + C  N   C        NKRCI ++WQCD +DDC +N DE      ++  C    + CNN   IP+S+ CD + DC    DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANEWQC-------ANKRCIPEYWQCDSVDDCLDNSDEDPSHCASR-TCRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668          

HSP 4 Score: 80.8777 bits (198), Expect = 1.285e-14
Identity = 47/139 (33.81%), Postives = 67/139 (48.20%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIF 2511
            P    +C N  CI     CDG +DCGDNSDE+     EC+ +   C        +++CI   W CD  +DCG+N DE +C +K    C   H+ C +   +P++  CDG  DC    DE  C  P       + P ++F
Sbjct: 3723 PSGDFRCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESEFRC-------ADQQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC--PTRFPNGTYCPAAMF 3849          

HSP 5 Score: 78.9518 bits (193), Expect = 4.109e-14
Identity = 46/139 (33.09%), Postives = 70/139 (50.36%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            ++C  +   C N  C+     CDG +DC DNSDE +     N CS ++  C          +CI   W+CD  +DC +  DE NCP ++    C  T + C+N++ IP+ + CD + DCS   DE++C       P +F
Sbjct: 1023 QQCGSSSFPCNNGKCVPSIFRCDGVDDCHDNSDEHQCGALNNTCSSSAFTCVH------GGQCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQF 1155          

HSP 6 Score: 74.7146 bits (182), Expect = 7.708e-13
Identity = 49/142 (34.51%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK--NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEED--CSNPQIIEPVKF 2493
            V  EC  ++ +C ++ CI     CD +NDCGDNSDE   +   C P    C        +  C+ K   CDG  DC +  DE  CP +  N   C    + C N++ I   + CDGE DC    DEE   C N     P +F
Sbjct: 3757 VPRECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRF 3891          

HSP 7 Score: 73.559 bits (179), Expect = 1.851e-12
Identity = 45/114 (39.47%), Postives = 59/114 (51.75%), Query Frame = 1
Query: 2119 NETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            N  CI +   C+G +DC DNSDE   +   C P+    DF      N  CI   W+CDGIDDCG+N DE +C  +   +C  + + C +   IP  + CD E DC    DE DC
Sbjct: 3691 NYRCIPQWAVCNGFDDCRDNSDEQGCESVPCHPSG---DFRCG---NHHCIPLRWKCDGIDDCGDNSDEESCVPR---ECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDC 3795          

HSP 8 Score: 72.7886 bits (177), Expect = 3.395e-12
Identity = 59/166 (35.54%), Postives = 74/166 (44.58%), Query Frame = 1
Query: 1972 DSKMLSLLEVKDATKD--DDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKN-ETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            D + +S L V D  KD  D      C  N             C  +Q KC +  +CI+    CDG  DC DNSDE    C    P   H D  +    +  CI   W+CDG  DC    DE N  V     C  +H+LC+N   I  S+ CDG+ DC  M DE+DC
Sbjct: 1159 DHRCISPLYVCDGDKDCVDGSDEAGCVLN-------------CTSSQFKCADGSSCINSRYRCDGVYDCKDNSDE--AGCPTRPPGMCHPDEFQ-CQGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKT--CSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDC 1306          

HSP 9 Score: 70.0922 bits (170), Expect = 2.356e-11
Identity = 44/135 (32.59%), Postives = 59/135 (43.70%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            C   Q +C +  CI     CDG  DC D SDE     N C+ +   C           CI   ++CDG+ DC +N DE  CP +    C    + C  +   IP ++ CDG PDC    DE +   P+   P  F
Sbjct: 1150 CHPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGCVLN-CTSSQFKC------ADGSSCINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKTCSPSHF 1277          

HSP 10 Score: 69.707 bits (169), Expect = 2.811e-11
Identity = 41/111 (36.94%), Postives = 57/111 (51.35%), Query Frame = 1
Query: 2128 CIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C+     CDG NDCGD SDE+   C  + C  N   C      +P+ RCI  +W CDG  DC ++ DE +    + + C    + C+N   I  S+ CDG+ DC  M DE+
Sbjct: 2836 CVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----VSPH-RCIPSYWFCDGEADCVDSSDEPDTCGHSLNSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDED 2940          

HSP 11 Score: 68.1662 bits (165), Expect = 7.724e-11
Identity = 46/136 (33.82%), Postives = 66/136 (48.53%), Query Frame = 1
Query: 2065 YVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDC--SSMEDEEDC 2460
            Y  +     C   Q  C N  CI ++  CD  NDCGD SDE    C  + C   +  C        N RC+  H++CD  +DCG+N DE  C  ++ +    T + C+N   IP SY C+G  +C  +   DE++C
Sbjct: 2692 YCVVDTGARCNQFQFTCLNGRCISQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTC-------ANGRCVPYHYRCDFYNDCGDNSDEAGCLFRSCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNC 2818          

HSP 12 Score: 68.1662 bits (165), Expect = 8.764e-11
Identity = 52/152 (34.21%), Postives = 70/152 (46.05%), Query Frame = 1
Query: 2038 ECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEEDC 2460
            +CA     D V L     C  N+ +C N+ CI E   CD  +DC DNSDED   C    C P    C+       N RCI + W+CD  +DCG+  DE   P+    +C+   Y C+N+           IP+   C+G  DC    DE+ C
Sbjct: 3579 DCADGSDEDRV-LCEHHRCEANEWQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQFKCN-------NGRCIPQSWKCDVDNDCGDYSDE---PIH---ECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716          

HSP 13 Score: 67.3958 bits (163), Expect = 1.515e-10
Identity = 44/125 (35.20%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 2101 NQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQ 2472
            +Q  C N  C + ++ CD K DC D+SDE    C   CS     C        +  CI++ + CD  +DC +N DE NC   N D C G  + C+N   I +++ CDG+ DC    DE+ C + Q
Sbjct:  148 DQLTCANGACYNTSQKCDHKVDCRDSSDE--ANCTTLCSQKEFQCG-------SGECILRAYVCDHDNDCEDNSDEHNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260          

HSP 14 Score: 60.4622 bits (145), Expect = 1.887e-8
Identity = 41/122 (33.61%), Postives = 54/122 (44.26%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK-CIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            C   + +C +  CI     CD  NDC DNSDE     + C  +   C        N +CI ++W CDG DDC ++ DE  C    +   C    + C  +   I     CDG PDC   EDE
Sbjct:  183 CSQKEFQCGSGECILRAYVCDHDNDCEDNSDEHNCNYDTCGGHQFTCS-------NGQCINQNWVCDGDDDCQDSGDEDGCESNQRHHTCYPREWACPGSGRCISMDKVCDGVPDCPEGEDE 297          

HSP 15 Score: 58.151 bits (139), Expect = 1.025e-7
Identity = 43/129 (33.33%), Postives = 52/129 (40.31%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            +EC     +C N  CI  +  CDG  DC D++DE       C P S    F         CI   W CD   DC +  DE  NCP      C      C+N   +P  Y CD   DC    DE +C  P
Sbjct:   26 QECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDE-----IGCPPRSCGSGFFL-CPAEGTCIPSSWVCDQDKDCSDGADEQQNCP---GTTCSSQQLTCSNGQCVPIEYRCDHVSDCPDGSDERNCYYP 145          

HSP 16 Score: 56.9954 bits (136), Expect = 1.992e-7
Identity = 33/98 (33.67%), Postives = 48/98 (48.98%), Query Frame = 1
Query: 2068 VTLYVKEECPLNQR-KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKC 2358
            + L     C   QR +C N  CI  ++ C+G +DCGD SDE  + C +  P    C   +    N  C+ +H+ CD +DDCG+  DE  C +     C
Sbjct: 3877 IHLCFNVPCESPQRFRCDNSRCIYGHQLCNGVDDCGDGSDEKEEHCRK--PTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTC 3972          

HSP 17 Score: 56.225 bits (134), Expect = 3.502e-7
Identity = 42/121 (34.71%), Postives = 57/121 (47.11%), Query Frame = 1
Query: 2113 CKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE--LNCPVK----NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEED 2457
            C N  CI  +  C+G N+C DN   D K C    P +   DF K    N  C+ + + CDG +DCG+  DE  + C       N+ +C+  H        IP  ++CDGE DC    DE D
Sbjct: 2789 CSNGRCIPLSYVCNGINNCHDNDTSDEKNC---PPITCQPDFAKCQTTNI-CVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQCVSPHRC------IPSYWFCDGEADCVDSSDEPD 2899          

HSP 18 Score: 55.4546 bits (132), Expect = 6.925e-7
Identity = 45/141 (31.91%), Postives = 62/141 (43.97%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN----ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLL-IPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTP 2499
            C  +Q  C+N  CI +   CD  NDCGD SDE    C+     C P+   CD       N  CI     C+ +DDC +N DE  C +        +H  C++N      S++C   P    M D+  C +   I+  K TP
Sbjct: 3034 CRDDQFTCQNGQCITKLYVCDEDNDCGDGSDEQEHLCHTPEPTCPPHQFRCD-------NGHCIEMGTVCNHVDDCSDNSDEKGCGINECQDSSISH--CDHNCTDTITSFYCSCLPGYKLMSDKRTCVD---IDECKETP 3162          

HSP 19 Score: 53.5286 bits (127), Expect = 2.386e-6
Identity = 39/125 (31.20%), Postives = 53/125 (42.40%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKD-KCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            C   +  C N  CI ++  CD +NDCGD SDE       C  +   C        N +CI K + CD  +DCG+  DE        +  C    + C+N   I     C+   DCS   DE+ C 
Sbjct: 2995 CSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYPPCRDDQFTCQ-------NGQCITKLYVCDEDNDCGDGSDEQEHLCHTPEPTCPPHQFRCDNGHCIEMGTVCNHVDDCSDNSDEKGCG 3112          

HSP 20 Score: 53.5286 bits (127), Expect = 2.596e-6
Identity = 46/144 (31.94%), Postives = 63/144 (43.75%), Query Frame = 1
Query: 2032 VYECAFNKLTDYVTLYVKEECPLNQRKCKNE-TCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDE 2451
            VY+C  N             C  ++ +C+ + TCI     CDG  DC   SDE    C    CSP+   CD       N  CI   W CDG +DC +  DE +CP +    C  + + C   ++ +  S  CDG  DC +  DE
Sbjct: 1211 VYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIQGSDE-HNGCVPKTCSPSHFLCD-------NGNCIYNSWVCDGDNDCRDMSDEKDCPTQ-PFHCPSSQWQCPGYSICVNLSALCDGVFDCPNGTDE 1345          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Lrp1 (low density lipoprotein receptor-related protein 1 [Source:MGI Symbol;Acc:MGI:96828])

HSP 1 Score: 82.4185 bits (202), Expect = 4.180e-15
Identity = 47/127 (37.01%), Postives = 70/127 (55.12%), Query Frame = 1
Query: 2092 CPLNQRKCKNET-CIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            C +++ +CK+   CI     CDG++DCGD SDE +++C+E  C P    C        N RC+   WQCD  +DCG+N DE +C  +    C  + + C N   I   + CDG+ DC+   DE+DC+
Sbjct: 3495 CGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRC-------KNNRCVPGRWQCDYDNDCGDNSDEESCTPR---PCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCT 3611          

HSP 2 Score: 80.1073 bits (196), Expect = 1.873e-14
Identity = 62/211 (29.38%), Postives = 86/211 (40.76%), Query Frame = 1
Query: 2071 TLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN--------------ECSPNSIHCDFLKDANP----------------------NKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE--EDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWD 2589
             L  +  CP ++ KC+N  CI     CDG NDCG++ DE    C+               C P S  CD   D                         N RCI  +W+CD  +DCG+N DE  C       C  T + CN+   IP  + CDG+ DC    DE   +C+N Q   P    P    ++      C++ G  +P + WR + D
Sbjct:  889 ALCHQHTCPSDRFKCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGC----SHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTN-QATRP----PGGCHSDE---FQCRLDGLCIP-LRWRCDGD 1086          

HSP 3 Score: 76.2554 bits (186), Expect = 2.872e-13
Identity = 50/139 (35.97%), Postives = 65/139 (46.76%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE-DCSNPQIIEPVKFT 2496
            +C   +  C N  CI E   CDG NDC DNSDE    C++  C  +   C+       N RCI   W CDG +DCGN+ DE N     +  C    + C +   IP S+ CD + DC    DE   C+ P      +FT
Sbjct:  854 QCQPGEFACANNRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRFKCE-------NNRCIPNRWLCDGDNDCGNSEDESNATCSAR-TCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTCFPLTQFT 984          

HSP 4 Score: 76.2554 bits (186), Expect = 2.945e-13
Identity = 54/154 (35.06%), Postives = 69/154 (44.81%), Query Frame = 1
Query: 2083 KEECPLN-----QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFT-NSTL 2526
            KEEC        Q +CKN  C+     CD  NDCGDNSDE+      CS +   C        N RCI   W+CDG  DC +  DE +C      +C    + C +   IP  + CD + DC    DEE C        V+  P+  F  N+TL
Sbjct: 3529 KEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSC-------ANGRCIAGRWKCDGDHDCADGSDEKDC----TPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGT-----GVRTCPLDEFQCNNTL 3666          

HSP 5 Score: 72.7886 bits (177), Expect = 3.446e-12
Identity = 55/151 (36.42%), Postives = 77/151 (50.99%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNS-IHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC--PVKNKDKCIG-THYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTL 2526
            CPL++ +C N  C      CDG++DCGDNSDE+ ++C    C PN    C        ++ C+    QCDG+D+CG+  DE +C  P      C     +LC N   +  S  C+   DC    DEEDCS    I+P K T  S  TN+++
Sbjct: 3655 CPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECARFICPPNRPFRC------KNDRVCLWIGRQCDGVDNCGDGTDEEDCEPPTAQNPHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCS----IDP-KLT--SCATNASM 3792          

HSP 6 Score: 68.9366 bits (167), Expect = 4.575e-11
Identity = 42/123 (34.15%), Postives = 58/123 (47.15%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRK-KCNECSPNSIHCDFLKDANPNKR-CIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE 2451
            C   Q +C+N  CI +   CDG +DCGD SDE    +   C P+S  C       P    C+ + W CDG  DC +  DE +         C    ++C N L IP+ + CD + DC+   DE
Sbjct: 2735 CSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAAHCEGKTCGPSSFSC-------PGTHVCVPERWLCDGDKDCTDGADESVTAGCLYNSTCDDREFMCQNRLCIPKHFVCDHDRDCADGSDE 2850          

HSP 7 Score: 68.5514 bits (166), Expect = 7.331e-11
Identity = 40/130 (30.77%), Postives = 62/130 (47.69%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPN---SIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            K  C + + +C++ +CI  +  C+   DC D SDE      +CS      +     +       C    W CDG +DCG+  DE +CP   + +C   ++ C +   IP S+ CD E DC + EDE  C+
Sbjct: 2603 KTACGVGEFRCRDGSCIGNSSRCNQFVDCEDASDEMNCSTTDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACPSGRCIPMSWTCDKEDDCENGEDETHCN 2732          

HSP 8 Score: 68.1662 bits (165), Expect = 8.531e-11
Identity = 46/135 (34.07%), Postives = 64/135 (47.41%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECS---PNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEEDC 2460
            C   Q KC +  CI E+  CDG NDCGD SDE    C   +   P   H D  +    +  CI   W+CDG  DC ++ DE +C         G  ++C+ N+          I +++ CDG+ DC    DEE+C
Sbjct: 1016 CSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHSDEFQ-CRLDGLCIPLRWRCDGDTDCMDSSDEKSCE--------GVTHVCDPNVKFGCKDSARCISKAWVCDGDSDCEDNSDEENC 1141          

HSP 9 Score: 65.855 bits (159), Expect = 4.407e-10
Identity = 47/126 (37.30%), Postives = 63/126 (50.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C  +Q  CKN+ CI     CD ++DCGD+SDE    C E  C P    C      NP        + CDG +DC +N DE NC +     C+ + + C N N  IP  + C+G+ +C   EDE DC
Sbjct: 3335 CTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEP-PDCPEFKCRPGQFQCSTGICTNP-------AFICDGDNDCQDNSDEANCDIH---VCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDC 3449          

HSP 10 Score: 64.6994 bits (156), Expect = 1.076e-9
Identity = 51/160 (31.87%), Postives = 71/160 (44.38%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCN-NNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPT 2565
            +C   Q +C    C +    CDG NDC DNSDE     + C P+   C      N N RCI   ++C+G D+CG+  DE +CP   +  C    + C+     IPR + CD + DC    D          EP   T ++   +      CK SGR +P 
Sbjct: 3374 KCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC-----TNTN-RCIPGIFRCNGQDNCGDGEDERDCP---EVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSD----------EPANCTQMTCGVDE---FRCKDSGRCIPA 3511          

HSP 11 Score: 59.3066 bits (142), Expect = 3.789e-8
Identity = 38/123 (30.89%), Postives = 57/123 (46.34%), Query Frame = 1
Query: 2113 CKNETCIDENKFCDGKNDCGDNSDEDRKKCN--ECSPNSIHCDFLKDANPNKRCII-KHWQCDGIDDCGNNFDEL----NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C+N  CI ++  CD   DC D SDE   +C    C PN   C        N RC+  + W+CDG +DC ++ DE     +C          + +LC++   +  +  C+G+ DC    DE  C
Sbjct: 2826 CQNRLCIPKHFVCDHDRDCADGSDES-PECEYPTCGPNEFRC-------ANGRCLSSRQWECDGENDCHDHSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDGSDERGC 2940          

HSP 12 Score: 59.3066 bits (142), Expect = 4.484e-8
Identity = 44/137 (32.12%), Postives = 60/137 (43.80%), Query Frame = 1
Query: 2062 DYVTLYVKEEC-PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN--ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            D+    V   C   ++ +C N  CI  +  CDG + C D SDE    CN   C      C+       N RC+     C+G+DDCG+  DE+ C   NK  C    + C +   I  S  C+   DC    DE +CS
Sbjct: 2515 DFTCRAVNSSCRAQDEFECANGECISFSLTCDGVSHCKDKSDEKPSYCNSRRCKKTFRQCN-------NGRCVSNMLWCNGVDDCGDGSDEIPC---NKTACGVGEFRCRDGSCIGNSSRCNQFVDCEDASDEMNCS 2641          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Match: Lrp4 (low density lipoprotein receptor-related protein 4 [Source:MGI Symbol;Acc:MGI:2442252])

HSP 1 Score: 81.6481 bits (200), Expect = 6.092e-15
Identity = 48/111 (43.24%), Postives = 60/111 (54.05%), Query Frame = 1
Query: 2125 TCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYW-CDGEPDCSSMEDEE 2454
            TCI     CDG NDCGD+SDED      CSP   HCD       N +CI + W CDG +DC ++ DE +CP +   +C    + C N   I RS W CDG+ DC    DE+
Sbjct:   43 TCIPAQWQCDGDNDCGDHSDEDGCTLPTCSPLDFHCD-------NGKCIRRSWVCDGDNDCEDDSDEQDCPPR---ECEEDEFPCQNGYCI-RSLWHCDGDNDCGDNSDEQ 142          

HSP 2 Score: 75.8702 bits (185), Expect = 3.019e-13
Identity = 44/116 (37.93%), Postives = 57/116 (49.14%), Query Frame = 1
Query: 2113 CKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C N  CI  +  CDG NDC D+SDE      EC  +   C        N  CI   W CDG +DCG+N DE  C ++   KC    + C++   I   ++CDG+ DC    DEE C
Sbjct:   78 CDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQ-------NGYCIRSLWHCDGDNDCGDNSDE-QCDMR---KCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESC 182          

HSP 3 Score: 70.8626 bits (172), Expect = 1.306e-11
Identity = 40/122 (32.79%), Postives = 54/122 (44.26%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE 2451
            + C   +  C +  CI+    CDG  DC D SDE     + C+     C        + RC+   W+CDG DDC +N DE NC      +C    +LC N   I +   C+G  DC    DE
Sbjct:  229 QPCRSGEFMCDSGLCINSGWRCDGDADCDDQSDERNCTTSMCTAEQFRCR-------SGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWNGRCIGQRKLCNGINDCGDSSDE 343          

HSP 4 Score: 68.5514 bits (166), Expect = 6.386e-11
Identity = 49/173 (28.32%), Postives = 67/173 (38.73%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDE--DRKKCNE----CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCP-----------------------------------------VKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
             EC  ++  C+N  CI     CDG NDCGDNSDE  D +KC++    CS  S              CI +HW CDG  DC +  DE +CP                                           +   C    ++C++ L I   + CDG+ DC    DE +C+
Sbjct:  108 RECEEDEFPCQNGYCIRSLWHCDGDNDCGDNSDEQCDMRKCSDKEFRCSDGS--------------CIAEHWYCDGDTDCKDGSDEESCPSAVPSPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINSGWRCDGDADCDDQSDERNCT 266          

HSP 5 Score: 56.6102 bits (135), Expect = 2.437e-7
Identity = 28/65 (43.08%), Postives = 37/65 (56.92%), Query Frame = 1
Query: 2266 CIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            CI   WQCDG +DCG++ DE  C +     C    + C+N   I RS+ CDG+ DC    DE+DC
Sbjct:   44 CIPAQWQCDGDNDCGDHSDEDGCTLPT---CSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDC 105          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|P98160|PGBM_HUMAN (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4)

HSP 1 Score: 185.267 bits (469), Expect = 1.144e-45
Identity = 135/500 (27.00%), Postives = 215/500 (43.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDE-DRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVT--KGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNF------------KTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYG--YPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPV--YASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C   +  C+N  CI  +  CDG+ DC D SDE D      C PN   C        N  C +K W+CDG  DC +  DE NCP K  ++  G T + C + N+ IP S+ CD E DC    DE  C  PQ++ P +   I      T+T TC   G P P I+WR NW H+P +    +T+          +L ++++     G Y+CE ++ R ++   PD  + +   +G      FY     +   C+ C+C  +T  C S   +     L     +P D   VN              T+    P+         + ++ ++++++      P+ + G   +  G  L RY   Y L   ++   +  D      VV+ G           YRL    +   +    N R   + +++W   H    P  R + + VL+++  VL +  Y     +  +S I+M   +    S+  A  +E+C+CP GYSGLSCE+
Sbjct:  285 CGPQEAACRNGHCIPRDYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCG-------NGHCALKLWRCDGDFDCEDRTDEANCPTKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPR-ESIQASRGQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGR-----GTLIIRDVKESDQGAYTCEAMNARGMVFGIPDGVLELVPQRGPCPDGHFYLE---HSAACLPCFCFGITSVCQSTRRFRDQIRL--RFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWAL----PEQFLGNKVDSYGGSL-RYNVRYELARGMLEPVQRPD------VVLMGAG---------YRLLSRGHTPTQPGALNQRQVQFSEEHWV--HESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHATSHGRAHSVEECRCPIGYSGLSCES 744          

HSP 2 Score: 63.929 bits (154), Expect = 1.125e-8
Identity = 64/263 (24.33%), Postives = 112/263 (42.59%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVNFK---------TKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKL-ILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+   ++  A  P  C+ C+C  +T +C+S+   A    LI +   P D    A+VN +         T E      +++F N A + +   E++Y +L   P+ Y        G  +  YG  L Y L   +G     L  P V I G +  +       + P   S E+     R   W + +         PATR   +  L ++  +L +  + +      +S +S++ A    ++   A ++E+C+CP GY GLSC++
Sbjct: 1307 CRPHHFHLSASNPDGCLPCFCMGITQQCASS---AYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGAQLSFGNFAQLGH---ESFYWQL---PETY-------QGDKVAAYGGKLRYTLSYTAGPQGSPLSDPDVQITGNNIMLVASQPALQGPERRSYEIM---FREEFWRRPD-------GQPATREHLLMALADLDELLIRATFSSVPLAASISAVSLEVAQPGPSNRPRALEVEECRCPPGYIGLSCQD 1543          

HSP 3 Score: 60.8474 bits (146), Expect = 1.013e-7
Identity = 58/240 (24.17%), Postives = 102/240 (42.50%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLIL-SGENSDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            P  C++C+C  ++  C+S++   +   L  +S +P   ++ N  +        E  F+       F   + + +L+  P Y++       G  +T YG  L + +   S   S  L G PLVV++G +  + H   +   P   S   F    R   W++ +         PATR   +  L  +  +L +  Y       ++S ISM  A+        A ++E+C CP GY G SC++
Sbjct:  918 PDGCLKCFCMGVSRHCTSSSW--SRAQLHGASEEPGHFSLTNAASTH---TTNEGIFSPTPGELGF---SSFHRLLSGP-YFWSLPSRFLGDKVTSYGGELRFTVTQRSQPGSTPLHGQPLVVLQGNNIILEHHVAQEPSPGQPST--FIVPFREQAWQRPD-------GQPATREHLLMALAGIDTLLIRASYAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQD 1139          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|Q05793|PGBM_MOUSE (Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.102e-44
Identity = 135/490 (27.55%), Postives = 215/490 (43.88%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE---CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVT--KGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVN--FKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLI--LSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C   +  C +  CI  +  CDG+ DC D SDE    C     C PN   C+       N  C +K W+CDG  DC +  DE NC VK   +  G TH+ C + N  IP S+ CD E DC    DE  C  PQ++ P +   I      T+T TC  +G P P I+WR NW H+P +    +T+          +L ++++     G Y+CE ++ R ++   PD  + +   +G      FY  D+     C+ C+C  +T+ C S+  +     L  S  +P+D   VN    ++    P          A++ F      ++ + + D ++       G+ +  YG  L YK+   L+    + +  P V++ G     Y    +   P +        N R     +++W   H    P  R + +  L ++  VL +  Y     +  +S I M   +  T  +  A  +E+C+CP GYSGLSCE+
Sbjct:  285 CGPQEASCHSGHCIPRDYLCDGQEDCRDGSDE--LGCASPPPCEPNEFACE-------NGHCALKLWRCDGDFDCEDRTDEANCSVKQPGEVCGPTHFQCVSTNRCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPQ-QSIQASRGQTVTFTCVATGVPTPIINWRLNWGHIPAHPRVTMTSEGGR-----GTLIIRDVKEADQGAYTCEAMNSRGMVFGIPDGVLELVPQRGPCPDGHFYLEDS---ASCLPCFCFGVTNVCQSSLRFRDQIRL--SFDQPNDFKGVNVTMPSQPGVPPLSSTQLQIDPALQEFQLVDLSRRFLVH-DAFWALPKQFLGNKVDSYGGFLRYKVRYELARGMLEPVQKPDVILVGAG---YRLHSRGHTPTHPGTL----NQRQVQLSEEHWV--HESGRPVQRAEMLQALASLEAVLLQTVYNTKMASVGLSDIVMDTTVTHTTIHGRAHSVEECRCPIGYSGLSCES 744          

HSP 2 Score: 62.3882 bits (150), Expect = 2.980e-8
Identity = 65/264 (24.62%), Postives = 116/264 (43.94%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVN----------FKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKL-ILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+   ++  A  P+ C+ C+C  +T +C+S++ Y+    LI +   P D    A+VN          F  +  +  AR ++F+N A +     E++Y +L   P+ Y        G  +  YG  L Y L   +G     L  P + I G +  +       + P   S E+     R   W + +         PATR   +  L ++  +L +  + +      +S +S++ A    +S   A ++E+C+CP GY GLSC++
Sbjct: 1307 CRPHHFHLSASNPEGCLPCFCMGVTQQCASSS-YSRQ--LISTHFAPGDFQGFALVNPQRNSQLTGGFTVEPVHDGAR-LSFSNFAHLG---QESFYWQL---PEIY-------QGDKVAAYGGKLRYTLSYTAGPQGSPLLDPDIQITGNNIMLVASQPALQGPERRSYEII---FREEFWRRPD-------GQPATREHLLMALADLDELLVRATFSSVPRAASISAVSLEGAQPGPSSGPRALEVEECRCPPGYVGLSCQD 1543          

HSP 3 Score: 60.077 bits (144), Expect = 1.822e-7
Identity = 57/248 (22.98%), Postives = 104/248 (41.94%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDEC-------SSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAR-EITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSD--YLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            P  C++C+C  ++ +C       +   G +  P    S    S+AA  +  ++    PA  E++F++            +  L+  P Y++    +  G  +T YG  L + ++     S       PLVV++G +  + H + +   P   SN  F    +   W++ +         PATR   +  L  +  +L +  Y       ++S ISM  A+        A ++E+C CP GY G SC++
Sbjct:  918 PDGCLKCFCMGVSRQCSSSSWSRAQVLGASEQP----SQFSLSNAAGTHTTSEGVSSPAPGELSFSS------------FHNLLSEP-YFWSLPASFRGDKVTSYGGELRFTVMQRPRPSSAPLHRQPLVVLQGNNIVLEHHASRDPSPGQPSN--FIVPFQEQAWQRPD-------GQPATREHLLMALAGIDALLIQASYTQQPAESRLSGISMDVAVPENTGQDSAREVEQCTCPPGYRGPSCQD 1139          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|Q06561|UNC52_CAEEL (Basement membrane proteoglycan OS=Caenorhabditis elegans OX=6239 GN=unc-52 PE=1 SV=2)

HSP 1 Score: 148.288 bits (373), Expect = 2.486e-34
Identity = 142/539 (26.35%), Postives = 229/539 (42.49%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR--KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK-NKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGIS-RRRIIA-PDFSVSV----------------------TKGQICQRPFYNN--------------------DAWY-----PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETY--YKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYH------CSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            +C  +++ C N  C+  +  CDG+ DC D SDE         C PN   C+       N +C+ K W CDG DDCG+N DELNC  K +   C  T + C++    +P S+ CDG  DC    DE  C  P +++P + T + +   +T ++TCK    P P I+WR NW  + E         +        +LT+ +      G Y+CE I+ + R++A PD  V V                      T+G +   P+ NN                     A++     P+ C++C+C  ++++C S+  Y T   L+ +     DA  V     E     R   F+       F    Y  +         Y+       G  +T YG  + +++  SG +  +   P+VV+KG  + + H        ++   PV  + E +E N     +EQ N          ATR D + VL ++   L +  +   QT+  +  +S + A++       A ++E+C CP GY G SCE+
Sbjct:  148 QCMADEKACGNNECVKNDYVCDGEPDCRDRSDEANCPAISRTCEPNEFKCN-------NNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQ-TNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEP-----PRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVT--PYPNNYGTCECKSQVTGPNCDQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFA----GDAEGVTISDIEERTIDRNTPFS-------FFKTGYLTFDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSG-SGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN-----YEQLNGAA-------ATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED 647          

HSP 2 Score: 74.7146 bits (182), Expect = 5.754e-12
Identity = 69/244 (28.28%), Postives = 112/244 (45.90%), Query Frame = 1
Query: 2809 PQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA-AIVNFKTKEYYKPAREITFANKA----AMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGE-NSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            PQ CI C+CS +T +CS A+ Y    V I+ +    D   +    +++ Y P      + +A    + +    +T Y KL   P+ + G         +T YG  L Y    SG  NSD      V+++G   ++ +   K+R P YA  E   N ++I + E      D +    ATR   +  L ++  +L K  Y +  T+ Q+   +++ A E       AA++E+C CP GY G SCE+
Sbjct:  715 PQGCIPCFCSGVTQQCS-ASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKL---PEKFLG-------DKVTSYGGTLEYTFKFSGNGNSDQSAD--VILRGNDIALQY---KHREPFYADRE---NKVQIKIIETSWQRVDGQ---QATREHLLMTLADLDTLLIKSTYNDDCTDSQLLSANLEFA-EPYGQGLTAAEVEQCICPPGYVGTSCED 935          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|C0HL13|LRP2_PIG (Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.729e-18
Identity = 58/140 (41.43%), Postives = 73/140 (52.14%), Query Frame = 1
Query: 2074 LYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDED-RKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            +Y    C  ++ KC N  CI     CDG NDCGD SDED R  C  + CS  + HC  +  A P++RCI   W CDG  DC + +DE  NC  +N   C GT + C+N L IP  + CD   DC    DE +C  P   E
Sbjct: 2897 VYSPSTCSSDEFKCDNNRCIQMEWICDGDNDCGDMSDEDGRHHCENHNCSSYAFHC--VNSAPPSRRCIPLSWVCDGDADCSDAYDEHQNCTRRN---CSGTEFRCSNGLCIPNWFRCDRRNDCGDYSDERNCKYPACDE 3031          

HSP 2 Score: 80.8777 bits (198), Expect = 8.328e-14
Identity = 43/138 (31.16%), Postives = 70/138 (50.72%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            E+C      C N  C+  +  CDG +DC DNSDE +       C+P++  C      +    CI  +W+CD  +DC +  DE NC  + +  C   ++ C+N++ IP+++ CD + DC    DE+ C   +   P +F
Sbjct: 1024 EQCGALSFPCNNGRCVPLHYRCDGVDDCHDNSDEVQCGAFNTSCAPSAFAC-----GHGGGECIPSYWRCDNHNDCVDGSDEQNCSSQAQTSCRADYFTCDNHMCIPKNWLCDTDNDCGDGSDEKRCDLGETCSPTQF 1156          

HSP 3 Score: 79.7221 bits (195), Expect = 1.733e-13
Identity = 47/130 (36.15%), Postives = 66/130 (50.77%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE--EDCSNP 2469
            C L Q +C +  C   N  C+ + DC D SDED   C  + C  N   C        NKRCI + WQCD ++DCG+N DE +     +  C+  ++ C N   IP+S+ CD + DC    DE  ++C  P
Sbjct: 3551 CRLGQFQCSDGNCTSSNFICNARQDCPDGSDEDAVLCEHHRCESNQWQC-------ANKRCIPESWQCDSLNDCGDNSDEDSSHCARR-TCLPGYFKCANGHCIPQSWKCDVDNDCGDYSDEPLQECMGP 3672          

HSP 4 Score: 79.7221 bits (195), Expect = 1.839e-13
Identity = 49/139 (35.25%), Postives = 66/139 (47.48%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIF 2511
            P  + +C N  CI     CDG NDCGDNSDE+     +CS +   CD       ++ CI   W CD  +DCG+N DE +C V     C   ++ C++   IP    CDG  DC    DE  C  P       + P ++F
Sbjct: 3719 PSGEFRCTNHHCIPLRWRCDGHNDCGDNSDEENCVPRQCSESEFRCD-------DQTCIPSRWICDQNNDCGDNSDERDCEVMT---CHPGYFQCSSGHCIPDQMRCDGFADCLDASDEATC--PTRFPNGAYCPATLF 3845          

HSP 5 Score: 78.9518 bits (193), Expect = 2.997e-13
Identity = 51/172 (29.65%), Postives = 73/172 (42.44%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHC--------DFLKDANPN------------------------KRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCN-NNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
             +  C  +   C N  CI +N  CD  NDCGD SDE R    E CSP   HC         F+ D + +                         +CI   ++CDG+ DC ++ DE++CP +    C    + C  + + IP S+ CDG PDC +  DE     P+     +F
Sbjct: 1107 AQTSCRADYFTCDNHMCIPKNWLCDTDNDCGDGSDEKRCDLGETCSPTQFHCPNHRCIDLAFVCDGDKDCADGSDESACVINCTDSQFKCVGSNKCISNTYRCDGVSDCSDHSDEIDCPTRPPGMCRQDEFQCREDGICIPDSWECDGHPDCLTGSDEHSGCPPRTCPXSRF 1278          

HSP 6 Score: 78.5666 bits (192), Expect = 4.568e-13
Identity = 45/127 (35.43%), Postives = 62/127 (48.82%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK--NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            V  +C  ++ +C ++TCI     CD  NDCGDNSDE   +   C P    C        +  CI    +CDG  DC +  DE  CP +  N   C  T + C N++ +  S+ CDG+ DC    DEE
Sbjct: 3753 VPRQCSESEFRCDDQTCIPSRWICDQNNDCGDNSDERDCEVMTCHPGYFQCS-------SGHCIPDQMRCDGFADCLDASDEATCPTRFPNGAYCPATLFECKNHVCVQPSWKCDGDNDCGDGSDEE 3872          

HSP 7 Score: 75.485 bits (184), Expect = 3.948e-12
Identity = 58/178 (32.58%), Postives = 67/178 (37.64%), Query Frame = 1
Query: 2068 VTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--------------NECSPNSIHCDFLKDAN--------------------------PNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
              L     C  NQ +C N+ CI E+  CD  NDCGDNSDED   C                C P S  CD   D                             N RCI K   C+G DDC +N DE NC            + C N+  IP  + CDG  DC    DEE+C   Q  E
Sbjct: 3584 AVLCEHHRCESNQWQCANKRCIPESWQCDSLNDCGDNSDEDSSHCARRTCLPGYFKCANGHCIPQSWKCDVDNDCGDYSDEPLQECMGPAYRCDNYTEFDCKTNYRCIPKWAVCNGFDDCRDNSDEQNCESLTCKP--SGEFRCTNHHCIPLRWRCDGHNDCGDNSDEENCVPRQCSE 3759          

HSP 8 Score: 72.4034 bits (176), Expect = 3.006e-11
Identity = 48/129 (37.21%), Postives = 57/129 (44.19%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
             EC  N+ +C N  CI E+  CDG  DC D SDE     + C     HC+          CI  +W CDG +DC N  DE   CP      C   H+ C N   IP  Y CD   DC    DE +C  P
Sbjct:   26 RECLGNEFRCSNGHCITESWRCDGTRDCLDGSDEIGCPPSTCGSTQFHCE------NEDVCIPLYWVCDGEEDCSNGADEHQRCPPGR--TCSSHHFTCTNGECIPVEYRCDHSTDCLDGTDEINCRYP 146          

HSP 9 Score: 71.2478 bits (173), Expect = 7.592e-11
Identity = 50/130 (38.46%), Postives = 65/130 (50.00%), Query Frame = 1
Query: 2071 TLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNN--FDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            TL     CP     C N  CI  +  CD  NDCGDNSDE   +   C   +I  +F   +  N +C+     CDGID C +N   DE NC    +  C+  +  C N+N+ IPR + CDG+ DC  M DE
Sbjct: 2731 TLCAYHTCPPTSFTCANGRCIQRHFRCDHYNDCGDNSDESGCRFRSC---NITTEF---SCNNGKCLPLQLVCDGIDHCNDNNTSDEKNCA---QHTCLPDYIKCANSNVCIPRLFLCDGDNDCGDMSDE 2851          

HSP 10 Score: 70.8626 bits (172), Expect = 8.399e-11
Identity = 54/172 (31.40%), Postives = 70/172 (40.70%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDED---------RKKC---NECSPNSIHCDFLKDANPNKR------------------------CIIKHWQCDGIDDCGNNFDELN-CPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
            + E C   Q  C N  CID    CDG  DC D SDE          + KC   N+C  N+  CD + D + +                          CI   W+CDG  DC    DE + CP +    C  + +LC N   I R + CDG+ DC  M DE+DC     + P
Sbjct: 1147 LGETCSPTQFHCPNHRCIDLAFVCDGDKDCADGSDESACVINCTDSQFKCVGSNKCISNTYRCDGVSDCSDHSDEIDCPTRPPGMCRQDEFQCREDGICIPDSWECDGHPDCLTGSDEHSGCPPRT---CPXSRFLCANGNCIFRDWLCDGDNDCRDMSDEKDCPTQPFLCP 1315          

HSP 11 Score: 67.0106 bits (162), Expect = 1.364e-9
Identity = 46/137 (33.58%), Postives = 70/137 (51.09%), Query Frame = 1
Query: 2065 YVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDC--SSMEDEEDCS 2463
            Y  +   + C   Q  C +  CI E+  C+  ++CGD+SDE    C  + C P S  C        N RCI +H++CD  +DCG+N DE  C  ++ +  I T + CNN   +P    CDG   C  ++  DE++C+
Sbjct: 2688 YCIVDDGKRCNSTQFTCLSGYCILESLKCNDIDECGDSSDELETLCAYHTCPPTSFTC-------ANGRCIQRHFRCDHYNDCGDNSDESGCRFRSCN--ITTEFSCNNGKCLPLQLVCDGIDHCNDNNTSDEKNCA 2815          

HSP 12 Score: 67.0106 bits (162), Expect = 1.447e-9
Identity = 44/118 (37.29%), Postives = 54/118 (45.76%), Query Frame = 1
Query: 2110 KCKNE-TCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            KC N   CI     CDG NDCGD SDE+   C    C  N   C        +  CI + W CDG  DC +  DE    V +   C    + C+NN  I   + CDG+ DC  M DE+
Sbjct: 2825 KCANSNVCIPRLFLCDGDNDCGDMSDENPIYCVSPTCKNNEFQC-------TSGSCIPELWHCDGERDCDDGSDEPATCVYSPSTCSSDEFKCDNNRCIQMEWICDGDNDCGDMSDED 2935          

HSP 13 Score: 66.2402 bits (160), Expect = 2.358e-9
Identity = 47/137 (34.31%), Postives = 62/137 (45.26%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL-NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPV 2487
             +  C   + +C N  CI     CD +NDCGD SDE   K   C  N   C        N  C  K + CDG +DCG+N DEL +   K +  C    + CNN   I     C+ + DCS   DEE C   +  +P+
Sbjct: 2986 TRRNCSGTEFRCSNGLCIPNWFRCDRRNDCGDYSDERNCKYPACDENLFTCQ-------NGICTYKSYICDGENDCGDNSDELEHLCHKEETTCPPHQFRCNNGNCIEMVKVCNHQADCSDNSDEERCGVNECNDPL 3115          

HSP 14 Score: 64.3142 bits (155), Expect = 9.462e-9
Identity = 44/133 (33.08%), Postives = 57/133 (42.86%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVK 2490
            C  +   C N  CI     CD   DC D +DE   +   C   + H         N  C     +CDG  DC +  DELNC      +C+   + C +   IPR Y CD +PDCS   DE  CS   + +P K
Sbjct:  109 CSSHHFTCTNGECIPVEYRCDHSTDCLDGTDEINCRYPVCQQQTCH---------NGACYNTSQRCDGEIDCRDASDELNC----TQRCLRNEFQCGSGECIPRDYVCDHDPDCSDSSDEHSCS---VYQPCK 225          

HSP 15 Score: 60.077 bits (144), Expect = 1.713e-7
Identity = 39/109 (35.78%), Postives = 50/109 (45.87%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECS---PNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL--NCPVKNKDKCIGTHYLCNNNLLIPR 2403
            CP    +CKN  C+  +  CDG NDCGD SDE+   C   +    N   CD       N RCI +H  C+  DDCG+  DE   NC       C    + C+N   I +
Sbjct: 3840 CPATLFECKNHVCVQPSWKCDGDNDCGDGSDEELHLCLNITCDLTNRFRCD-------NNRCIYRHELCNHEDDCGDGSDEKKENCLAPTPRPCTEGEFKCSNGHCISQ 3941          

HSP 16 Score: 59.6918 bits (143), Expect = 1.993e-7
Identity = 41/125 (32.80%), Postives = 60/125 (48.00%), Query Frame = 1
Query: 2104 QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQI 2475
            Q+ C N  C + ++ CDG+ DC D SDE    C + C  N   C        +  CI + + CD   DC ++ DE +C V     C G  + C+N   I +++ CDG  DC    DE+ C +  I
Sbjct:  150 QQTCHNGACYNTSQRCDGEIDCRDASDE--LNCTQRCLRNEFQCG-------SGECIPRDYVCDHDPDCSDSSDEHSCSVYQP--CKGNEFACSNGFCINQNWVCDGMADCLDNSDEDGCESSII 263          

HSP 17 Score: 55.4546 bits (132), Expect = 4.233e-6
Identity = 43/129 (33.33%), Postives = 59/129 (45.74%), Query Frame = 1
Query: 2074 LYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC--PVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            L   + C  N+ +C +  CI  +  CD   DC D+SDE    C+   P    C   + A  N  CI ++W CDG+ DC +N DE  C   +    +C    + C  +   IP S  CDG  DC    DE
Sbjct:  178 LNCTQRCLRNEFQCGSGECIPRDYVCDHDPDCSDSSDE--HSCSVYQP----CKGNEFACSNGFCINQNWVCDGMADCLDNSDEDGCESSIIRTHECYPNEWACPEDGKCIPLSRVCDGIADCPRGGDE 300          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Match: sp|A2ARV4|LRP2_MOUSE (Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.106e-16
Identity = 54/130 (41.54%), Postives = 66/130 (50.77%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE---CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL-NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            C  NQ  C N  CI  +  CDG NDCGD SDED++   E   CS     C  +    PN+RCI +HW CDG  DC +  DEL NC ++    C    + C N   I +S+ CD   DC    DE  CS P
Sbjct: 2908 CSANQFHCDNGRCISSSWVCDGDNDCGDMSDEDQRHHCELQNCSSTEFTC--INSRPPNRRCIPQHWVCDGDADCADALDELQNCTMR---ACSTGEFSCANGRCIRQSFRCDRRNDCGDYSDERGCSYP 3032          

HSP 2 Score: 82.8037 bits (203), Expect = 2.333e-14
Identity = 54/163 (33.13%), Postives = 72/163 (44.17%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNEC---SPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL--NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS---NPQIIEPVKFTPISIFTNSTLTITCKMSGRP 2556
            CP    +CKN  CI     CDG+NDC D SDE+   C      SP    CD       N RCI  H  C+G+DDCG+  DE   +C       C  T Y C+N   + + Y CD   DC  + DE  C+   N    E +     +  +N     +C+   +P
Sbjct: 3844 CPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRFRCD-------NSRCIYGHQLCNGVDDCGDGSDEKEEHCRKPTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTCAEKICEQNCTQLSNGGFICSCRPGFKP 3999          

HSP 3 Score: 81.6481 bits (200), Expect = 5.024e-14
Identity = 46/122 (37.70%), Postives = 62/122 (50.82%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE 2451
            C L Q +C++  C      C+ + DC D SDEDR  C  + C  N   C        NKRCI ++WQCD +DDC +N DE      ++  C    + CNN   IP+S+ CD + DC    DE
Sbjct: 3555 CRLGQFQCRDGNCTSPQALCNARQDCADGSDEDRVLCEHHRCEANEWQC-------ANKRCIPEYWQCDSVDDCLDNSDEDPSHCASR-TCRPGQFKCNNGRCIPQSWKCDVDNDCGDYSDE 3668          

HSP 4 Score: 80.8777 bits (198), Expect = 8.985e-14
Identity = 47/139 (33.81%), Postives = 67/139 (48.20%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIF 2511
            P    +C N  CI     CDG +DCGDNSDE+     EC+ +   C        +++CI   W CD  +DCG+N DE +C +K    C   H+ C +   +P++  CDG  DC    DE  C  P       + P ++F
Sbjct: 3723 PSGDFRCGNHHCIPLRWKCDGIDDCGDNSDEESCVPRECTESEFRC-------ADQQCIPSRWVCDQENDCGDNSDERDCEMKT---CHPEHFQCTSGHCVPKALACDGRADCLDASDESAC--PTRFPNGTYCPAAMF 3849          

HSP 5 Score: 78.9518 bits (193), Expect = 2.874e-13
Identity = 46/139 (33.09%), Postives = 70/139 (50.36%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            ++C  +   C N  C+     CDG +DC DNSDE +     N CS ++  C          +CI   W+CD  +DC +  DE NCP ++    C  T + C+N++ IP+ + CD + DCS   DE++C       P +F
Sbjct: 1023 QQCGSSSFPCNNGKCVPSIFRCDGVDDCHDNSDEHQCGALNNTCSSSAFTCVH------GGQCIPGQWRCDKQNDCLDGSDEQNCPTRSPSSTCPPTSFTCDNHMCIPKEWVCDTDNDCSDGSDEKNCQASGTCHPTQF 1155          

HSP 6 Score: 74.7146 bits (182), Expect = 5.392e-12
Identity = 49/142 (34.51%), Postives = 65/142 (45.77%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK--NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEED--CSNPQIIEPVKF 2493
            V  EC  ++ +C ++ CI     CD +NDCGDNSDE   +   C P    C        +  C+ K   CDG  DC +  DE  CP +  N   C    + C N++ I   + CDGE DC    DEE   C N     P +F
Sbjct: 3757 VPRECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDCEMKTCHPEHFQC-------TSGHCVPKALACDGRADCLDASDESACPTRFPNGTYCPAAMFECKNHVCIQSFWICDGENDCVDGSDEEIHLCFNVPCESPQRF 3891          

HSP 7 Score: 73.559 bits (179), Expect = 1.295e-11
Identity = 45/114 (39.47%), Postives = 59/114 (51.75%), Query Frame = 1
Query: 2119 NETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            N  CI +   C+G +DC DNSDE   +   C P+    DF      N  CI   W+CDGIDDCG+N DE +C  +   +C  + + C +   IP  + CD E DC    DE DC
Sbjct: 3691 NYRCIPQWAVCNGFDDCRDNSDEQGCESVPCHPSG---DFRCG---NHHCIPLRWKCDGIDDCGDNSDEESCVPR---ECTESEFRCADQQCIPSRWVCDQENDCGDNSDERDC 3795          

HSP 8 Score: 72.7886 bits (177), Expect = 2.375e-11
Identity = 59/166 (35.54%), Postives = 74/166 (44.58%), Query Frame = 1
Query: 1972 DSKMLSLLEVKDATKD--DDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKN-ETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            D + +S L V D  KD  D      C  N             C  +Q KC +  +CI+    CDG  DC DNSDE    C    P   H D  +    +  CI   W+CDG  DC    DE N  V     C  +H+LC+N   I  S+ CDG+ DC  M DE+DC
Sbjct: 1159 DHRCISPLYVCDGDKDCVDGSDEAGCVLN-------------CTSSQFKCADGSSCINSRYRCDGVYDCKDNSDE--AGCPTRPPGMCHPDEFQ-CQGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKT--CSPSHFLCDNGNCIYNSWVCDGDNDCRDMSDEKDC 1306          

HSP 9 Score: 70.0922 bits (170), Expect = 1.648e-10
Identity = 44/135 (32.59%), Postives = 59/135 (43.70%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            C   Q +C +  CI     CDG  DC D SDE     N C+ +   C           CI   ++CDG+ DC +N DE  CP +    C    + C  +   IP ++ CDG PDC    DE +   P+   P  F
Sbjct: 1150 CHPTQFRCPDHRCISPLYVCDGDKDCVDGSDEAGCVLN-CTSSQFKC------ADGSSCINSRYRCDGVYDCKDNSDEAGCPTRPPGMCHPDEFQCQGDGTCIPNTWECDGHPDCIQGSDEHNGCVPKTCSPSHF 1277          

HSP 10 Score: 69.707 bits (169), Expect = 1.967e-10
Identity = 41/111 (36.94%), Postives = 57/111 (51.35%), Query Frame = 1
Query: 2128 CIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C+     CDG NDCGD SDE+   C  + C  N   C      +P+ RCI  +W CDG  DC ++ DE +    + + C    + C+N   I  S+ CDG+ DC  M DE+
Sbjct: 2836 CVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQC-----VSPH-RCIPSYWFCDGEADCVDSSDEPDTCGHSLNSCSANQFHCDNGRCISSSWVCDGDNDCGDMSDED 2940          

HSP 11 Score: 68.1662 bits (165), Expect = 5.403e-10
Identity = 46/136 (33.82%), Postives = 66/136 (48.53%), Query Frame = 1
Query: 2065 YVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDC--SSMEDEEDC 2460
            Y  +     C   Q  C N  CI ++  CD  NDCGD SDE    C  + C   +  C        N RC+  H++CD  +DCG+N DE  C  ++ +    T + C+N   IP SY C+G  +C  +   DE++C
Sbjct: 2692 YCVVDTGARCNQFQFTCLNGRCISQDWKCDNDNDCGDGSDELPTVCAFHTCRSTAFTC-------ANGRCVPYHYRCDFYNDCGDNSDEAGCLFRSCNS--TTEFTCSNGRCIPLSYVCNGINNCHDNDTSDEKNC 2818          

HSP 12 Score: 68.1662 bits (165), Expect = 6.130e-10
Identity = 52/152 (34.21%), Postives = 70/152 (46.05%), Query Frame = 1
Query: 2038 ECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEEDC 2460
            +CA     D V L     C  N+ +C N+ CI E   CD  +DC DNSDED   C    C P    C+       N RCI + W+CD  +DCG+  DE   P+    +C+   Y C+N+           IP+   C+G  DC    DE+ C
Sbjct: 3579 DCADGSDEDRV-LCEHHRCEANEWQCANKRCIPEYWQCDSVDDCLDNSDEDPSHCASRTCRPGQFKCN-------NGRCIPQSWKCDVDNDCGDYSDE---PIH---ECMTAAYNCDNHTEFSCKTNYRCIPQWAVCNGFDDCRDNSDEQGC 3716          

HSP 13 Score: 67.3958 bits (163), Expect = 1.060e-9
Identity = 44/125 (35.20%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 2101 NQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQ 2472
            +Q  C N  C + ++ CD K DC D+SDE    C   CS     C        +  CI++ + CD  +DC +N DE NC   N D C G  + C+N   I +++ CDG+ DC    DE+ C + Q
Sbjct:  148 DQLTCANGACYNTSQKCDHKVDCRDSSDE--ANCTTLCSQKEFQCG-------SGECILRAYVCDHDNDCEDNSDEHNC---NYDTCGGHQFTCSNGQCINQNWVCDGDDDCQDSGDEDGCESNQ 260          

HSP 14 Score: 60.4622 bits (145), Expect = 1.320e-7
Identity = 41/122 (33.61%), Postives = 54/122 (44.26%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK-CIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            C   + +C +  CI     CD  NDC DNSDE     + C  +   C        N +CI ++W CDG DDC ++ DE  C    +   C    + C  +   I     CDG PDC   EDE
Sbjct:  183 CSQKEFQCGSGECILRAYVCDHDNDCEDNSDEHNCNYDTCGGHQFTCS-------NGQCINQNWVCDGDDDCQDSGDEDGCESNQRHHTCYPREWACPGSGRCISMDKVCDGVPDCPEGEDE 297          

HSP 15 Score: 58.151 bits (139), Expect = 7.167e-7
Identity = 43/129 (33.33%), Postives = 52/129 (40.31%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            +EC     +C N  CI  +  CDG  DC D++DE       C P S    F         CI   W CD   DC +  DE  NCP      C      C+N   +P  Y CD   DC    DE +C  P
Sbjct:   26 QECGSGNFRCDNGYCIPASWRCDGTRDCLDDTDE-----IGCPPRSCGSGFFL-CPAEGTCIPSSWVCDQDKDCSDGADEQQNCP---GTTCSSQQLTCSNGQCVPIEYRCDHVSDCPDGSDERNCYYP 145          

HSP 16 Score: 56.9954 bits (136), Expect = 1.394e-6
Identity = 33/98 (33.67%), Postives = 48/98 (48.98%), Query Frame = 1
Query: 2068 VTLYVKEECPLNQR-KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKC 2358
            + L     C   QR +C N  CI  ++ C+G +DCGD SDE  + C +  P    C   +    N  C+ +H+ CD +DDCG+  DE  C +     C
Sbjct: 3877 IHLCFNVPCESPQRFRCDNSRCIYGHQLCNGVDDCGDGSDEKEEHCRK--PTHKPCTDTEYKCSNGNCVSQHYVCDNVDDCGDLSDETGCNLGENRTC 3972          

HSP 17 Score: 56.225 bits (134), Expect = 2.449e-6
Identity = 42/121 (34.71%), Postives = 57/121 (47.11%), Query Frame = 1
Query: 2113 CKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE--LNCPVK----NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEED 2457
            C N  CI  +  C+G N+C DN   D K C    P +   DF K    N  C+ + + CDG +DCG+  DE  + C       N+ +C+  H        IP  ++CDGE DC    DE D
Sbjct: 2789 CSNGRCIPLSYVCNGINNCHDNDTSDEKNC---PPITCQPDFAKCQTTNI-CVPRAFLCDGDNDCGDGSDENPIYCASHTCRSNEFQCVSPHRC------IPSYWFCDGEADCVDSSDEPD 2899          

HSP 18 Score: 55.4546 bits (132), Expect = 4.844e-6
Identity = 45/141 (31.91%), Postives = 62/141 (43.97%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN----ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLL-IPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTP 2499
            C  +Q  C+N  CI +   CD  NDCGD SDE    C+     C P+   CD       N  CI     C+ +DDC +N DE  C +        +H  C++N      S++C   P    M D+  C +   I+  K TP
Sbjct: 3034 CRDDQFTCQNGQCITKLYVCDEDNDCGDGSDEQEHLCHTPEPTCPPHQFRCD-------NGHCIEMGTVCNHVDDCSDNSDEKGCGINECQDSSISH--CDHNCTDTITSFYCSCLPGYKLMSDKRTCVD---IDECKETP 3162          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A4D6FZV6 (Pharynx muscle-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=phmus-1 PE=2 SV=1)

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 303/304 (99.67%), Postives = 304/304 (100.00%), Query Frame = 1
Query: 2596 PENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSG 3507
            PENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMS+ISMQEAIETTNSYSWAAKLEKCKCPAGYSG
Sbjct:    1 PENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSRISMQEAIETTNSYSWAAKLEKCKCPAGYSG 304          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A095AGT9 (Basement membrane-specific heparan sulfate proteoglycan core protein (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_01273 PE=4 SV=1)

HSP 1 Score: 541.191 bits (1393), Expect = 5.413e-164
Identity = 291/780 (37.31%), Postives = 429/780 (55.00%), Query Frame = 1
Query: 1216 KIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQG----KVLWRRMDKKSLTVFKETRFDSKM-LSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLC-NNNLLIPRSYWCDGEPDCS-SMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRC--TLPAT--RRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            K+E++    + + Y +G   ELHCE+   +  ++  G ++IWTFNG  +    N       RLD    S++VIK M   +EG Y+C Q S+     ++   + V + I P   E   N   I E HCR+D     +  I+W FIPE    E+ L  + K++ P A  STSF+ I NV K HEG YVC+ L+ +   +++V+T+  L V+P+ V  +PG   +F+CEL  + G    KV W R D++ L   KE    +    +LL VKD  + D    Y C       Y  LYV+E C    R C ++ C++E KFCDG  DC D  DE   KC+EC  N   C  + D  P K C ++ W CDG DDCGNN+DE NC   +  D+C GTHY C   + +I R++ CD   DC  + +DE +CS P IIEP   T +    +  LT+TC   GRP PTISWRYNW HL E + ++I  TV NC++  S LT+ ++ +  SG+Y+CE ++R R +APDF V+V KG IC+ P +N+ AW+  MC+ CYCSN+TD+C+S  GY  +P  +    K +   +  +      +  + +T  +   ++           VPN   +    FN++GSW+  YGY +   L L GE+ +YLPGP +++     SIY C    RL V+     ++N + I L E+D W+ D++C  T+  T  R  F+ VL NV+ +  +VKYY  QT  ++  + ++ AI++     W  ++E+C CP GY GLSCE
Sbjct:  308 KMELSETTTEIFSYRNGESLELHCEL---EKDFVGTGENVIWTFNGGTLPTGTN-------RLDRLRTSVIVIKEMENIHEGLYECQQNSKKLRGHIIRAPTIVTLSILPKEDEAWANAGDITEFHCRLDGREYGNQLIDWYFIPEGDDREISLHNDVKIDNPDATPSTSFLSIMNVQKYHEGLYVCRALNLRDTAKLIVKTRD-LTVTPEEVKARPGTTVQFLCELSTITGMKGGKVFWMRTDRQDLRPGKEEVIGTNGGRALLIVKDVGRFDHNISYMCTDGYSKGYAKLYVQEVCAPGFRPCGSQECLEETKFCDGVVDCEDGYDEIPSKCSECGVNENVCGIVNDVKPLKNCYLQFWHCDGEDDCGNNYDESNCLAPSVYDQCNGTHYTCPQGDKMIARAFMCDSVTDCEPNGDDESECSYPSIIEPSGETHLIGHQSENLTLTCVAYGRPPPTISWRYNWGHLREGVKHSINYTVINCNMAISHLTLYDLESRASGLYTCEAVNRGRALAPDFLVNVAKGGICKAPQFNDAAWFDDMCLTCYCSNVTDKCTSVKGYRKSPHDLMFDYKTTPIILSTYNQDGSVEEGQGVTEIDGDILRI--------PDVPNEATFVESDFNLSGSWVKSYGYNIILNLRLFGESLNYLPGPFIILNSTDRSIYWCPPNDRLLVHTIPTGYDNQIHIRLTERDKWYIDNKCKHTIEQTIGRSGFMQVLSNVKKISLRVKYYQDQTTLELFNVKVEHAIKSDVPGQWVGEIEECICPHGYEGLSCE 1068          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A5K4F322 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 539.265 bits (1388), Expect = 2.887e-159
Identity = 290/782 (37.08%), Postives = 422/782 (53.96%), Query Frame = 1
Query: 1216 KIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLP--TEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQG----KVLWRRMDKKSLTVFKETRFDSKM-LSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNK-DKCIGTHYLC-NNNLLIPRSYWCDGEPDCS-SMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCT----LPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            K+E++    + + Y +G   ELHCE+   +  +I  G ++IW FNG  +    N       RLD    SI+VIK M   +EG Y+C Q S+     +L   + V + + P   E   N N I E HCR+D     +  I+W FIP  S  + ++P   + K++ P    STSF+ I NV K HEG YVC+ L+ K   +++V+ +  L V+P+ V  +PG   +F+CEL  + G    KV W R D++ L   KE    +    +LL VKD  + D    Y C       Y  LYV+E C    R C ++ C++E KFCDG  DC D  DE   KC EC  N   C  + D  P K C ++ W CDG DDCGNNFDE NC   +  D+C GTHY C   + +I R++ CD  PDC  + +DE +CS P IIEP   T +    +  LT+TC   GRP PTISWRYNW HL E + ++I  TV NC++  S LT+ ++    SG+Y+CE ++R R +APDF V+V KG IC+ P +N+ AW+  MC+ CYCSN+TD C+S  GY  +P  +    K +   +  +      +  + IT  +   ++           VPN   +    FN++GSW+  YGY +   L L GE+ +YLPGP V++     SIY C    RL V+     ++N + I L E+D WF D  C         R  F+ ++ +++ + F+VKY+  QT  ++  I ++ A+++     W  ++E+C CP GY GLSCE
Sbjct:  423 KMELSETTTEIFSYRNGDTLELHCEL---EKDFIGTGENVIWKFNGGTLPTGAN-------RLDKLKTSIIVIKEMGNIHEGLYECQQNSKKLRGHILRAPTIVTLTVLPKEDERWANANDITEFHCRLDGRENGNQLIDWYFIPAGSDDDREIPLHNDVKIDNPDTTPSTSFLSIMNVQKYHEGFYVCRALNLKDTAKLIVKIRD-LTVTPEEVKARPGTTVQFLCELSTITGMKGGKVFWMRTDRQDLRSGKEEVIGTNGGRALLIVKDVGRFDHNISYMCTDGYSKGYAKLYVQEVCAPGFRPCGSQQCLEETKFCDGVVDCEDGYDEIPSKCTECGVNENACGLMNDVKPLKNCYLQFWHCDGEDDCGNNFDESNCLAPSDYDQCNGTHYTCPQGDKMIARAFMCDSVPDCEPNGDDESECSYPSIIEPSGETHLIGHQSGNLTLTCVAYGRPPPTISWRYNWGHLREGVKHSINYTVINCNMAISHLTLTDLEPRASGLYTCEAVNRGRALAPDFLVNVAKGGICKAPQFNDAAWFDDMCLTCYCSNVTDTCTSVKGYRKSPHDLLLDFKTTPIILSTYNQDGSIEEGQGITEIDGDILRI--------PDVPNESTFIESDFNLSGSWVKSYGYDIIINLRLFGESLNYLPGPFVILNSTDQSIYWCPPNDRLLVHTIPTGYDNRIHIRLSERDKWFIDKECKQKIDQTIGRAGFMQIISDIKKIGFRVKYFRDQTTLELFNIKVEHAVKSDVPGQWVGEIEECTCPNGYEGLSCE 1185          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A5K4F4U5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 539.265 bits (1388), Expect = 2.915e-159
Identity = 290/782 (37.08%), Postives = 422/782 (53.96%), Query Frame = 1
Query: 1216 KIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLP--TEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQG----KVLWRRMDKKSLTVFKETRFDSKM-LSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNK-DKCIGTHYLC-NNNLLIPRSYWCDGEPDCS-SMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCT----LPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            K+E++    + + Y +G   ELHCE+   +  +I  G ++IW FNG  +    N       RLD    SI+VIK M   +EG Y+C Q S+     +L   + V + + P   E   N N I E HCR+D     +  I+W FIP  S  + ++P   + K++ P    STSF+ I NV K HEG YVC+ L+ K   +++V+ +  L V+P+ V  +PG   +F+CEL  + G    KV W R D++ L   KE    +    +LL VKD  + D    Y C       Y  LYV+E C    R C ++ C++E KFCDG  DC D  DE   KC EC  N   C  + D  P K C ++ W CDG DDCGNNFDE NC   +  D+C GTHY C   + +I R++ CD  PDC  + +DE +CS P IIEP   T +    +  LT+TC   GRP PTISWRYNW HL E + ++I  TV NC++  S LT+ ++    SG+Y+CE ++R R +APDF V+V KG IC+ P +N+ AW+  MC+ CYCSN+TD C+S  GY  +P  +    K +   +  +      +  + IT  +   ++           VPN   +    FN++GSW+  YGY +   L L GE+ +YLPGP V++     SIY C    RL V+     ++N + I L E+D WF D  C         R  F+ ++ +++ + F+VKY+  QT  ++  I ++ A+++     W  ++E+C CP GY GLSCE
Sbjct:  423 KMELSETTTEIFSYRNGDTLELHCEL---EKDFIGTGENVIWKFNGGTLPTGAN-------RLDKLKTSIIVIKEMGNIHEGLYECQQNSKKLRGHILRAPTIVTLTVLPKEDERWANANDITEFHCRLDGRENGNQLIDWYFIPAGSDDDREIPLHNDVKIDNPDTTPSTSFLSIMNVQKYHEGFYVCRALNLKDTAKLIVKIRD-LTVTPEEVKARPGTTVQFLCELSTITGMKGGKVFWMRTDRQDLRSGKEEVIGTNGGRALLIVKDVGRFDHNISYMCTDGYSKGYAKLYVQEVCAPGFRPCGSQQCLEETKFCDGVVDCEDGYDEIPSKCTECGVNENACGLMNDVKPLKNCYLQFWHCDGEDDCGNNFDESNCLAPSDYDQCNGTHYTCPQGDKMIARAFMCDSVPDCEPNGDDESECSYPSIIEPSGETHLIGHQSGNLTLTCVAYGRPPPTISWRYNWGHLREGVKHSINYTVINCNMAISHLTLTDLEPRASGLYTCEAVNRGRALAPDFLVNVAKGGICKAPQFNDAAWFDDMCLTCYCSNVTDTCTSVKGYRKSPHDLLLDFKTTPIILSTYNQDGSIEEGQGITEIDGDILRI--------PDVPNESTFIESDFNLSGSWVKSYGYDIIINLRLFGESLNYLPGPFVILNSTDQSIYWCPPNDRLLVHTIPTGYDNRIHIRLSERDKWFIDKECKQKIDQTIGRAGFMQIISDIKKIGFRVKYFRDQTTLELFNIKVEHAVKSDVPGQWVGEIEECTCPNGYEGLSCE 1185          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Match: A0A5J4NMJ0 (Heparan sulfate proteoglycan 2 (Perlecan) OS=Paragonimus westermani OX=34504 GN=DEA37_0013778 PE=4 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.626e-151
Identity = 275/771 (35.67%), Postives = 422/771 (54.73%), Query Frame = 1
Query: 1243 QYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQG----KVLWRRMDKKSLTVFKETRFDSKM-LSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNK-DKCIGTHYLC-NNNLLIPRSYWCDGEPDCS-SMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTL----PATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            + + Y SG   ++ C+   VD +    G DI+WT NG          +  + R D    S+++I NM+ E+EG Y C Q+ ++    L+ +   + +E+ P       N     E  CR+      +  ++W FIP  ++ E+ + ++ ++ RPSA  STSF+ I++V K HEG Y+C+  D K    +VV+T+ +  V+P+ V  +PG   RF+CEL  V G    K+ W R D++ LT  KE    S    +LL VK    +D+GTVY C     +    L+V++ C    R C +  CI+ +KFCDGK DC D SDE + KC EC  N   C+   D  P + C +++W+CDG DDCGNNFDE+ CP  +  DKC GTHY C  +   I R++ CD  PDC    EDE +CS P +IEP   + +    +S LT+TC + GRP P I+WR+NW  L E +D+ + TTV +C+ + S LT+ N+    SG+Y+CE +++ R +APD SV+V KG +C  P +N+ AW+  MC  CYCS +T++C SA GY  +     S+ K  D     ++ + Y             + +     TY  +   +P  Y    F + GS LT YGY L + L   G +S+YLPG L+ I G + S Y C    R+ +Y     ++N + +   E+D W++D  CT     P  R +F++VL++VR +  ++K Y  Q + ++  ++++ A  +     W A++E+C+CP GY GLSCE
Sbjct:  199 KVFSYESGEAAQITCD---VDKQHAETGKDIVWTLNG-------GPPRDGVKRTDRMLTSMIIIPNMSPEDEGVYACEQQGKLRQLHLIEKSVKLELELLPESDTRWANAGENTEFRCRLYGRTDGNRLVDWTFIPAGTEDEIHVHSDVEITRPSATPSTSFLTIDSVQKYHEGQYLCRAFDLKKTATLVVKTREI-SVTPESVDARPGTTVRFLCELSVVPGARGGKLYWIRTDRRDLTPGKEEVIGSTGGRTLLIVKSLDWNDNGTVYMCTDGVSSVTAQLFVRDVCGPGYRACSSHECIESSKFCDGKEDCTDGSDELQAKCLECGANEFTCEIWNDKQPVRNCYLQYWRCDGEDDCGNNFDEVGCPPPSAADKCNGTHYRCPTSGKFIARAFMCDSVPDCEPDGEDEHECSLPTVIEPSGDSQLFGLQSSNLTLTCVVYGRPPPAINWRFNWGGLREGVDHVVNTTVVDCNKVISHLTLTNLEPHASGLYTCEAVNKGRTLAPDISVNVAKGGLCTSPMFNDAAWFEDMCHLCYCSGVTNKCQSAKGYVKS-----STDKSWDIVSHPWQVRAYTPDGVVDVHEGVESTENLFRFTYGTE---HP-AYLESTFGLNGSLLTSYGYNLKFTLRQFGSSSNYLPGALIAIHGTNKSAYWCPPSDRVLLYTLPVGYDNPISVRFNERDRWYSDLNCTQSLNHPLGRSEFMDVLRDVRRIGIRMKNYGEQVSVELQDMTLEYATRSDVPGVWVAEVEQCECPVGYEGLSCE 949          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 192.971 bits (489), Expect = 5.085e-49
Identity = 142/503 (28.23%), Postives = 222/503 (44.14%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC---NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVTKGQICQRPFYNNDAWYPQ-------MCIRCYCSNLTDECSSATGYATNPVL------------IESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C  +Q  C+N  CI  +  CDG+ DC D SDE   KC   + C PN   C        N RC +K W+CDG +DC +N DE++CPV+   D C    ++C ++   IP SY CD EPDC+   DE  C+ P +  P + + ++     T+T TCK  G P P I+WR NW H+P  +   IT T  N      +LT++++     G Y+CE I+ + ++   PD  +++ +      PF+      P+        C+ C+C  +T  C S   Y     L            +   I+P     +   T+    P  E  F      + F++   +  L   P  + G   +  G +L    Y ++Y L   G   D     L++  G+        + YR     S ++   N R   + ++NW   H      TR + +  L NV  +  +  Y N   +  +S + M       +       +E+C+CP GYSGLSCE+
Sbjct:  191 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDE--MKCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDS-VTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIP--VSSRITMTSENGQ---GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRN---AGPFFFAHCNCPEGHFNIGGRCMPCFCFGITKNCQSTGRYRNQISLRFDEEENFKGVNVSYPIRPGAPPPLT-STQILINPEEE-EFQLVDLSRRFLDLDSHWTL---PRQFLGNKVDSYGGFLR---YKVSYSLQREGSEPDNKADILLMGNGQ-------RLVYRRGSPTSPDI--KNQREIKFTEENW--QHTSGRSVTREELLMTLANVESIRIRTVYDNRMVSVGLSDVVMDTTSVEFSLQGQPKDVEECRCPPGYSGLSCES 656          

HSP 2 Score: 65.0846 bits (157), Expect = 4.942e-10
Identity = 61/252 (24.21%), Postives = 105/252 (41.67%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYK-KLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGEN-SDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            C+   ++  A  P  C++C+C  +T +C+S+T +  + V             VN +       A   T     + K     +Y     VP+  YY+    +  G  +T YG  L YK+    ++ S  + G P VV++G    + H S    LP   +  V     R   W + +         P TR   +  L +V +++ +  Y +  +   +S I M  A+  +     A ++E+C CP GY G SC+
Sbjct:  801 CKPGSFHLSADNPDGCLQCFCMGVTKQCASST-WTRDQV----------RGGVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNSVPSDIYYWVMPESFRGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQGNGIFLEHSSQTKPLPRVPT--VVTVPFRESAWRRADG-------QPCTREHLLMALADVAVLMIRATYADKMSESSISDIHMDIAVPHSTGNERAMEVEECACPQGYRGPSCQ 1032          

HSP 3 Score: 63.5438 bits (153), Expect = 1.635e-9
Identity = 57/247 (23.08%), Postives = 105/247 (42.51%), Query Frame = 1
Query: 2818 CIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVNFKTKEYYKPAREITF-ANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPG----PL----VVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+ C+C  +T +C+S++ Y     ++ S   P +    A+VN +          +   A+      F N   + +L   P +Y+    +  G  +  YG  L Y +        Y+PG    P+    V I G   ++       R      +  FE   R   W++ +        +P TR   + VL ++  +L +  Y+    +  +S +SM+ A+      + A ++E+C+CP GY GLSC++
Sbjct: 1183 CLICFCMGITQQCTSSSYYRD---VVTSVFAPGNTQGYALVNRQRTNRITSGFSVEVSADGTTQTSFTN---FDRLGQEP-HYWQLPNSYQGDKVGSYGGKLKYTI-------SYVPGSRGAPIDDIDVQIIGNDITLVARQDWRRGQGTRESRSFEIVFREDYWKRPDG-------MPTTREHLLMVLADLDDILIRASYHTEMRSSSISGVSMEIAVPNYTGLAQALEVEQCRCPPGYQGLSCQD 1408          

HSP 4 Score: 55.0694 bits (131), Expect = 6.693e-7
Identity = 32/98 (32.65%), Postives = 37/98 (37.76%), Query Frame = 1
Query: 2257 NKRCIIKHWQCDGIDDCGNNFDELNC-------------------PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            N  CI     CD I  C +  DE NC                   P+     C G   +C N   I R Y CDGE DC+   DE  C  P   EP +F
Sbjct:  139 NGECIQLDQLCDQIQHCEDGSDEENCATDAPTTTTTRSTTTVERRPLPGPGPCRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPSPCEPNEF 236          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 192.586 bits (488), Expect = 5.787e-49
Identity = 142/503 (28.23%), Postives = 222/503 (44.14%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC---NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVTKGQICQRPFYNNDAWYPQ-------MCIRCYCSNLTDECSSATGYATNPVL------------IESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C  +Q  C+N  CI  +  CDG+ DC D SDE   KC   + C PN   C        N RC +K W+CDG +DC +N DE++CPV+   D C    ++C ++   IP SY CD EPDC+   DE  C+ P +  P + + ++     T+T TCK  G P P I+WR NW H+P  +   IT T  N      +LT++++     G Y+CE I+ + ++   PD  +++ +      PF+      P+        C+ C+C  +T  C S   Y     L            +   I+P     +   T+    P  E  F      + F++   +  L   P  + G   +  G +L    Y ++Y L   G   D     L++  G+        + YR     S ++   N R   + ++NW   H      TR + +  L NV  +  +  Y N   +  +S + M       +       +E+C+CP GYSGLSCE+
Sbjct:  191 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDE--MKCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDS-VTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIP--VSSRITMTSENGQ---GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRN---AGPFFFAHCNCPEGHFNIGGRCMPCFCFGITKNCQSTGRYRNQISLRFDEEENFKGVNVSYPIRPGAPPPLT-STQILINPEEE-EFQLVDLSRRFLDLDSHWTL---PRQFLGNKVDSYGGFLR---YKVSYSLQREGSEPDNKADILLMGNGQ-------RLVYRRGSPTSPDI--KNQREIKFTEENW--QHTSGRSVTREELLMTLANVESIRIRTVYDNRMVSVGLSDVVMDTTSVEFSLQGQPKDVEECRCPPGYSGLSCES 656          

HSP 2 Score: 65.4698 bits (158), Expect = 4.861e-10
Identity = 61/252 (24.21%), Postives = 105/252 (41.67%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYK-KLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGEN-SDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            C+   ++  A  P  C++C+C  +T +C+S+T +  + V             VN +       A   T     + K     +Y     VP+  YY+    +  G  +T YG  L YK+    ++ S  + G P VV++G    + H S    LP   +  V     R   W + +         P TR   +  L +V +++ +  Y +  +   +S I M  A+  +     A ++E+C CP GY G SC+
Sbjct:  801 CKPGSFHLSADNPDGCLQCFCMGVTKQCASST-WTRDQV----------RGGVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNSVPSDIYYWVMPESFRGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQGNGIFLEHSSQTKPLPRVPT--VVTVPFRESAWRRADG-------QPCTREHLLMALADVAVLMIRATYADKMSESSISDIHMDIAVPHSTGNERAMEVEECACPQGYRGPSCQ 1032          

HSP 3 Score: 63.5438 bits (153), Expect = 1.622e-9
Identity = 57/247 (23.08%), Postives = 105/247 (42.51%), Query Frame = 1
Query: 2818 CIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVNFKTKEYYKPAREITF-ANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPG----PL----VVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+ C+C  +T +C+S++ Y     ++ S   P +    A+VN +          +   A+      F N   + +L   P +Y+    +  G  +  YG  L Y +        Y+PG    P+    V I G   ++       R      +  FE   R   W++ +        +P TR   + VL ++  +L +  Y+    +  +S +SM+ A+      + A ++E+C+CP GY GLSC++
Sbjct: 1183 CLICFCMGITQQCTSSSYYRD---VVTSVFAPGNTQGYALVNRQRTNRITSGFSVEVSADGTTQTSFTN---FDRLGQEP-HYWQLPNSYQGDKVGSYGGKLKYTI-------SYVPGSRGAPIDDIDVQIIGNDITLVARQDWRRGQGTRESRSFEIVFREDYWKRPDG-------MPTTREHLLMVLADLDDILIRASYHTEMRSSSISGVSMEIAVPNYTGLAQALEVEQCRCPPGYQGLSCQD 1408          

HSP 4 Score: 55.0694 bits (131), Expect = 6.924e-7
Identity = 32/98 (32.65%), Postives = 37/98 (37.76%), Query Frame = 1
Query: 2257 NKRCIIKHWQCDGIDDCGNNFDELNC-------------------PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            N  CI     CD I  C +  DE NC                   P+     C G   +C N   I R Y CDGE DC+   DE  C  P   EP +F
Sbjct:  139 NGECIQLDQLCDQIQHCEDGSDEENCATDAPTTTTTRSTTTVERRPLPGPGPCRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPSPCEPNEF 236          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 192.586 bits (488), Expect = 6.226e-49
Identity = 141/497 (28.37%), Postives = 220/497 (44.27%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC---NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVTK-GQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVL------------IESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C  +Q  C+N  CI  +  CDG+ DC D SDE   KC   + C PN   C        N RC +K W+CDG +DC +N DE++CPV+   D C    ++C ++   IP SY CD EPDC+   DE  C+ P +  P + + ++     T+T TCK  G P P I+WR NW H+P  +   IT T  N      +LT++++     G Y+CE I+ + ++   PD  +++ +    C    +N        C+ C+C  +T  C S   Y     L            +   I+P     +   T+    P  E  F      + F++   +  L   P  + G   +  G +L    Y ++Y L   G   D     L++  G+        + YR     S ++   N R   + ++NW   H      TR + +  L NV  +  +  Y N   +  +S + M       +       +E+C+CP GYSGLSCE+
Sbjct:  196 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDE--MKCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDS-VTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIP--VSSRITMTSENGQ---GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRVPSNCPEGHFNIGG----RCMPCFCFGITKNCQSTGRYRNQISLRFDEEENFKGVNVSYPIRPGAPPPLT-STQILINPEEE-EFQLVDLSRRFLDLDSHWTL---PRQFLGNKVDSYGGFLR---YKVSYSLQREGSEPDNKADILLMGNGQ-------RLVYRRGSPTSPDI--KNQREIKFTEENW--QHTSGRSVTREELLMTLANVESIRIRTVYDNRMVSVGLSDVVMDTTSVEFSLQGQPKDVEECRCPPGYSGLSCES 654          

HSP 2 Score: 65.4698 bits (158), Expect = 4.677e-10
Identity = 61/252 (24.21%), Postives = 105/252 (41.67%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYK-KLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGEN-SDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            C+   ++  A  P  C++C+C  +T +C+S+T +  + V             VN +       A   T     + K     +Y     VP+  YY+    +  G  +T YG  L YK+    ++ S  + G P VV++G    + H S    LP   +  V     R   W + +         P TR   +  L +V +++ +  Y +  +   +S I M  A+  +     A ++E+C CP GY G SC+
Sbjct:  799 CKPGSFHLSADNPDGCLQCFCMGVTKQCASST-WTRDQV----------RGGVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNSVPSDIYYWVMPESFRGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQGNGIFLEHSSQTKPLPRVPT--VVTVPFRESAWRRADG-------QPCTREHLLMALADVAVLMIRATYADKMSESSISDIHMDIAVPHSTGNERAMEVEECACPQGYRGPSCQ 1030          

HSP 3 Score: 55.8398 bits (133), Expect = 3.851e-7
Identity = 22/70 (31.43%), Postives = 41/70 (58.57%), Query Frame = 1
Query: 3313 LPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            +P TR   + VL ++  +L +  Y+    +  +S +SM+ A+      + A ++E+C+CP GY GLSC++
Sbjct: 1447 MPTTREHLLMVLADLDDILIRASYHTEMRSSSISGVSMEIAVPNYTGLAQALEVEQCRCPPGYQGLSCQD 1516          

HSP 4 Score: 55.0694 bits (131), Expect = 5.967e-7
Identity = 32/98 (32.65%), Postives = 37/98 (37.76%), Query Frame = 1
Query: 2257 NKRCIIKHWQCDGIDDCGNNFDELNC-------------------PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            N  CI     CD I  C +  DE NC                   P+     C G   +C N   I R Y CDGE DC+   DE  C  P   EP +F
Sbjct:  144 NGECIQLDQLCDQIQHCEDGSDEENCATDAPTTTTTRSTTTVERRPLPGPGPCRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPSPCEPNEF 241          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZDB-GENE-080807-4])

HSP 1 Score: 192.586 bits (488), Expect = 6.539e-49
Identity = 141/497 (28.37%), Postives = 220/497 (44.27%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC---NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVTK-GQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVL------------IESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C  +Q  C+N  CI  +  CDG+ DC D SDE   KC   + C PN   C        N RC +K W+CDG +DC +N DE++CPV+   D C    ++C ++   IP SY CD EPDC+   DE  C+ P +  P + + ++     T+T TCK  G P P I+WR NW H+P  +   IT T  N      +LT++++     G Y+CE I+ + ++   PD  +++ +    C    +N        C+ C+C  +T  C S   Y     L            +   I+P     +   T+    P  E  F      + F++   +  L   P  + G   +  G +L    Y ++Y L   G   D     L++  G+        + YR     S ++   N R   + ++NW   H      TR + +  L NV  +  +  Y N   +  +S + M       +       +E+C+CP GYSGLSCE+
Sbjct:  196 CRGDQAMCQNGQCISRDYLCDGERDCTDGSDE--MKCGTPSPCEPNEFKCK-------NGRCALKLWRCDGDNDCKDNSDEMDCPVRRPGDACAPEQFVCLSDRACIPASYQCDEEPDCADRSDEYGCAPPTVTSPPEDS-VTAMRGGTVTFTCKAVGVPTPIITWRLNWGHIP--VSSRITMTSENGQ---GTLTIRDVKEGDQGAYTCEAINAKGLVFAIPDGVLTLNRVPSNCPEGHFNIGG----RCMPCFCFGITKNCQSTGRYRNQISLRFDEEENFKGVNVSYPIRPGAPPPLT-STQILINPEEE-EFQLVDLSRRFLDLDSHWTL---PRQFLGNKVDSYGGFLR---YKVSYSLQREGSEPDNKADILLMGNGQ-------RLVYRRGSPTSPDI--KNQREIKFTEENW--QHTSGRSVTREELLMTLANVESIRIRTVYDNRMVSVGLSDVVMDTTSVEFSLQGQPKDVEECRCPPGYSGLSCES 654          

HSP 2 Score: 65.4698 bits (158), Expect = 4.753e-10
Identity = 61/252 (24.21%), Postives = 105/252 (41.67%), Query Frame = 1
Query: 2773 CQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYK-KLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGEN-SDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            C+   ++  A  P  C++C+C  +T +C+S+T +  + V             VN +       A   T     + K     +Y     VP+  YY+    +  G  +T YG  L YK+    ++ S  + G P VV++G    + H S    LP   +  V     R   W + +         P TR   +  L +V +++ +  Y +  +   +S I M  A+  +     A ++E+C CP GY G SC+
Sbjct:  799 CKPGSFHLSADNPDGCLQCFCMGVTKQCASST-WTRDQV----------RGGVNGQLFSLANGANTRTITEGISQKGSAEISYRSFNSVPSDIYYWVMPESFRGDKVTAYGGELRYKVRFEHQSFSLVIDGQPDVVLQGNGIFLEHSSQTKPLPRVPT--VVTVPFRESAWRRADG-------QPCTREHLLMALADVAVLMIRATYADKMSESSISDIHMDIAVPHSTGNERAMEVEECACPQGYRGPSCQ 1030          

HSP 3 Score: 56.225 bits (134), Expect = 2.548e-7
Identity = 58/280 (20.71%), Postives = 113/280 (40.36%), Query Frame = 1
Query: 2818 CIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVNFKTKEYYKPAREITF-ANKAAMKYFIN------ETYYKKLVPNPDYYFGGAF-------NMAGSWLTRYGYPLTYK-LILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASN----------EVFENNMRIYL---WEQDNWFTDHRC--------------TLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            C+ C+C  +T +C+S++ Y     ++ S   P +    A+VN +          +   A+      F N      E +Y +L   P+ Y G          N+   + ++Y Y L YK   L  ++  +   P    +G+    Y   +KY +     +          ++  N++ +     W +     + R                +P TR   + VL ++  +L +  Y+    +  +S +SM+ A+      + A ++E+C+CP GY GLSC++
Sbjct: 1181 CLICFCMGITQQCTSSSYYRD---VVTSVFAPGNTQGYALVNRQRTNRITSGFSVEVSADGTTQTSFTNFDRLGQEPHYWQL---PNSYQGDKVQSDTNICNVFFFFFSQYRYALVYKDFSLHPDDVLFWQLP-PKFRGDKVGSYGGKLKYTISYVPGSRGAPIDDIDVQIIGNDITLVARQDWRRGQGTRESRSFEIVFREDYWKRPDGMPTTREHLLMVLADLDDILIRASYHTEMRSSSISGVSMEIAVPNYTGLAQALEVEQCRCPPGYQGLSCQD 1453          

HSP 4 Score: 55.0694 bits (131), Expect = 6.710e-7
Identity = 32/98 (32.65%), Postives = 37/98 (37.76%), Query Frame = 1
Query: 2257 NKRCIIKHWQCDGIDDCGNNFDELNC-------------------PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            N  CI     CD I  C +  DE NC                   P+     C G   +C N   I R Y CDGE DC+   DE  C  P   EP +F
Sbjct:  144 NGECIQLDQLCDQIQHCEDGSDEENCATDAPTTTTTRSTTTVERRPLPGPGPCRGDQAMCQNGQCISRDYLCDGERDCTDGSDEMKCGTPSPCEPNEF 241          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 90.8929 bits (224), Expect = 8.767e-18
Identity = 46/135 (34.07%), Postives = 68/135 (50.37%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            +C  N   C N  C+ ++  CDG +DC DNSDE       C  N+  C        N+RC+ ++W+CDG +DC +  DE  CP +    C    + C N+  IPR++ CD + DC    DE +C +     P +F
Sbjct: 1011 QCGSNSFSCSNGKCVPQSYRCDGVDDCHDNSDE-----ASCGANNSTCSSTAFTCANQRCVPRNWRCDGHNDCFDGSDERECPTQTPGTCQADQFSCANHRCIPRTWLCDTDNDCGDGSDETNCDSIGTCHPGQF 1140          

HSP 2 Score: 88.9669 bits (219), Expect = 3.239e-17
Identity = 54/142 (38.03%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 2068 VTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEEDC 2460
              L    +C  +Q +C N+ CI E   CDG+NDCGDNSDED   C+   C P    C        N RCI + W+CD  DDCG+N DE   P+   D+C+G  Y C+N+           +P    C+G  DC    DE++C
Sbjct: 3573 TVLCATHQCEAHQWQCNNKRCIPEAWQCDGENDCGDNSDEDPSHCSSRTCRPGQFKCS-------NGRCIPQSWKCDVDDDCGDNSDE---PI---DECMGPAYRCDNHTEFDCVTNYRCVPLWALCNGHNDCRDNSDEQNC 3701          

HSP 3 Score: 81.2629 bits (199), Expect = 6.443e-15
Identity = 55/154 (35.71%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 2020 DDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDED-RKKCNE----CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            D+GT  +CA           +   C  +Q +C +  CI  +  CDG NDCGD SDED R  C E    CS     C  + +  P ++CI + W CDG  DC + +DE  NC    +  C    + C+N L I  SY CD   DC    DE+ C+
Sbjct: 2870 DEGT--DCADGSDEPSTCTTMVRTCNSDQFRCDDGRCIASSWICDGDNDCGDMSDEDQRHNCGESNRTCSSLEFTC--VNNQPPQRKCIPRDWVCDGDADCSDAYDEHQNC---TRRSCSANEFTCSNGLCIRSSYRCDRRNDCGDSSDEQGCT 3016          

HSP 4 Score: 74.7146 bits (182), Expect = 6.687e-13
Identity = 46/132 (34.85%), Postives = 66/132 (50.00%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE--EDCSNP 2469
              C L Q +C +  C   +  C+   DC D SDED   C  ++C  +   C+       NKRCI + WQCDG +DCG+N DE      ++  C    + C+N   IP+S+ CD + DC    DE  ++C  P
Sbjct: 3538 RHCRLGQFQCNDGNCTSPHFLCNSNQDCPDGSDEDTVLCATHQCEAHQWQCN-------NKRCIPEAWQCDGENDCGDNSDEDPSHCSSR-TCRPGQFKCSNGRCIPQSWKCDVDDDCGDNSDEPIDECMGP 3661          

HSP 5 Score: 73.9442 bits (180), Expect = 1.028e-12
Identity = 44/123 (35.77%), Postives = 58/123 (47.15%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            + C   Q +C N  C+     CD  +DCGD SDE       C      C       P+ RCI + W CDG DDCG+N DE  C    + +C    + C ++ + IP  + CDG P C   EDE
Sbjct:  177 QRCSSGQFQCSNGECVPRGYVCDHDDDCGDRSDEQNCTYPTCRGTYFTC-------PSGRCIHQVWLCDGEDDCGDNADERGCDNVQR-ECFPGEWPCPSSGVCIPMEHLCDGTPHCPDGEDE 291          

HSP 6 Score: 72.7886 bits (177), Expect = 2.552e-12
Identity = 51/136 (37.50%), Postives = 65/136 (47.79%), Query Frame = 1
Query: 2086 EECPLNQRKCKNET---------CIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            +EC     +C N T         C+     C+G NDC DNSDE  + C E  C P     DF  D   N +CI   W+CDG +DCG+  DE NC  +    C  + Y C+N   IP  + CD + DC    DE DC
Sbjct: 3656 DECMGPAYRCDNHTEFDCVTNYRCVPLWALCNGHNDCRDNSDE--QNCEELTCDPAG---DFRCD---NHQCIPLRWKCDGDNDCGDGSDERNCSPR---ACTESEYRCDNLHCIPDRWVCDHDNDCEDNSDERDC 3780          

HSP 7 Score: 72.4034 bits (176), Expect = 3.124e-12
Identity = 47/116 (40.52%), Postives = 64/116 (55.17%), Query Frame = 1
Query: 2113 CKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNF--DELNCPVKNKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDE 2451
            C N  C+  +  CD  NDCGDNSDE+      C P++   +F  +   N RCI + + C+G ++C +N   DE NCP +    C   H  C + N+ IPRSY CDG+ DC  M DE
Sbjct: 2734 CGNGRCVPYHYRCDHYNDCGDNSDEEGCVFRPCDPDT---EFTCN---NGRCIAREYVCNGFNNCYDNGTSDEQNCPERT---CQPEHTKCQSTNICIPRSYLCDGDNDCGDMSDE 2840          

HSP 8 Score: 71.633 bits (174), Expect = 6.500e-12
Identity = 45/136 (33.09%), Postives = 62/136 (45.59%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
             +  C  N+  C N  CI  +  CD +NDCGD+SDE       C  +   C        N RCI   + CDG +DCG+  DEL+   +     C   +Y C N   +P S  CD   DC+   DE+ C   +  +P
Sbjct: 2977 TRRSCSANEFTCSNGLCIRSSYRCDRRNDCGDSSDEQGCTYQSCQQHQFTCQ-------NGRCISSDFVCDGDNDCGDESDELDHLCRTPAPTCPPGNYRCENGNCVPASQVCDHSDDCNDNSDEKGCGINECTDP 3105          

HSP 9 Score: 70.8626 bits (172), Expect = 1.068e-11
Identity = 44/127 (34.65%), Postives = 58/127 (45.67%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNET-CIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            +  C     KC++   CI  +  CDG NDCGD SDE    C  + CS N   C        + RCI  HW CD   DC +  DE +        C    + C++   I  S+ CDG+ DC  M DE+
Sbjct: 2805 ERTCQPEHTKCQSTNICIPRSYLCDGDNDCGDMSDESPTHCASSTCSQNEFRC-------TSGRCIPAHWYCDEGTDCADGSDEPSTCTTMVRTCNSDQFRCDDGRCIASSWICDGDNDCGDMSDED 2924          

HSP 10 Score: 69.707 bits (169), Expect = 2.223e-11
Identity = 41/122 (33.61%), Postives = 55/122 (45.08%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            P    +C N  CI     CDG NDCGD SDE       C+ +   CD       N  CI   W CD  +DC +N DE +C ++    C   ++ C++   +   + CDG  DC    DE  C
Sbjct: 3708 PAGDFRCDNHQCIPLRWKCDGDNDCGDGSDERNCSPRACTESEYRCD-------NLHCIPDRWVCDHDNDCEDNSDERDCELRT---CHPGYFQCDSGHCVAERFKCDGNADCLDFTDEMSC 3819          

HSP 11 Score: 68.9366 bits (167), Expect = 3.748e-11
Identity = 45/128 (35.16%), Postives = 57/128 (44.53%), Query Frame = 1
Query: 2101 NQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
             Q +C    CI     CDG  DC D+SDE     + C      C  L D      CI + W CD  +DC +  DE  +CP +    C  + + C N   IP  Y CD  PDCS   DE +C  P+  E
Sbjct:   27 GQFRCGTGRCIPAGWHCDGTADCTDDSDESGCPQSTCEAGQFQC--LSDG----ECIPELWLCDDEEDCEDGSDERQHCPGRT---CSSSQFTCTNGACIPGEYRCDHLPDCSDGADERNCHYPECSE 145          

HSP 12 Score: 68.9366 bits (167), Expect = 3.942e-11
Identity = 55/180 (30.56%), Postives = 74/180 (41.11%), Query Frame = 1
Query: 2110 KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSV 2646
            +C N  C + ++ CD   +C D SDE    C + CS     C        N  C+ + + CD  DDCG+  DE NC       C GT++ C +   I + + CDGE DC    DE  C N Q            F        C  SG  +P         H P+  D N +T   NCS+
Sbjct:  147 RCANGACYNRSQHCDQVLNCRDGSDE--ANCTQRCSSGQFQCS-------NGECVPRGYVCDHDDDCGDRSDEQNCTYPT---CRGTYFTCPSGRCIHQVWLCDGEDDCGDNADERGCDNVQ---------RECFPGE---WPCPSSGVCIPMEHLCDGTPHCPDGEDENNSTAGRNCSI 302          

HSP 13 Score: 66.2402 bits (160), Expect = 2.234e-10
Identity = 48/142 (33.80%), Postives = 69/142 (48.59%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIF 2511
            C   Q +C +  CID    CDG  DC D +DE      +C  N    +F K AN   +CI   ++CDG+ DC +  DE+ CP +    C   + + C ++   IP ++ CDG PDC      ED S+     P +  P S+F
Sbjct: 1135 CHPGQFQCPDHRCIDPAYVCDGDRDCVDGADE-----QDCIYNCTGYEF-KCAN-GHQCINSFYRCDGVFDCNDRSDEIGCPTRPPGMCHHESEFQCQSDGSCIPAAWECDGHPDC------EDGSDEHHACPPRTCPTSLF 1263          

HSP 14 Score: 63.5438 bits (153), Expect = 1.589e-9
Identity = 45/127 (35.43%), Postives = 58/127 (45.67%), Query Frame = 1
Query: 2110 KCKN-ETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELN-CPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
            KC N   CI+    CDG  DC D SDE    C    P   H +       +  CI   W+CDG  DC +  DE + CP +    C  + + C+N   + RS+ CDG+ DC    DE DC  P    P
Sbjct: 1179 KCANGHQCINSFYRCDGVFDCNDRSDE--IGCPTRPPGMCHHESEFQCQSDGSCIPAAWECDGHPDCEDGSDEHHACPPRT---CPTSLFRCDNGNCVFRSWLCDGDNDCRDGSDERDCPTPPFRCP 1300          

HSP 15 Score: 62.003 bits (149), Expect = 4.709e-9
Identity = 33/99 (33.33%), Postives = 50/99 (50.51%), Query Frame = 1
Query: 2206 ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC--SNPQIIEPVKFT 2496
            +C  NS  C        N +C+ + ++CDG+DDC +N DE +C   N   C  T + C N   +PR++ CDG  DC    DE +C    P   +  +F+
Sbjct: 1011 QCGSNSFSCS-------NGKCVPQSYRCDGVDDCHDNSDEASCGANNS-TCSSTAFTCANQRCVPRNWRCDGHNDCFDGSDERECPTQTPGTCQADQFS 1101          

HSP 16 Score: 60.8474 bits (146), Expect = 1.102e-8
Identity = 40/126 (31.75%), Postives = 55/126 (43.65%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            C  +Q  C N  CI     CD   DC D +DE      ECS   + C        N  C  +   CD + +C +  DE NC      +C    + C+N   +PR Y CD + DC    DE++C+ P
Sbjct:  104 CSSSQFTCTNGACIPGEYRCDHLPDCSDGADERNCHYPECS--ELRC-------ANGACYNRSQHCDQVLNCRDGSDEANC----TQRCSSGQFQCSNGECVPRGYVCDHDDDCGDRSDEQNCTYP 216          

HSP 17 Score: 56.9954 bits (136), Expect = 1.437e-7
Identity = 46/158 (29.11%), Postives = 62/158 (39.24%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN----ECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMS 2547
            + C  +Q  C+N  CI  +  CDG NDCGD SDE    C      C P +  C+       N  C+     CD  DDC +N DE  C + N+      H+  +     P S+ C   P    M D   C +             I  N+  +  CK S
Sbjct: 3018 QSCQQHQFTCQNGRCISSDFVCDGDNDCGDESDELDHLCRTPAPTCPPGNYRCE-------NGNCVPASQVCDHSDDCNDNSDEKGCGI-NECTDPSMHHCDHECTDTPTSFICTCRPGYRLMSDNRTCDDVNECRDTPSVCSQICENTAGSYVCKCS 3167          

HSP 18 Score: 56.225 bits (134), Expect = 2.889e-7
Identity = 33/108 (30.56%), Postives = 53/108 (49.07%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK--NKDKCIGTHYLCNNNLLIPRSY 2409
            C  ++ +C N  CI +   CD  NDC DNSDE   +   C P    CD       +  C+ + ++CDG  DC +  DE++CP +  N   C    + C N++ + + +
Sbjct: 3746 CTESEYRCDNLHCIPDRWVCDHDNDCEDNSDERDCELRTCHPGYFQCD-------SGHCVAERFKCDGNADCLDFTDEMSCPTRYPNGTYCPPFLFECKNHVCVQQHW 3846          

HSP 19 Score: 53.1434 bits (126), Expect = 2.599e-6
Identity = 37/116 (31.90%), Postives = 57/116 (49.14%), Query Frame = 1
Query: 2110 KCKNE-TCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            +C+++ +CI     CDG  DC D SDE     + C P +      +  N N  C+ + W CDG +DC +  DE +CP     +C    + C  +++ +  S  CD  PDC +  DE
Sbjct: 1223 QCQSDGSCIPAAWECDGHPDCEDGSDEH----HACPPRTCPTSLFRCDNGN--CVFRSWLCDGDNDCRDGSDERDCPTP-PFRCPSWQWQCPGHSVCVNLSRVCDNTPDCPNGADE 1331          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 82.0333 bits (201), Expect = 9.253e-16
Identity = 51/131 (38.93%), Postives = 64/131 (48.85%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDED-RKKCNE--CSPNSIHCDFLKDAN-PNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            CP  Q  C +  CI  +  CDG NDCGD SDED R  C    C P+   C    DA+ P +RCI + + CDG  DC +  DE  NC    +  C    + C+N L +   Y CD   DC    DE  C+ P
Sbjct: 2868 CPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTC---ADASPPRRRCIQRRFVCDGDADCSDALDEHQNC---TRRSCTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYP 2992          

HSP 2 Score: 75.0998 bits (183), Expect = 1.176e-13
Identity = 43/122 (35.25%), Postives = 57/122 (46.72%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            PL   +C N  CI     CD  +DCGD SDE       CS +   C        N+RCI   W C+  +DCG+N DE +C ++    C+  ++ C +   IP    CDG  DC    DE  C
Sbjct: 3686 PLGDYRCDNHRCIPLRWRCDRYDDCGDGSDERNCAPRPCSESEFRC-------TNQRCIPGRWVCNHENDCGDNSDERDCELQT---CLPGYFQCGSGHCIPERLKCDGSADCQDFSDESLC 3797          

HSP 3 Score: 74.7146 bits (182), Expect = 1.290e-13
Identity = 44/123 (35.77%), Postives = 63/123 (51.22%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK--NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C  ++ +C N+ CI     C+ +NDCGDNSDE   +   C P    C        +  CI +  +CDG  DC +  DE  CP +  N   C  + + C+N++ IP S+ CDG+ DC    DEE
Sbjct: 3724 CSESEFRCTNQRCIPGRWVCNHENDCGDNSDERDCELQTCLPGYFQCG-------SGHCIPERLKCDGSADCQDFSDESLCPTRYPNGTWCPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEE 3839          

HSP 4 Score: 70.0922 bits (170), Expect = 3.533e-12
Identity = 41/122 (33.61%), Postives = 58/122 (47.54%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C   Q +C +  CID    CDG +DC D +DE R     C+     C      +   +CI  +++CDG  DC +  DE+ CP +    C    + C ++ L IP  + CDG PDC    DE 
Sbjct: 1111 CHPMQFQCPDHRCIDNAYVCDGDSDCVDGADE-RGCVFNCTSYQFSC------SSGDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQSDGLCIPAGWECDGHPDCDDGSDEH 1225          

HSP 5 Score: 68.1662 bits (165), Expect = 1.250e-11
Identity = 45/132 (34.09%), Postives = 59/132 (44.70%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECS-PNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL--NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQ 2472
            CP +  +C N  CI  +  CDG NDCGD SDE+   C    C+ P    CD       N RCI  H  C+ +DDCG+  DE    C       C    + C +   IP +  C+   +C    DE  C+  Q
Sbjct: 3807 CPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCD-------NNRCIYSHEICNAVDDCGDGSDETPDKCKEPTFAPCTEEEFKCASGRCIPMAAVCNNYNECRDNTDETGCNQGQ 3931          

HSP 6 Score: 65.0846 bits (157), Expect = 1.224e-10
Identity = 44/132 (33.33%), Postives = 61/132 (46.21%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLK-DANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            C   Q +C +  CI  +  CD  NDC D+SDE       CSP +  C  L+     + RCI + + CDG  DC +  DE  NCP      C  +H+ C +   +  ++ CD   DC    DE+ C  P   E
Sbjct:    1 CDSGQFRCGSGACIPRSWVCDSINDCSDDSDE-----RGCSPAT--CTTLQFRCRSDNRCIARAFVCDGEADCADRSDEHQNCP---GSTCSSSHFTCASGHCVQSAFRCDHFQDCDDRSDEQSCQYPTCAE 122          

HSP 7 Score: 64.3142 bits (155), Expect = 2.046e-10
Identity = 42/118 (35.59%), Postives = 54/118 (45.76%), Query Frame = 1
Query: 2119 NETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL-NCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
             + CI     CDG  DC D SDE    C   +P   H D  +    +  CI   W+CDG  DC +  DE   CP +    C   +  C+N   +P S+ CDG+ DC    DE DC  P
Sbjct: 1159 GDQCIATYYRCDGAFDCRDRSDE--VGCPTRAPGLCHNDEFQ-CQSDGLCIPAGWECDGHPDCDDGSDEHPGCPPRT---CAAGYLRCDNGNCVPESWRCDGDNDCRDGTDERDCPTP 1270          

HSP 8 Score: 63.5438 bits (153), Expect = 3.689e-10
Identity = 51/178 (28.65%), Postives = 65/178 (36.52%), Query Frame = 1
Query: 2071 TLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQ---------------------------------------------CDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            TL     C  NQ +C N+ CI     CDG  DC D SDED   C    C+P    C+       N RCI + W                                              C+G+DDC +N DE  C     D  +G  Y C+N+  IP  + CD   DC    DE +C+
Sbjct: 3552 TLCFNHRCNSNQWQCMNKRCIPAAWLCDGGPDCQDGSDEDSATCAARTCAPGQFRCN-------NGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDSHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCAEITCDP-LG-DYRCDNHRCIPLRWRCDRYDDCGDGSDERNCA 3720          

HSP 9 Score: 61.2326 bits (147), Expect = 1.922e-9
Identity = 40/129 (31.01%), Postives = 61/129 (47.29%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDC--SSMEDEEDC 2460
            ++C  +Q  C N  CI     CD +++C D SDE  + C  + C P    C        N RC+   ++CD  +DCG++ DE  C  +  D      + C N   I RS  C+G  +C  ++  DE+ C
Sbjct: 2659 QQCGTSQFTCLNGRCIPFRNKCDNRDNCRDGSDELERVCAFHTCEPTDFTCR-------NGRCVRYGYRCDHTNDCGDSSDEEGCAFRTCDP--AAEFACTNGRCIARSQVCNGVNNCRDNATSDEQRC 2778          

HSP 10 Score: 60.4622 bits (145), Expect = 2.903e-9
Identity = 43/140 (30.71%), Postives = 59/140 (42.14%), Query Frame = 1
Query: 2113 CKNETCIDENKFCDGKNDCGDNSDEDRKKCNE----CSPNSIHCDFLK----DANPNK----------------RCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C N  C+     CDG +DC D SDE  + C      CSP +  C   +    D  P +                RCI ++W CD  +DCG+  DE  C +     C    + C ++  I  +Y CDG+ DC    DE  C
Sbjct: 1010 CANGRCVPRLFLCDGYDDCHDGSDE--RGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIPRYWICDTDNDCGDGSDERGCDMSG--TCHPMQFQCPDHRCIDNAYVCDGDSDCVDGADERGC 1145          

HSP 11 Score: 58.9214 bits (141), Expect = 9.276e-9
Identity = 40/123 (32.52%), Postives = 54/123 (43.90%), Query Frame = 1
Query: 2101 NQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNN-----NLLIPRSYWCDGEPDCSSMEDEE 2454
            N+ +C N  CI  +  CD + DC DN+DE     + CS     C   +    + RCI   W CDG +DCG+  DE          C    + C +        I R + CDG+ DCS   DE 
Sbjct: 2829 NEFRCGNGQCIPLSWVCDSEQDCTDNADEP----SSCSDPGRTCPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCADASPPRRRCIQRRFVCDGDADCSDALDEH 2947          

HSP 12 Score: 56.6102 bits (135), Expect = 3.913e-8
Identity = 50/172 (29.07%), Postives = 69/172 (40.12%), Query Frame = 1
Query: 2113 CKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNF--DELNCPVKN----------KDKCIGTHYL------------------------------CNNNLLIPRSYWCDGEPDCSSMEDE-EDCSNPQIIEP-VKFT 2496
            C+N  C+     CD  NDCGD+SDE+      C P +      + A  N RCI +   C+G+++C +N   DE  CP +            + C+  HYL                              C N   IP S+ CD E DC+   DE   CS+P    P  +FT
Sbjct: 2709 CRNGRCVRYGYRCDHTNDCGDSSDEEGCAFRTCDPAA------EFACTNGRCIARSQVCNGVNNCRDNATSDEQRCPERTCQPGLLKCLTTNICVLRHYLSGGAAEWRRNDLRRPPPLPLHTCFIANEFRCGNGQCIPLSWVCDSEQDCTDNADEPSSCSDPGRTCPGTQFT 2874          

HSP 13 Score: 56.6102 bits (135), Expect = 4.830e-8
Identity = 37/129 (28.68%), Postives = 53/129 (41.09%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
             +  C   +  C N  C+     CD +NDCGD SDE       C  N   C+       N RCI + + CDG +DCG+  DE  +   +    C    + C     +     C+   DC+   DE+ C 
Sbjct: 2951 TRRSCTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFTCE-------NGRCIPRIFACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAGECVAIHLVCNQANDCADGSDEKGCG 3072          

HSP 14 Score: 54.6842 bits (130), Expect = 1.873e-7
Identity = 32/83 (38.55%), Postives = 40/83 (48.19%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPV 2340
            C  NQ  C+N  CI     CDG NDCGD SDED   C++ SP      F   A     C+  H  C+  +DC +  DE  C +
Sbjct: 2994 CRQNQFTCENGRCIPRIFACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAG---ECVAIHLVCNQANDCADGSDEKGCGI 3073          

HSP 15 Score: 49.6766 bits (117), Expect = 5.953e-6
Identity = 39/110 (35.45%), Postives = 54/110 (49.09%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDC--GNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSY 2409
            CP+ + +C++  C   N  C+G N+C D SDE+   C  + C+ N   C        NKRCI   W CDG  DC  G++ D   C  +    C    + CNN   IPRS+
Sbjct: 3518 CPIGRFQCRDGNCTSSNLLCNGNNNCPDGSDEEDTLCFNHRCNSNQWQC-------MNKRCIPAAWLCDGGPDCQDGSDEDSATCAART---CAPGQFRCNNGRCIPRSW 3617          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001137.1 (pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008.1 transcript:ENSPMAT00000001137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.133e-15
Identity = 54/146 (36.99%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFT-NSTL 2526
            C   Q +CKN  CI     CD  NDCGDNSDE+      CS +   C        N RCI   W+CDG  DC +  DE +C +    +C    + C N   IP+ + CD + DC    DEE+C +      V+  P   F  NSTL
Sbjct:  876 CEPYQFRCKNNRCIPGRWHCDYDNDCGDNSDEEGCTPRPCSESEFSC-------ANGRCIAGRWRCDGDHDCMDGSDEKDCSL----RCEQDQFQCQNGHCIPQRWRCDNDADCLDGSDEENCGS-----AVRLCPKDEFQCNSTL 1005          

HSP 2 Score: 70.8626 bits (172), Expect = 1.887e-12
Identity = 47/130 (36.15%), Postives = 59/130 (45.38%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR------KKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYW-CDGEPDCSSMEDEEDC 2460
            C  +Q  CKN  CI     CDG NDCGD SDE        +   +C  +   C        N  CI   W+CDG  DC +  DE  C  + +    GTH+ C +N +  R  W CDG+ DC    DE  C
Sbjct:  150 CADSQFSCKNGHCIPSQWVCDGDNDCGDVSDETHTCEFPARPLRQCREDEFRCAI------NGNCIPLRWRCDGDADCMDISDEKECDGQRRTCNPGTHFTCVSNGICIRKAWVCDGDNDCEDNSDEAGC 273          

HSP 3 Score: 70.4774 bits (171), Expect = 2.216e-12
Identity = 54/205 (26.34%), Postives = 78/205 (38.05%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--------------NECSPNSIHCDFLKDANPNK----------------------RCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWD 2589
            +  C  ++ KCKN  CI     CDG NDCG+N DE    C               +C P +  CD   D + N                       RCI   W+CD  +DC ++ DE  C     + C  + + C N   IP  + CDG+ DC  + DE            +F    +         C ++G  +P + WR + D
Sbjct:   27 QHTCISDRFKCKNNRCIPMRWLCDGDNDCGENEDESNTTCTVRTCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFSCNNGRCINIRWRCDSDNDCADSSDEAGC----NNTCADSQFSCKNGHCIPSQWVCDGDNDCGDVSDE--------THTCEFPARPLRQCREDEFRCAINGNCIP-LRWRCDGD 218          

HSP 4 Score: 66.6254 bits (161), Expect = 3.168e-11
Identity = 47/128 (36.72%), Postives = 61/128 (47.66%), Query Frame = 1
Query: 2128 CIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELN--CPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE-EDCSNPQIIEPVKFT 2496
            CI +   CDG NDC D SDE  + C +  C  +   C        N RCI   W CDG +DCG N DE N  C V+    C    + C N   IP ++ CD + DCS   DE   C+ P  +   +F+
Sbjct:    1 CIQDQWRCDGDNDCQDGSDELPEICQQHTCISDRFKC-------KNNRCIPMRWLCDGDNDCGENEDESNTTCTVRT---CPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFS 118          

HSP 5 Score: 52.373 bits (124), Expect = 7.359e-7
Identity = 42/139 (30.22%), Postives = 66/139 (47.48%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCN--ECSP-NSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC--PVKNKDKCIGTHYLCNN--NLLIPRSYWCDGEPDCS-SMEDEEDC-SNPQIIE 2481
            CP ++ +C +  C   +  CDG++DCGDNSDED   C   +C P     C        ++ C+     CDGI++CG++ DE +C  P +    C    + C++     I     C+   DC     DE  C  +P++ E
Sbjct:  994 CPKDEFQCNSTLCKPFSWRCDGEDDCGDNSDEDADHCRAFQCPPRRQFRC------RNDRVCVSLDRVCDGINNCGDHSDEEHCGEPARGARACTAEEFKCDSLERKCIDVRLLCNHHDDCGDGGSDEMACGGDPRVNE 1126          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 78.5666 bits (192), Expect = 1.003e-14
Identity = 58/205 (28.29%), Postives = 81/205 (39.51%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--------------NECSPNSIHCDFLKD----------------------ANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWD 2589
            +  CP ++ KC+N  CI     CDG NDCG++ DE    C                C P S  CD   D                      A  N RCI  +W+CD  +DC +  DE+ C       C  + + CN+   IP  + CDG+ DC    DE   +NP   +     P     +      CK  G+ +P + WR + D
Sbjct:  865 QHTCPSDRFKCQNNRCIPLRWLCDGDNDCGNSEDESNTTCAARTCPPNQFSCASGHCIPMSWKCDLDDDCGDRSDEPPSCAYPTCFPLTQFACNNGRCINMNWRCDADNDCADASDEIGC----NHSCSISQFKCNSGRCIPSHWTCDGDNDCGDFSDE---TNPNCTKLATRPPGGCHGDE---FQCKADGQCIP-LRWRCDGD 1058          

HSP 2 Score: 77.411 bits (189), Expect = 2.019e-14
Identity = 45/124 (36.29%), Postives = 60/124 (48.39%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            C   Q +CKN  C+     CD  NDCGDNSDE+      CS +   C        N RCI   W+CDG  DC +  DE +C      +C    + C N   IP+ + CD + DC    DE++C+
Sbjct: 3505 CEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEEGCTPRPCSESEFSC-------ANGRCIAGRWRCDGDHDCSDGSDEKDC----SPRCDHDQFQCRNGHCIPQRWRCDADIDCIDGSDEDNCA 3617          

HSP 3 Score: 76.6406 bits (187), Expect = 4.029e-14
Identity = 56/169 (33.14%), Postives = 75/169 (44.38%), Query Frame = 1
Query: 2023 DGTVYECAFNKLTDYVTLYVKE--------ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE-EDCSNPQIIEPVKFT 2496
            +G    CA ++L D   +  K         +C   +  CKN  CI E   CDG NDC DNSDE  + C++  C  +   C        N RCI   W CDG +DCGN+ DE N     +  C    + C +   IP S+ CD + DC    DE   C+ P      +F 
Sbjct:  796 EGRACACADDQLLDADNITCKPNPDYTPPPQCHPGEFACKNGRCIQERWRCDGDNDCLDNSDEAPEICHQHTCPSDRFKCQ-------NNRCIPLRWLCDGDNDCGNSEDESNTTCAAR-TCPPNQFSCASGHCIPMSWKCDLDDDCGDRSDEPPSCAYPTCFPLTQFA 956          

HSP 4 Score: 70.0922 bits (170), Expect = 3.164e-12
Identity = 51/160 (31.87%), Postives = 72/160 (45.00%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNN-LLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPT 2565
            +C   Q +CKN  C +    CDG NDCGD SDE     + C P+   C          RCI   ++C+G D+CG+  DE +CP   +  C    + C++    IPR + CD + DC    D          EP   T +   T       CK +GR +P+
Sbjct: 3342 KCRPGQFQCKNGICTNPAFICDGDNDCGDGSDEANCDVHVCLPSQFKC------RTTHRCIPGIFRCNGQDNCGDGEDEKDCP---EVTCAPNQFQCSSTKRCIPRVWVCDRDNDCGDGSD----------EPANCTQM---TCGQEEFRCKGTGRCIPS 3479          

HSP 5 Score: 70.0922 bits (170), Expect = 3.500e-12
Identity = 44/116 (37.93%), Postives = 58/116 (50.00%), Query Frame = 1
Query: 2128 CIDENKFCDGKNDCGDNSDEDRKKCNE------CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEED 2457
            C+     CDG NDCGD +DE  K C +      CSP+  +C       P+  CI   W+CD   DC +  DELNC +     C   H+ C+N   I + + CDGE DC    DE+D
Sbjct: 2643 CVLPAWICDGANDCGDYADE--KNCKKKSGSPGCSPDYFNC-------PSGPCIPTAWKCDREPDCDDGADELNCDML----CAVDHFECDNGKCITKRWMCDGEDDCGDRSDEKD 2745          

HSP 6 Score: 67.781 bits (164), Expect = 1.594e-11
Identity = 45/131 (34.35%), Postives = 65/131 (49.62%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECS---PNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCP--VKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
              C ++Q KC +  CI  +  CDG NDCGD SDE    C + +   P   H D  +    + +CI   W+CDG  DC +  DE  C   V+  D  +   + C +    I ++++CDG+ DC    DEE C
Sbjct:  986 HSCSISQFKCNSGRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQ-CKADGQCIPLRWRCDGDTDCIDTSDEKECDGVVRTCDPTL--QFSCRDTGRCISKTWFCDGDNDCEDNSDEEGC 1113          

HSP 7 Score: 64.6994 bits (156), Expect = 1.460e-10
Identity = 49/170 (28.82%), Postives = 68/170 (40.00%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDE----------DRKKCNE--CSPNSIHCDFLKDA------------------------------NPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKD-KCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
               +C      C N  C++  K C+G NDCGDNSDE          D  +C +  C  N   C+ + D                               N    C++  W CDG +DCG+  DE NC  K+    C   ++ C +   IP ++ CD EPDC    DE +C
Sbjct: 2539 TSRQCKNGYVNCLNGRCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGCGPMNCTHYHRLGVQASGYVSCNSTSLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSGPCIPTAWKCDREPDCDDGADELNC 2708          

HSP 8 Score: 62.003 bits (149), Expect = 1.021e-9
Identity = 51/152 (33.55%), Postives = 71/152 (46.71%), Query Frame = 1
Query: 2026 GTVYECA----FNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            G  Y+CA    F   +D  T      C  ++  CKN+ CI     CD ++DCGD SDE    C +  C P    C        N  C    + CDG +DCG+  DE NC V     C+ + + C   +  IP  + C+G+ +C   EDE+DC
Sbjct: 3279 GGQYKCACPTNFYLASDGRTCL--SNCTASRFVCKNDKCIPFWWKCDTEDDCGDRSDEP-ADCPDFKCRPGQFQC-------KNGICTNPAFICDGDNDCGDGSDEANCDVH---VCLPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDC 3417          

HSP 9 Score: 58.151 bits (139), Expect = 1.400e-8
Identity = 39/101 (38.61%), Postives = 52/101 (51.49%), Query Frame = 1
Query: 2167 CGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            CGD SDE +++C +  C P    C        N RC+   WQCD  +DCG+N DE  C  +    C  + + C N   I   + CDG+ DCS   DE+DCS
Sbjct: 3489 CGDTSDEPKEECEDRTCEPYQFRC-------KNNRCVPGRWQCDYDNDCGDNSDEEGCTPR---PCSESEFSCANGRCIAGRWRCDGDHDCSDGSDEKDCS 3579          

HSP 10 Score: 56.6102 bits (135), Expect = 3.813e-8
Identity = 46/142 (32.39%), Postives = 64/142 (45.07%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPN-SIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPV---------KNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCS-SMEDEEDCSNPQII 2478
            CP ++ +C N  C   +  CDG++DCGDNSDE  + C   +C P     C        N+ C     QCDG+D+CG+  DE NC            ++ KC GT   C +  L+     C+   DC     DE  C   Q +
Sbjct: 3623 CPHHEFQCNNTLCKPLSWKCDGEDDCGDNSDETPEMCLKFQCPPGRQFRC------RNNRVCFWAGRQCDGVDNCGDGSDEENCEKPSPKPRICNSSEFKCGGTERKCISTQLV-----CNRFDDCGDGGSDEVACGGDQFV 3753          

HSP 11 Score: 53.5286 bits (127), Expect = 3.892e-7
Identity = 41/130 (31.54%), Postives = 57/130 (43.85%), Query Frame = 1
Query: 2083 KEECPLN-QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            K  C L  + +C N  CI  +  CDG  DC D SDE    C   +C    ++C        N RC+     C+G++DCG+N DE+ C   N   C    + C +   I     C+   DC  + DE  C 
Sbjct: 2498 KNSCDLQTEFECNNGDCIRYHLTCDGVADCKDKSDEKPFYCTSRQCKNGYVNC-------LNGRCMETLKLCNGVNDCGDNSDEIAC---NNSTCGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGCG 2617          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: corin (corin, serine peptidase [Source:ZFIN;Acc:ZDB-GENE-060224-3])

HSP 1 Score: 74.3294 bits (181), Expect = 1.227e-13
Identity = 53/156 (33.97%), Postives = 69/156 (44.23%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCD-FLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS----NPQIIEPVKFTPISIFTNSTLTITCKM 2544
            C   + +C    C+  ++ CDG NDCGD SDE           + HCD  +     +  C+ + W CDG  DC +  DELNC  K+          C+  L IP SY CDGE DC    DEE C     +    EP  F   S+ +N    I   M
Sbjct:   97 CGAGEFRCGTGRCVALSQRCDGFNDCGDLSDE----------AACHCDNAVWFRCGDGVCVSRAWVCDGDADCSDRSDELNCTCKSHGM-----QECDGGLCIPPSYLCDGERDCEDGRDEEGCGPANESDSDSEPRCFPDPSLTSNGGGEICSAM 237          

HSP 2 Score: 60.077 bits (144), Expect = 2.720e-9
Identity = 38/122 (31.15%), Postives = 55/122 (45.08%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            PL   +C +  C+   + CD ++DC D SDE   +C +          + +   +K CI     CDG  DC +  DE  C      +C      C N+  +P+  WCDGE  C+   DE DC
Sbjct:  374 PLLHFRCASGRCVSAARRCDSRSDCDDASDEQDCECAQ--------RGMWECLSDKSCINLDMHCDGFPDCRDEEDEKFC-----SQCEVEEMACLNHQCVPQRAWCDGERHCADGSDEWDC 482          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Match: sorl1 (sortilin-related receptor, L(DLR class) A repeats containing [Source:ZFIN;Acc:ZDB-GENE-050208-22])

HSP 1 Score: 73.1738 bits (178), Expect = 3.358e-13
Identity = 48/158 (30.38%), Postives = 68/158 (43.04%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDED--RKKCNEC-------SPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQII-----EPVKFTPISIFTNST 2523
            C  ++ +C++  CI  +  CDG +DCGD SDE   R  C  C       +P  +     +    N RC+   W+CD  +DCG+  DE  CP K    C    + C +   I   + CDG PDC+   DE  C     +      P  FT      + T
Sbjct:  794 CTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCRASCIICWSSGPTVAPRCL--PLFQFQCRNHRCVPVWWKCDNDNDCGDWSDEDTCPSKLPSGCPAHQFRCGDGTCIFDHFVCDGSPDCADGSDEYGCPTQHAVITGRPSPCSFTQFQCLKDKT 949          

HSP 2 Score: 72.0182 bits (175), Expect = 7.592e-13
Identity = 44/124 (35.48%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 2092 CPLNQRKCKNET-CIDENKFCDGKNDCGDNSDEDRK-KCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKD-KCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C  NQ +C+N   CI  +  CD ++DCGDNSDE       +C      C        N RC+   W+CDG +DC +  DE+NC     +  C    + C +   IPR + CDG+ DC    DE+
Sbjct:  660 CGTNQFRCQNSGRCIPMSYKCDQEDDCGDNSDEPADCPHQKCQATEFSCS-------NGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGNISCSADGFQCPSGPCIPRRWLCDGDKDCLDGADEQ 776          

HSP 3 Score: 65.4698 bits (158), Expect = 6.073e-11
Identity = 44/129 (34.11%), Postives = 57/129 (44.19%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDED---RKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNK------DKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            PL Q +C+N  C+     CD  NDCGD SDED    K  + C  +   C        +  CI  H+ CDG  DC +  DE  CP ++         C  T + C  +   +P S  CDG  DC    DE
Sbjct:  848 PLFQFQCRNHRCVPVWWKCDNDNDCGDWSDEDTCPSKLPSGCPAHQFRCG-------DGTCIFDHFVCDGSPDCADGSDEYGCPTQHAVITGRPSPCSFTQFQCLKDKTCVPASARCDGRKDCVDGSDE 969          

HSP 4 Score: 62.003 bits (149), Expect = 7.684e-10
Identity = 43/143 (30.07%), Postives = 59/143 (41.26%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE----CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNC-------PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQII 2478
            ++C   +  C N  C+     CDG NDC D SDE     ++    CS +   C       P+  CI + W CDG  DC +  DE   C       P      C  + + C + + I   + CDG  DC    DE +C    II
Sbjct:  699 QKCQATEFSCSNGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGNISCSADGFQC-------PSGPCIPRRWLCDGDKDCLDGADEQQQCGGLVPPQPTPGHLNCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCRASCII 834          

HSP 5 Score: 54.299 bits (129), Expect = 1.907e-7
Identity = 29/71 (40.85%), Postives = 42/71 (59.15%), Query Frame = 1
Query: 2263 RCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQ 2472
            RCI   ++CD  DDCG+N DE  +CP +   KC  T + C+N   +  ++ CDG+ DC    DE +CS+ Q
Sbjct:  672 RCIPMSYKCDQEDDCGDNSDEPADCPHQ---KCQATEFSCSNGRCVRSAWRCDGDNDCHDWSDEVNCSSSQ 739          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 92.0485 bits (227), Expect = 4.839e-19
Identity = 52/154 (33.77%), Postives = 75/154 (48.70%), Query Frame = 1
Query: 2035 YECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFT 2496
            Y+C    L+D     V   C  +  +C N  C   +  CDG +DCGD SDE     + C+P    C       P+ RCI   W+CDG  DC +  DE  CP KN   C  + + C+N   I  ++ CDG+ DC+   DE +C+  +  +P +F 
Sbjct:   67 YDCLAPDLSDEANCSVATNCSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCANHSCTPAQFSC-------PSGRCIPLRWRCDGDGDCSDGADERGCPPKN---CTDSQFSCSNGQCISLAWRCDGDHDCADKSDERNCTG-KTCKPFEFA 209          

HSP 2 Score: 71.2478 bits (173), Expect = 1.516e-12
Identity = 51/140 (36.43%), Postives = 66/140 (47.14%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDR-KKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDC--GNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFT 2496
            C   +  CKN  CI     CDG+NDC DNSDED    C E  C  +   C        +++CI   W+CDG  DC   +  DE NC V     C  + + C N    PR + CDG  DC    DE+ C+N     P +F+
Sbjct:    1 CSAGKFTCKNGHCISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASEFRC------QASRKCIPLSWRCDGDYDCLAPDLSDEANCSVAT--NCSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGCANHSCT-PAQFS 131          

HSP 3 Score: 64.6994 bits (156), Expect = 1.539e-10
Identity = 44/121 (36.36%), Postives = 59/121 (48.76%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNN-NLLIPRSYWCDGEPDCSSMEDE 2451
            C  +Q  C N  CI     CDG +DC D SDE       C P    C     AN  + CI + W CDG +DCG+  DE++C +++   C    + C+N +  I +S  CDG  DC    DE
Sbjct:  164 CTDSQFSCSNGQCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFAC-----AN-GRHCIQRKWICDGENDCGDRSDEVDCGLES---CGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDE 275          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO45218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTH9])

HSP 1 Score: 89.3521 bits (220), Expect = 8.082e-18
Identity = 49/124 (39.52%), Postives = 62/124 (50.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            C   Q KC N  CI  +  CD  NDCGDNSDE+    + C+P+   CD       N RCI   W+CD  +DCG+  DE NC       C   ++ C N   IP  + CD + DC    DE DC+
Sbjct: 1027 CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCD-------NGRCISSKWRCDHDNDCGDMSDERNCTFST---CASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDCT 1140          

HSP 2 Score: 87.4261 bits (215), Expect = 2.641e-17
Identity = 49/123 (39.84%), Postives = 61/123 (49.59%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C   Q KC N  CI  +  CD  NDCGDNSDE+    + C+P+   CD       N RCI   W+CD  +DCG+  DE NC       C    + C N   IP S+ CD + DC    DE +C
Sbjct:  950 CAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCD-------NGRCISSKWRCDHDNDCGDMSDERNC----TGTCAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNC 1061          

HSP 3 Score: 79.337 bits (194), Expect = 9.485e-15
Identity = 53/156 (33.97%), Postives = 72/156 (46.15%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPV 2559
            C  N  +C N+ CI     CD  NDC DNSDE      +C+P    C        N+RCI   W CD  +DC +N DE +C    +  C    + C+N   I RS+ CD + DC    DE +CS P            IF+  +   +C ++GR V
Sbjct: 1105 CASNYFRCANQRCIPMRWVCDFDNDCRDNSDE-----RDCTPTFSTCASNYFRCANQRCIPMRWVCDFDNDCRDNSDERDCTPTGR-SCNSGQFSCSNGRCISRSWVCDRDNDCGDGSDERNCSYPTTGPWTTRPWTPIFSCRSWEFSC-LNGRCV 1253          

HSP 4 Score: 73.559 bits (179), Expect = 4.867e-13
Identity = 49/157 (31.21%), Postives = 64/157 (40.76%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNS-------IHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNK----DKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNST 2523
              C   Q  C N  CI  +  CD  NDCGD SDE         P +         C   + +  N RC+     CDG+DDCG++ DE++C           C    + C N   +  S  CDG+ DC    DE  CS P I        +  F NS+
Sbjct: 1185 RSCNSGQFSCSNGRCISRSWVCDRDNDCGDGSDERNCSYPTTGPWTTRPWTPIFSCRSWEFSCLNGRCVFYRLVCDGVDDCGDSSDEMSCNATATPFVPRSCHYWEFQCANRRCVYNSQRCDGQNDCGDWSDETGCSTPPIPTTCPADWVRCFYNSS 1341          

HSP 5 Score: 70.4774 bits (171), Expect = 3.989e-12
Identity = 45/134 (33.58%), Postives = 57/134 (42.54%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNC-----------PVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C  N  +C N+ CI     CD  NDC DNSDE      +C+P    C+  + +  N RCI + W CD  +DCG+  DE NC           P      C    + C N   +     CDG  DC    DE  C
Sbjct: 1146 CASNYFRCANQRCIPMRWVCDFDNDCRDNSDE-----RDCTPTGRSCNSGQFSCSNGRCISRSWVCDRDNDCGDGSDERNCSYPTTGPWTTRPWTPIFSCRSWEFSCLNGRCVFYRLVCDGVDDCGDSSDEMSC 1274          

HSP 6 Score: 69.707 bits (169), Expect = 7.452e-12
Identity = 46/141 (32.62%), Postives = 64/141 (45.39%), Query Frame = 1
Query: 2068 VTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECS----PNSIHCDFLK-DANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDK----CIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
             T +V   C   + +C N  C+  ++ CDG+NDCGD SDE       CS    P +   D+++   N +  CI   W C+G  DC + +DE     +        C    Y C+N   IP  Y CDG   CS   DE  C+
Sbjct: 1278 ATPFVPRSCHYWEFQCANRRCVYNSQRCDGQNDCGDWSDE-----TGCSTPPIPTTCPADWVRCFYNSSGLCISTSWLCNGRVDCPDAWDEQPAQCRTSPAPTRTCSPQEYQCDNGACIPSRYECDGRIQCSDGSDETGCT 1413          

HSP 7 Score: 64.3142 bits (155), Expect = 2.912e-10
Identity = 45/146 (30.82%), Postives = 63/146 (43.15%), Query Frame = 1
Query: 2080 VKEECPLNQRKC---KNETCIDENKFCDGKNDCGDNSDEDRKKCNE-------CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK-NKDKCIGTHYLCNNNLL-IPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            +   CP +  +C    +  CI  +  C+G+ DC D  DE   +C         CSP    CD       N  CI   ++CDG   C +  DE  C    +   C G  +LC+ N L +P    CDG  DC    DE +CS P ++ 
Sbjct: 1325 IPTTCPADWVRCFYNSSGLCISTSWLCNGRVDCPDAWDEQPAQCRTSPAPTRTCSPQEYQCD-------NGACIPSRYECDGRIQCSDGSDETGCTATISPSSCPG--FLCDGNTLCLPFYKRCDGSYDCKDYTDEFNCSMPLMVS 1461          

HSP 8 Score: 61.2326 bits (147), Expect = 2.970e-9
Identity = 31/94 (32.98%), Postives = 45/94 (47.87%), Query Frame = 1
Query: 2185 EDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN 2466
            +D +    C+P    C        N +CI   W+CD  +DCG+N DE NCP      C  + + C+N   I   + CD + DC  M DE +C+ 
Sbjct:  942 QDAQTAGTCAPGQFKCG-------NGKCIPSSWKCDHDNDCGDNSDENNCPYST---CNPSQFKCDNGRCISSKWRCDHDNDCGDMSDERNCTG 1025          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO48069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ9])

HSP 1 Score: 87.8113 bits (216), Expect = 1.162e-17
Identity = 49/123 (39.84%), Postives = 66/123 (53.66%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C  ++  C N  CI +   CD  NDCGD SDE+    + C PN   C        +KRCI+  W+CDG  DC +N DE+NCP  +   C  + Y C+    I +S+ CDGE DC +  DE +C
Sbjct:   42 CAPHEFSCGNGRCISQQWVCDQDNDCGDFSDENHCPPHTCRPNEFTC-------ADKRCILSRWRCDGDRDCADNSDEINCP-NSSQYCKSSEYQCSTGECIHKSWVCDGEFDCLNKSDENNC 156          

HSP 2 Score: 62.3882 bits (150), Expect = 7.882e-10
Identity = 45/123 (36.59%), Postives = 55/123 (44.72%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C  N+  C ++ CI     CDG  DC DNSDE       C  +S +C   +       CI K W CDG  DC N  DE NC   +   C  + + C N   IP    C+G  DC    DE DC
Sbjct:   81 CRPNEFTCADKRCILSRWRCDGDRDCADNSDE-----INCPNSSQYCKSSEYQCSTGECIHKSWVCDGEFDCLNKSDENNC---HSSACHISQFTCANKRCIPMRDRCNGNNDCLDNSDEADC 195          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO45747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS53])

HSP 1 Score: 77.411 bits (189), Expect = 6.739e-17
Identity = 50/123 (40.65%), Postives = 59/123 (47.97%), Query Frame = 1
Query: 2095 PLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            P    KC N  CI     CD +NDCGDNSDE       CSP+   C       PN  CI K W CDG  DC    DE +C      KC  + + C   + IPR   CDG PDC   +DE++C 
Sbjct:    1 PDTSFKCDNGRCISATWVCDTENDCGDNSDEMNCSQRSCSPDEYQC-------PNGECIRKRWVCDGEPDCEGGADEKDCA---NSKCKESQFRCMGGVCIPRDLVCDGFPDCKQKDDEDNCG 113          

HSP 2 Score: 62.3882 bits (150), Expect = 1.210e-11
Identity = 33/75 (44.00%), Postives = 43/75 (57.33%), Query Frame = 1
Query: 2257 NKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            N RCI   W CD  +DCG+N DE+NC  ++   C    Y C N   I + + CDGEPDC    DE+DC+N +  E
Sbjct:    9 NGRCISATWVCDTENDCGDNSDEMNCSQRS---CSPDEYQCPNGECIRKRWVCDGEPDCEGGADEKDCANSKCKE 80          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Match: EDO49499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB1])

HSP 1 Score: 82.0333 bits (201), Expect = 9.686e-16
Identity = 49/125 (39.20%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 2113 CKNET-CIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
            C N + CI     CDG  +C D SDE   +   C+P+   C        +  CI   W CDG +DCG+N DELNC    +  C  T +LC N + IP+S  CDGE DC  M DE    +  I +P
Sbjct:  129 CPNSSHCIPRRWLCDGLAECEDGSDEKNCQKFTCAPDKFAC-------ASGGCIASRWVCDGDNDCGDNSDELNC---TRLTCPPTKFLCANGMCIPKSAVCDGENDCGDMSDEPSNCSAHICDP 243          

HSP 2 Score: 68.5514 bits (166), Expect = 1.329e-11
Identity = 48/125 (38.40%), Postives = 60/125 (48.00%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRK-KCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK----NKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDE 2451
            CP  +  C N  CI ++  CDG+NDCGD SDE      + C P       L+    N RCI K W+CDG+ DC +  DE  C       ++  CIGT      +  IP S  CDG  DC    DE
Sbjct:  201 CPPTKFLCANGMCIPKSAVCDGENDCGDMSDEPSNCSAHICDPK------LEFQCANGRCINKKWRCDGMKDCADGSDESTCGEGTCRPDEWHCIGT------SRCIPLSRVCDGTNDCGDNYDE 313          

HSP 3 Score: 63.929 bits (154), Expect = 3.303e-10
Identity = 87/324 (26.85%), Postives = 114/324 (35.19%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDY 3051
            K  C  ++  C +  CI     CDG NDCGDNSDE       C P    C        N  CI K   CDG +DCG+  DE  NC     D      + C N   I + + CDG  DC+   DE  C       P ++  I       L+  C        T     N+D     LD +      NC    S   VQ         +    IS+  I   D +   + G+ C    YN    Y   C   Y       C     Y   P LI S+ K  D   V+    +Y    R +T A      +   + Y+  +  N  Y
Sbjct:  159 KFTCAPDKFACASGGCIASRWVCDGDNDCGDNSDELNCTRLTCPPTKFLC-------ANGMCIPKSAVCDGENDCGDMSDEPSNCSAHICDP--KLEFQCANGRCINKKWRCDGMKDCADGSDESTCGE-GTCRPDEWHCIGTSRCIPLSRVCD------GTNDCGDNYDEGSHCLDLDCKK--KNC----SQRCVQTPRGGECRCFPGYTISKDLITCKDINECSSIGR-CDHFCYNTPGSYKCACDEGYVLERPHTCKPVGPY--KPWLIFSNCK--DIRQVSLDGTQYDLLIRNLTRAISVDFDWLEKKVYWTDVRENAIY 455          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: hspg2 (heparan sulfate proteoglycan 2 [Source:NCBI gene;Acc:101159991])

HSP 1 Score: 193.356 bits (490), Expect = 3.919e-49
Identity = 139/486 (28.60%), Postives = 227/486 (46.71%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVS-NCSVITSSLTVQNINTDHSGIYSCEGISRRRII--APDFSVSVTKGQICQRPFYNN--DAWYP--QMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKL--ILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCE 3519
            C  +Q  C++  CI  +  CDG+ DC D SDE R   + C PN   C        N RC +K W+CDG +DC +N DE++C    +++C   H+ C ++   IP SY CD EPDC+   DE  C  P +  P + + I     ST+  TC+  G P P I+WR NW H+P      ++  VS N      +LT++++     G Y+CE I+ + ++   PD  +++    I   P   N  D  +     C+ C+C+ ++  C SA  Y  + + +  + +      V++ ++    P        K  M+ F      ++ + N D ++       G+ +  YG  L +K+   L+   S+ +  P V++ G    +    V  R     +N V +  +R   + QDNW   H    P +R + +  L N+  +  +  Y N   +  +S I M+       S   A  +E+C CPAGY+GLSCE
Sbjct:  183 CRADQATCQSGECISRDYICDGERDCADGSDEFRCTPSPCEPNEFRCK-------NGRCALKLWRCDGDNDCEDNSDEMDCTKGPEEQCASKHFECVSDRKCIPASYQCDEEPDCADRSDEYGCP-PTVTTPPEES-IQAVRGSTVMFTCRAVGVPTPMITWRLNWGHIP------VSGRVSMNNKNGFGTLTIRDVKESDQGAYTCEAINAKGLVFGVPDGVLTLVSNPI---PLSGNCPDGTFSVNDRCVPCFCAGISKNCKSAGRY-RDQIRLRFTDEEDFKVNVSYPSRPSTPPLSSTQLLIKPEMEEFQLVDLSRRFL-NLDSFWTLPRQFLGNKIDSYGGTLKFKVRYTLARGLSESVERPDVILVGNGRRL----VYRRGQSTPANVVNQKEIRFTEF-QDNW--QHSNGQPVSRGELMMTLANLDSISIRTIYDNHMVSVALSDIVMETTTTEFISLGPARDVEEC-CPAGYTGLSCE 640          

HSP 2 Score: 67.781 bits (164), Expect = 9.481e-11
Identity = 61/250 (24.40%), Postives = 108/250 (43.20%), Query Frame = 1
Query: 2812 QMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDA---AIVNFK---------TKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPG-PLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCEN 3522
            + C+ C+C  +T +CSS+T Y      + S+  P +    A+VN +         T E      +++++N     Y   E +Y +L   P+ Y        G  +  YG  L Y +    E++  L   P V I G   ++       + P   +   FE   R   W + +          ATR   + VL ++  +L +  Y     +  +S +SM+ A+   +  + A ++E+C+CP GY GLSC++
Sbjct: 1184 EGCLSCFCMGVTQQCSSSTHYRDT---VTSAFFPGNFEGFALVNRQRTNRISTGFTVEVSTEGTQLSYSN---FDYLGEEPHYWQL---PEAY-------KGDKVVSYGGKLKYTISYVAESTKSLQDDPDVQIIGNDITLVARQPWRQFPGRQTKH-FEVVFREEHWRRPDGIL-------ATREHLMMVLADLDDILIRASYSADMRSSSISDVSMEIAVPNYSGLAQALEVEQCRCPPGYQGLSCQD 1409          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: lrp2a (LDL receptor related protein 2 [Source:NCBI gene;Acc:101157655])

HSP 1 Score: 88.1965 bits (217), Expect = 5.154e-17
Identity = 47/125 (37.60%), Postives = 66/125 (52.80%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            +C  N   C N  C+  +  CDG +DC DNSDE     N  CSP++  C        N+RC+   W+CDG +DC ++ DE+NCP +    C    + C N+  IP ++ CD + DC    DE DC
Sbjct:  979 QCGANSFSCGNGKCVPNSYRCDGVDDCHDNSDEMSCGVNTTCSPSAFTC-------ANRRCVPVGWRCDGHNDCLDDSDEINCPTRVPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDEVDC 1096          

HSP 2 Score: 79.337 bits (194), Expect = 2.361e-14
Identity = 52/137 (37.96%), Postives = 73/137 (53.28%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE-CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFT 2496
            C  +Q +C +  CI  +  CDG NDCGD SDED++  N  CS +   C    +  P ++CI + W CDG  DC +  DE  NC  ++   C    + C+N L I RS +CD   DC    DE+ C+  Q  +P +FT
Sbjct: 2844 CNTDQFRCDDGRCIALSWICDGDNDCGDMSDEDQRHNNRTCSSSEFTC--ANNQPPQRKCIPRDWVCDGDADCADALDEHQNCTHRS---CGINEFTCSNGLCI-RSSYCDRRNDCGDSSDEQGCTY-QPCQPHQFT 2973          

HSP 3 Score: 76.2554 bits (186), Expect = 2.239e-13
Identity = 49/131 (37.40%), Postives = 60/131 (45.80%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYW-CDGEPDCSSMEDEEDCSNP 2469
            V   CP NQ  C N  CI     CD  NDCGD SDE     + C+P    C       P+ RCI  ++ CDG  DC +  DE +C       C    + C N      SY+ CDG  DCS   DE +C+ P
Sbjct: 1058 VPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDEVDCLGSTCNPEQFQC-------PDHRCIDPNYICDGDRDCVDGADEQDCY-----NCTANEFKCTNGHQCISSYYHCDGVFDCSDRSDEHNCTRP 1176          

HSP 4 Score: 75.8702 bits (185), Expect = 3.084e-13
Identity = 50/144 (34.72%), Postives = 71/144 (49.31%), Query Frame = 1
Query: 2059 TDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL---------LIPRSYWCDGEPDCSSMEDEED 2457
            +D   +    +C  +Q +C N+ CI E+  CDG++DCGD+SDED   C+   C P    C        N RCI + W+CD  DDCG+N DE   P++      G  Y C+N+           +P    C+G  DC    DE+D
Sbjct: 3511 SDEDPVLCTHQCESHQWQCANKRCIPESWQCDGEDDCGDHSDEDPAHCSARTCRPGQFKCR-------NGRCIPQAWKCDVDDDCGDNSDE---PLEE----CGPAYRCDNHTEFDCRTNYRCVPLWSVCNGHNDCRDNSDEQD 3640          

HSP 5 Score: 75.0998 bits (183), Expect = 4.860e-13
Identity = 50/142 (35.21%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNET-CIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFT 2496
            +  C   Q KC++   CI  +  CDG NDCGD SDE    C  + CS +   C        + RCI  HW CDG  DC +  DE L+C +     C    + C++   I  S+ CDG+ DC  M DE+   N +     +FT
Sbjct: 2758 ERTCQPEQTKCQSTNICIPRSYLCDGDNDCGDMSDESPTHCATSTCSQSEFRCS-------SGRCIPAHWYCDGGSDCSDGSDEPLSCTLIR--TCNTDQFRCDDGRCIALSWICDGDNDCGDMSDEDQRHNNRTCSSSEFT 2890          

HSP 6 Score: 74.3294 bits (181), Expect = 8.194e-13
Identity = 53/170 (31.18%), Postives = 66/170 (38.82%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC-----------NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVK----------NKDKCIGTHYLCNN-----------------------------NLLIPRSYWCDGEPDCSSMEDE 2451
            C   Q  C N  CI     CD  NDCGD SDE  + C           + C P    C        N RC+  H++CD  +DCG+N DE+ C  +          N  +CI   Y+CN                              N+ IPRSY CDG+ DC  M DE
Sbjct: 2631 CQPGQFTCMNGRCIRALWKCDNDNDCGDGSDELERVCQLLSSFIALSFHTCEPTMFTCG-------NGRCVPYHYRCDHYNDCGDNSDEVGCLFRPCDPNTEFPCNNGRCIAKEYVCNGINNCYDNGTSDEQNCERTCQPEQTKCQSTNICIPRSYLCDGDNDCGDMSDE 2793          

HSP 7 Score: 71.2478 bits (173), Expect = 7.447e-12
Identity = 44/121 (36.36%), Postives = 56/121 (46.28%), Query Frame = 1
Query: 2104 QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN 2466
            Q +C N  C D  + CD   DC D SDE    C  C+     C        N  CI + + CD  DDCG+  DELNC       C G ++ C +   I + + CDGE DC    DE+ C N
Sbjct:  122 QLRCTNGACYDRTQRCDHVLDCRDGSDE--ANCQHCNAGMFQCQ-------NGLCIPQRYVCDHDDDCGDRSDELNC----YPTCKGNYFTCPSGRCIHQVWLCDGEDDCEDNADEKGCDN 229          

HSP 8 Score: 70.0922 bits (170), Expect = 1.498e-11
Identity = 46/136 (33.82%), Postives = 65/136 (47.79%), Query Frame = 1
Query: 2080 VKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKN-KDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE---DCSNPQI 2475
                C +N+  C N  CI  + +CD +NDCGD+SDE       C P+   C        N RC+ + + CDG +DCG+  DEL    +     C   ++ C N   I  S  CD   DCS   DE+   +C++P I
Sbjct: 2925 THRSCGINEFTCSNGLCI-RSSYCDRRNDCGDSSDEQGCTYQPCQPHQFTCQ-------NGRCVAQDFVCDGDNDCGDESDELEHMCRTPAPTCPPGNFRCENGHCIDLSRVCDRSDDCSDNSDEKGINECTDPSI 3052          

HSP 9 Score: 69.707 bits (169), Expect = 1.995e-11
Identity = 47/133 (35.34%), Postives = 61/133 (45.86%), Query Frame = 1
Query: 2092 CPLNQRKCKN-ETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELN-CPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
            C  N+ KC N   CI     CDG  DC D SDE    C    P   H +       +  C+   W+CDG  DC +  DE + CP +    C  + + C+N   + RS+ CDG+ DC  M DE DC  P    P
Sbjct: 1138 CTANEFKCTNGHQCISSYYHCDGVFDCSDRSDE--HNCTR-PPGMCHHESEFQCQSDGSCVPSTWECDGHPDCEDGSDEHHACPPRT---CSSSLFRCDNGNCVLRSWICDGDNDCRDMSDERDCPTPPFRCP 1264          

HSP 10 Score: 69.707 bits (169), Expect = 2.442e-11
Identity = 46/139 (33.09%), Postives = 64/139 (46.04%), Query Frame = 1
Query: 2059 TDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDE---DRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN 2466
            +D ++  V   C  +   C N  C+     CDG NDC D+SDE     +    C  N   C        N RCI   W+CD  +DCG+  DE++C       C    + C ++  I  +Y CDG+ DC    DE+DC N
Sbjct: 1009 SDEMSCGVNTTCSPSAFTCANRRCVPVGWRCDGHNDCLDDSDEINCPTRVPGTCPANQFTC-------ANHRCIPHTWRCDTDNDCGDGSDEVDCL---GSTCNPEQFQCPDHRCIDPNYICDGDRDCVDGADEQDCYN 1137          

HSP 11 Score: 67.781 bits (164), Expect = 8.711e-11
Identity = 45/124 (36.29%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            C L Q +C    CI  +  CDG +DC D+SDE  + C + + +  H   L D      CI   W CD  +DC +  DE  NC       C G  + C+N + IP  Y CD   DCS   DE  C
Sbjct:    3 CELGQFRCGTGRCIPGDWHCDGTSDCVDDSDE--QDCAQVTCDHSHFQCLSDG----ECIPDVWVCDDEEDCEDGSDERQNC----GRTCTGDQFTCSNGMCIPALYRCDHMADCSDGSDERHC 116          

HSP 12 Score: 66.2402 bits (160), Expect = 2.625e-10
Identity = 43/128 (33.59%), Postives = 60/128 (46.88%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRK--KCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL-----LIPRSYWCDGEPDCSSMEDEE 2454
            C  ++ +C +  CI  + +CDG +DC D SDE         C+ +   CD       + RCI   W CDG +DCG+  DE      N   C  + + C NN       IPR + CDG+ DC+   DE 
Sbjct: 2803 CSQSEFRCSSGRCIPAHWYCDGGSDCSDGSDEPLSCTLIRTCNTDQFRCD-------DGRCIALSWICDGDNDCGDMSDEDQ--RHNNRTCSSSEFTCANNQPPQRKCIPRDWVCDGDADCADALDEH 2921          

HSP 13 Score: 62.7734 bits (151), Expect = 3.255e-9
Identity = 45/124 (36.29%), Postives = 58/124 (46.77%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC-NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDE 2451
            + C     +C+N  CI +   CD  +DCGD SDE    C   C  N   C       P+ RCI + W CDG DDC +N DE  C    + +C    + C ++   IP    CDG  DC   EDE
Sbjct:  153 QHCNAGMFQCQNGLCIPQRYVCDHDDDCGDRSDE--LNCYPTCKGNYFTC-------PSGRCIHQVWLCDGEDDCEDNADEKGCDNVPR-ECYPGEWPCPSSGKCIPMDKLCDGRVDCLDGEDE 266          

HSP 14 Score: 55.0694 bits (131), Expect = 5.967e-7
Identity = 41/125 (32.80%), Postives = 56/125 (44.80%), Query Frame = 1
Query: 2092 CPLNQRKCKN-ETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSI---HCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEE 2454
            C   Q +C N E+CI     CDG+ DC D SDE         P++    HC   +    +  C   ++ C+   DC +  DE   PV    +C    + C N   IP S+ CDGE DC    DE+
Sbjct: 3441 CTSTQYRCANNESCIPIWWKCDGQQDCRDGSDE---------PSTCPIRHCHLGQFQCSDGNCTSPYFLCNSNQDCPDGSDED--PVLCTHQCESHQWQCANKRCIPESWQCDGEDDCGDHSDED 3554          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:101161779])

HSP 1 Score: 87.0409 bits (214), Expect = 6.498e-17
Identity = 52/136 (38.24%), Postives = 65/136 (47.79%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKC--NECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            C  +Q KC N  C+     CDG +DCGD +DE    C    C P+  +C       P  +C+ K W CDG  DC N  DE NC VK   +C    + C N   I  S+ CD + DCS   DE  CS P    P+ F
Sbjct:   30 CSSSQLKCGNGRCVTRRWICDGTDDCGDGTDELLSTCASKTCLPSQFNC-----GAPINQCVPKSWHCDGKADCSNGADEKNCTVK---QCKNDEFRCANGQCISLSFVCDNDNDCSDGSDETTCSKP-TCNPLSF 156          

HSP 2 Score: 75.8702 bits (185), Expect = 2.162e-13
Identity = 48/135 (35.56%), Postives = 65/135 (48.15%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDEL--NCPVKN-KDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            ++C  ++ +C N  CI  +  CD  NDC D SDE       C+P S  C+       N  C+   W+CDG +DC +  DE    C  K    KC  + + C N   IP S+ CDG  DC    DE +CS P  +E
Sbjct:  110 KQCKNDEFRCANGQCISLSFVCDNDNDCSDGSDETTCSKPTCNPLSFQCN-------NSVCVPSLWRCDGDEDCADGSDEWPETCGGKKPAAKCSVSEFECANGQCIPGSWRCDGGIDCDDRSDELNCSRPVCLE 237          

HSP 3 Score: 65.4698 bits (158), Expect = 3.003e-10
Identity = 40/118 (33.90%), Postives = 56/118 (47.46%), Query Frame = 1
Query: 2110 KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            +C N  C+     CDG  DC D SDE  + C    P +  C   +    N +CI   W+CDG  DC +  DELNC   ++  C+   + C +   +  +  C+   DCS   DE DCS
Sbjct:  157 QCNNSVCVPSLWRCDGDEDCADGSDEWPETCGGKKP-AAKCSVSEFECANGQCIPGSWRCDGGIDCDDRSDELNC---SRPVCLEGQFQCGDGSCLQGNLKCNSVRDCSDGSDETDCS 270          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: lrp2b (low density lipoprotein receptor-related protein 2b [Source:ZFIN;Acc:ZDB-GENE-111115-1])

HSP 1 Score: 86.6557 bits (213), Expect = 1.414e-16
Identity = 43/119 (36.13%), Postives = 63/119 (52.94%), Query Frame = 1
Query: 2110 KCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN 2466
            +C    C   +  CDG  DC D +DE    C  CSP +  C+       NK CI   W+CDG+DDCG+  DE+NCP      C   ++ C+N   + +++ CDG+ DC    DE +C++
Sbjct:   55 ECDEGRCRPNSYRCDGIFDCVDKTDE--ANCTSCSPLAFTCN-------NKHCIYSSWRCDGMDDCGDGSDEVNCPTYIPSTCSSEYFTCDNKRCVSKAWLCDGDNDCGDGSDERNCNS 164          

HSP 2 Score: 77.411 bits (189), Expect = 8.976e-14
Identity = 45/128 (35.16%), Postives = 63/128 (49.22%), Query Frame = 1
Query: 2092 CPLNQRKC-KNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELN-CPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            C   Q  C   + C+  +  CDG  DC D+SDE   +   C  +   C        +  CI  +W+CDG  DC +  DE N CP      C+ +++ C N + IP S+ CDGE DC  M DE++C  P
Sbjct:  207 CQSYQFACASGDQCVSSSYRCDGVFDCRDHSDERNCRPGLCHDDEFQCQM------DGFCIPANWECDGHPDCEDGSDEHNTCPAVT---CLSSYFQCANKMCIPMSWLCDGENDCRDMSDEQNCPTP 325          

HSP 3 Score: 72.7886 bits (177), Expect = 2.138e-12
Identity = 46/133 (34.59%), Postives = 60/133 (45.11%), Query Frame = 1
Query: 2077 YVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE----CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDC 2460
            Y+   C      C N+ C+ +   CDG NDCGD SDE  + CN     C P    C       P+ RCI  ++ CDG  DC +  DE NC       C    + C + +  +  SY CDG  DC    DE +C
Sbjct:  123 YIPSTCSSEYFTCDNKRCVSKAWLCDGDNDCGDGSDE--RNCNSSISTCRPGYFLC-------PDHRCISSYFVCDGDQDCLDGSDEKNCEF----SCQSYQFACASGDQCVSSSYRCDGVFDCRDHSDERNC 242          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Match: lrp2a (LDL receptor related protein 2 [Source:NCBI gene;Acc:101157655])

HSP 1 Score: 85.8853 bits (211), Expect = 1.739e-16
Identity = 48/128 (37.50%), Postives = 67/128 (52.34%), Query Frame = 1
Query: 2089 ECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNE--CSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN 2466
            +C  N   C N  C+  +  CDG +DC DNSDE     N   CSP++  C        N+RC+   W+CDG +DC ++ DE+NCP +    C    + C N+  IP ++ CD + DC    DE DC N
Sbjct:  791 QCGANSFSCGNGKCVPNSYRCDGVDDCHDNSDEMSCGVNSTTCSPSAFTC-------ANRRCVPVGWRCDGHNDCLDDSDEINCPTRVPGTCPANQFTCANHRCIPHTWRCDTDNDCGDGSDEVDCRN 911          

HSP 2 Score: 71.2478 bits (173), Expect = 6.448e-12
Identity = 47/131 (35.88%), Postives = 64/131 (48.85%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDE-LNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIE 2481
            C L Q +C    CI  +  CDG +DC D+SDE  + C + + +  H   L D      CI   W CD  +DC +  DE  NCP +    C G  + C+N + IP  Y CD   DCS   DE  C+ P+  +
Sbjct:    5 CELGQFRCGTGRCIPGDWHCDGTSDCVDDSDE--QDCPQVTCDHSHFQCLSDG----ECIPDVWVCDDEEDCEDGSDERQNCPGR---TCTGDQFTCSNGMCIPALYRCDHMADCSDGSDERHCNYPECTQ 126          

HSP 3 Score: 68.5514 bits (166), Expect = 4.570e-11
Identity = 44/139 (31.65%), Postives = 63/139 (45.32%), Query Frame = 1
Query: 2083 KEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIG-THYLC-NNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKF 2493
            +  C   Q +C +  CID N  CDG  DC D +DE     N C+ N   C          +CI  ++ CDG+ DC +  DE NCP +    C   + + C ++   +P ++ CDG PDC    DE     P+      F
Sbjct:  910 RNTCNPEQFQCPDHRCIDPNYICDGDRDCVDGADEQDCSYN-CTANEFKC------TNGHQCISSYYHCDGVFDCSDRSDEHNCPTRPPGMCHHESEFQCQSDGSCVPSTWECDGHPDCEDGSDEHHACPPRTCSSSLF 1041          

HSP 4 Score: 68.1662 bits (165), Expect = 5.994e-11
Identity = 47/133 (35.34%), Postives = 61/133 (45.86%), Query Frame = 1
Query: 2092 CPLNQRKCKN-ETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELN-CPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEP 2484
            C  N+ KC N   CI     CDG  DC D SDE    C    P   H +       +  C+   W+CDG  DC +  DE + CP +    C  + + C+N   + RS+ CDG+ DC  M DE DC  P    P
Sbjct:  951 CTANEFKCTNGHQCISSYYHCDGVFDCSDRSDE--HNCPTRPPGMCHHESEFQCQSDGSCVPSTWECDGHPDCEDGSDEHHACPPR---TCSSSLFRCDNGNCVLRSWICDGDNDCRDMSDERDCPTPPFRCP 1078          

HSP 5 Score: 63.929 bits (154), Expect = 9.337e-10
Identity = 43/120 (35.83%), Postives = 56/120 (46.67%), Query Frame = 1
Query: 2104 QRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCS 2463
            Q +C N  C D  + CD   DC D SDE    C +      HC+       N  CI + + CD  DDCG+  DELNC       C G ++ C +   I + + CDGE DC    DE+ C 
Sbjct:  126 QLRCTNGACYDRTQRCDHVLDCRDGSDE--ANCTQ------HCNAGMFQCQNGLCIPQRYVCDHDDDCGDRSDELNCTYP---TCKGNYFTCPSGRCIHQVWLCDGEDDCEDNADEKGCG 234          

HSP 6 Score: 57.7658 bits (138), Expect = 8.112e-8
Identity = 42/126 (33.33%), Postives = 54/126 (42.86%), Query Frame = 1
Query: 2092 CPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNP 2469
            C  +Q  C N  CI     CD   DC D SDE  + CN      + C        N  C  +  +CD + DC +  DE NC       C    + C N L IP+ Y CD + DC    DE +C+ P
Sbjct:   85 CTGDQFTCSNGMCIPALYRCDHMADCSDGSDE--RHCNYPECTQLRC-------TNGACYDRTQRCDHVLDCRDGSDEANC----TQHCNAGMFQCQNGLCIPQRYVCDHDDDCGDRSDELNCTYP 197          

HSP 7 Score: 55.4546 bits (132), Expect = 3.694e-7
Identity = 34/91 (37.36%), Postives = 43/91 (47.25%), Query Frame = 1
Query: 2086 EECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKC 2358
            + C     +C+N  CI +   CD  +DCGD SDE       C  N   C       P+ RCI + W CDG DDC +N DE  C    + KC
Sbjct:  158 QHCNAGMFQCQNGLCIPQRYVCDHDDDCGDRSDELNCTYPTCKGNYFTC-------PSGRCIHQVWLCDGEDDCEDNADEKGCGKDGEYKC 241          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000075928.1 (SMESG000075928.1)

HSP 1 Score: 2336.99 bits (6055), Expect = 0.000e+0
Identity = 1147/1155 (99.31%), Postives = 1151/1155 (99.65%), Query Frame = 1
Query:   67 MSFNKVIPLFIFQFLISQTFGFQPTRNVSVNIKNSKFSPSRIHFVCPYIRPDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDKTIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESVNWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVKNIVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTILLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAMDVPTPLKYGSEMKIDCLTLDGEDGEXXXXXXXXXXXXXHNGNTLTISSFKKDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADNVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSCENKVE 3531
            MSFNKVIPLFIFQFLISQTFGFQPTRNVSVNIKNS FSPSRIHFVCPYIRPDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDKTIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESVNWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVKN++QTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTILLDY RDFYMKSIYEN TTIYYRINRYGDPSINKIGKLLISIKRSDDIAMDVPTPLKYGSEMKIDCLTLDGEDG+DVKVIWKKDDVVIHNGNTLTISSFKKDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELAD+VNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCP GYSGLSCENKVE
Sbjct:    1 MSFNKVIPLFIFQFLISQTFGFQPTRNVSVNIKNSTFSPSRIHFVCPYIRPDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDKTIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESVNWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVKNMIQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTILLDYDRDFYMKSIYENLTTIYYRINRYGDPSINKIGKLLISIKRSDDIAMDVPTPLKYGSEMKIDCLTLDGEDGDDVKVIWKKDDVVIHNGNTLTISSFKKDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSGVKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNSVSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELADDVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPVGYSGLSCENKVE 1155          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 491.886 bits (1265), Expect = 9.180e-147
Identity = 241/633 (38.07%), Postives = 374/633 (59.08%), Query Frame = 1
Query: 1636 WKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL-LIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKG-ESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYS---WAAKLEKCKCPAGYSGLSCE 3519
            W F    S  E +L  +A +   S  S+   V I +V   H GTY C          + V  K  L V+P  + V+PG  ARF+C+LIG  G V+WRR DKKS  +  E+R   +  +LL V  ATK+ +GTVYEC  N L    TL VK+ C  NQR C+N  CIDENKFC+G  DC D  DE+   C +C PN   C  +    P+++C+  +W+CDG +DCGN +DELNC   +K+ C+G+H+ C++N+ LIPRS WCD  P+C + EDE++C +P+++ P + T   +  NS++++ C++   P  TI+WR+NW  LP+ L++ +  T  +C+ IT+ LT+ N++ D +GIY+CE +S +R +A D+++ VT   +C++P +NN A +  MC++C+CS  TD+CSSA GY  +P    S+   +   ++NFK+++  + +   +  +  +  Y      Y+  V +P+ +    F M GSWL  Y Y L   + L GE+ D +PGP V+++     S+Y C+      +Y++ E F N ++I LWE++NWF D  C   A R D + VL +++ +L ++KYY+ QT F+    ++   I   +S     +A ++EKC CP  Y+GLSCE
Sbjct:  337 WTFKNLASNVETNLSKDAVIRHNSFNST---VNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTST--RTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCE 964          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 491.886 bits (1265), Expect = 9.180e-147
Identity = 241/633 (38.07%), Postives = 374/633 (59.08%), Query Frame = 1
Query: 1636 WKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL-LIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKG-ESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYS---WAAKLEKCKCPAGYSGLSCE 3519
            W F    S  E +L  +A +   S  S+   V I +V   H GTY C          + V  K  L V+P  + V+PG  ARF+C+LIG  G V+WRR DKKS  +  E+R   +  +LL V  ATK+ +GTVYEC  N L    TL VK+ C  NQR C+N  CIDENKFC+G  DC D  DE+   C +C PN   C  +    P+++C+  +W+CDG +DCGN +DELNC   +K+ C+G+H+ C++N+ LIPRS WCD  P+C + EDE++C +P+++ P + T   +  NS++++ C++   P  TI+WR+NW  LP+ L++ +  T  +C+ IT+ LT+ N++ D +GIY+CE +S +R +A D+++ VT   +C++P +NN A +  MC++C+CS  TD+CSSA GY  +P    S+   +   ++NFK+++  + +   +  +  +  Y      Y+  V +P+ +    F M GSWL  Y Y L   + L GE+ D +PGP V+++     S+Y C+      +Y++ E F N ++I LWE++NWF D  C   A R D + VL +++ +L ++KYY+ QT F+    ++   I   +S     +A ++EKC CP  Y+GLSCE
Sbjct:  337 WTFKNLASNVETNLSKDAVIRHNSFNST---VNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTST--RTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCE 964          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 491.886 bits (1265), Expect = 9.180e-147
Identity = 241/633 (38.07%), Postives = 374/633 (59.08%), Query Frame = 1
Query: 1636 WKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL-LIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKG-ESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYS---WAAKLEKCKCPAGYSGLSCE 3519
            W F    S  E +L  +A +   S  S+   V I +V   H GTY C          + V  K  L V+P  + V+PG  ARF+C+LIG  G V+WRR DKKS  +  E+R   +  +LL V  ATK+ +GTVYEC  N L    TL VK+ C  NQR C+N  CIDENKFC+G  DC D  DE+   C +C PN   C  +    P+++C+  +W+CDG +DCGN +DELNC   +K+ C+G+H+ C++N+ LIPRS WCD  P+C + EDE++C +P+++ P + T   +  NS++++ C++   P  TI+WR+NW  LP+ L++ +  T  +C+ IT+ LT+ N++ D +GIY+CE +S +R +A D+++ VT   +C++P +NN A +  MC++C+CS  TD+CSSA GY  +P    S+   +   ++NFK+++  + +   +  +  +  Y      Y+  V +P+ +    F M GSWL  Y Y L   + L GE+ D +PGP V+++     S+Y C+      +Y++ E F N ++I LWE++NWF D  C   A R D + VL +++ +L ++KYY+ QT F+    ++   I   +S     +A ++EKC CP  Y+GLSCE
Sbjct:  337 WTFKNLASNVETNLSKDAVIRHNSFNST---VNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTST--RTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCE 964          
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Match: SMESG000055070.1 (SMESG000055070.1)

HSP 1 Score: 491.886 bits (1265), Expect = 9.180e-147
Identity = 241/633 (38.07%), Postives = 374/633 (59.08%), Query Frame = 1
Query: 1636 WKFIPENSKSELDLPTEAKVERPSAASSTSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKPGGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATKDDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKNDCGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNNFDELNCPVKNKDKCIGTHYLCNNNL-LIPRSYWCDGEPDCSSMEDEEDCSNPQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYNITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKGQICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPSDAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGAFNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKG-ESDSIYHCSVKYRLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLVLFKVKYYNGQTNFQMSKISMQEAIETTNSYS---WAAKLEKCKCPAGYSGLSCE 3519
            W F    S  E +L  +A +   S  S+   V I +V   H GTY C          + V  K  L V+P  + V+PG  ARF+C+LIG  G V+WRR DKKS  +  E+R   +  +LL V  ATK+ +GTVYEC  N L    TL VK+ C  NQR C+N  CIDENKFC+G  DC D  DE+   C +C PN   C  +    P+++C+  +W+CDG +DCGN +DELNC   +K+ C+G+H+ C++N+ LIPRS WCD  P+C + EDE++C +P+++ P + T   +  NS++++ C++   P  TI+WR+NW  LP+ L++ +  T  +C+ IT+ LT+ N++ D +GIY+CE +S +R +A D+++ VT   +C++P +NN A +  MC++C+CS  TD+CSSA GY  +P    S+   +   ++NFK+++  + +   +  +  +  Y      Y+  V +P+ +    F M GSWL  Y Y L   + L GE+ D +PGP V+++     S+Y C+      +Y++ E F N ++I LWE++NWF D  C   A R D + VL +++ +L ++KYY+ QT F+    ++   I   +S     +A ++EKC CP  Y+GLSCE
Sbjct:  337 WTFKNLASNVETNLSKDAVIRHNSFNST---VNINSVKPFHAGTYYCDAKKDVASAVLNVLPKPTLLVTPTEMIVRPGSSARFLCQLIGASGTVIWRREDKKSFQIDVESRVGGETQALLIVNTATKEMNGTVYECVHNNLLIKATLIVKDFCSFNQRACRNSICIDENKFCNGIKDCEDGFDEEINTCAQCEPNQFACHTVGGIPPHQKCVANYWRCDGENDCGNGYDELNCIKLDKNTCLGSHFACDDNVTLIPRSAWCDENPNCLNGEDEKNCRHPEVVIPNQETTYVVHANSSISLKCEVVSVPTSTINWRFNWGRLPQRLNFTVHQTGKDCNRITNVLTINNMSPDFAGIYTCEALSTKRAMAKDYTIFVTSKTLCEKPMFNNAAMFVSMCLKCFCSGQTDDCSSAMGYYQSPNPKTST--RTKGLLMNFKSQKILEVSYAKSIYDVNSKSYKFVGKMYQDFVVDPNVFLTSDFGMDGSWLESYSYYLKINIRLFGESKDDIPGPKVILQNVNGKSLYWCTNDNSEVIYSNPEGFYNQLKISLWEKENWFIDSICETSAMRPDILAVLSDIKYLLIRIKYYSNQTGFEFFNATVDHVITNPDSMGSNIYAPRIEKCNCPTPYTGLSCE 964          
The following BLAST results are available for this feature:
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPG22.383e-4627.00heparan sulfate proteoglycan 2 [Source:HGNC Symbol... [more]
LRP23.569e-1735.71LDL receptor related protein 2 [Source:HGNC Symbol... [more]
LRP22.511e-1635.71LDL receptor related protein 2 [Source:HGNC Symbol... [more]
LRP15.596e-1537.01LDL receptor related protein 1 [Source:HGNC Symbol... [more]
LAMA28.930e-1525.00laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-521.955e-3526.35Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-522.989e-3526.53Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-523.275e-3526.47Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-523.300e-3526.47Basement membrane proteoglycan [Source:UniProtKB/... [more]
unc-523.595e-3526.47Basement membrane proteoglycan [Source:UniProtKB/... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trol1.867e-4827.10gene:FBgn0284408 transcript:FBtr0342811[more]
trol1.968e-4827.10gene:FBgn0284408 transcript:FBtr0342825[more]
trol2.158e-4827.10gene:FBgn0284408 transcript:FBtr0342824[more]
trol2.366e-4827.10gene:FBgn0284408 transcript:FBtr0342815[more]
trol2.398e-4827.10gene:FBgn0284408 transcript:FBtr0342823[more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg22.090e-5029.54heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg22.224e-5029.54heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg22.371e-5029.54heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
lrp2a6.467e-1835.04low density lipoprotein receptor-related protein 2... [more]
lrp2a6.686e-1835.04low density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sel1l5.586e-4928.22SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l3.324e-4828.48SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
sel1l8.149e-4828.37SEL1L adaptor subunit of ERAD E3 ubiquitin ligase ... [more]
lpp1.316e-1532.26LIM domain containing preferred translocation part... [more]
LRP12.142e-1539.10LDL receptor related protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspg22.817e-4527.55perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Hspg22.818e-4527.55perlecan (heparan sulfate proteoglycan 2) [Source:... [more]
Lrp21.581e-1741.54low density lipoprotein receptor-related protein 2... [more]
Lrp14.180e-1537.01low density lipoprotein receptor-related protein 1... [more]
Lrp46.092e-1543.24low density lipoprotein receptor-related protein 4... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P98160|PGBM_HUMAN1.144e-4527.00Basement membrane-specific heparan sulfate proteog... [more]
sp|Q05793|PGBM_MOUSE3.102e-4427.55Basement membrane-specific heparan sulfate proteog... [more]
sp|Q06561|UNC52_CAEEL2.486e-3426.35Basement membrane proteoglycan OS=Caenorhabditis e... [more]
sp|C0HL13|LRP2_PIG2.729e-1841.43Low-density lipoprotein receptor-related protein 2... [more]
sp|A2ARV4|LRP2_MOUSE1.106e-1641.54Low-density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZV60.000e+099.67Pharynx muscle-1 (Fragment) OS=Schmidtea mediterra... [more]
A0A095AGT95.413e-16437.31Basement membrane-specific heparan sulfate proteog... [more]
A0A5K4F3222.887e-15937.08Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F4U52.915e-15937.08Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5J4NMJ01.626e-15135.67Heparan sulfate proteoglycan 2 (Perlecan) OS=Parag... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg25.085e-4928.23heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg25.787e-4928.23heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg26.226e-4928.37heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
hspg26.539e-4928.37heparan sulfate proteoglycan 2 [Source:ZFIN;Acc:ZD... [more]
lrp2a8.767e-1834.07low density lipoprotein receptor-related protein 2... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp2a9.253e-1638.93low density lipoprotein receptor-related protein 2... [more]
ENSPMAT00000001137.11.133e-1536.99pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1... [more]
lrp1ab1.003e-1428.29low density lipoprotein receptor-related protein 1... [more]
corin1.227e-1333.97corin, serine peptidase [Source:ZFIN;Acc:ZDB-GENE-... [more]
sorl13.358e-1330.38sortilin-related receptor, L(DLR class) A repeats ... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494984.839e-1933.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452188.082e-1839.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480691.162e-1739.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457476.739e-1740.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494999.686e-1639.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspg23.919e-4928.60heparan sulfate proteoglycan 2 [Source:NCBI gene;A... [more]
lrp2a5.154e-1737.60LDL receptor related protein 2 [Source:NCBI gene;A... [more]
ldlrb6.498e-1738.24low-density lipoprotein receptor [Source:NCBI gene... [more]
lrp2b1.414e-1636.13low density lipoprotein receptor-related protein 2... [more]
lrp2a1.739e-1637.50LDL receptor related protein 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Basement membrane-specific heparan sulfate proteoglycan core protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075928.10.000e+099.31SMESG000075928.1[more]
SMESG000055070.19.180e-14738.07SMESG000055070.1[more]
SMESG000055070.19.180e-14738.07SMESG000055070.1[more]
SMESG000055070.19.180e-14738.07SMESG000055070.1[more]
SMESG000055070.19.180e-14738.07SMESG000055070.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017714 ID=SMED30017714|Name=Basement membrane-specific heparan sulfate proteoglycan core protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3624bp
TATCATTTCATTTTAATGCTTTAAGCTTGCTTTAATTAAAACAAAACTGT
TTTCATTAATTTACTAATGAGTTTCAATAAAGTCATTCCTTTATTTATTT
TCCAATTCCTCATCAGTCAGACCTTCGGGTTCCAACCAACAAGAAATGTC
TCGGTAAACATAAAAAATTCGAAGTTTAGTCCTTCTCGAATTCATTTTGT
TTGTCCATATATTCGACCTGATGGCGATATAATCAAATATTATAAATATG
TAGAAAACAATCTTGTTTTAATCAAGGAACAAAATACGTCTGATGGGATA
GTCATTAAGTTAAAACAGTTAAAAGATTTAGGAAAATATGAATGTTCGGT
TTTATCAAAAGATAAAACAATCCGAAATTCAACTCTCAATATTTTTGATC
GAAGCATAATTGAAAGTCCAAAGTTATTTGTTTATAAAGTAGCTGATGTA
GTTTATGTTCAGCAAATGAATGGTACGGTTGAATTAGATTGTGGGTCTTT
GGAAGAGGAATCAGTAAATTGGTTTAGACCTCCACAATATCATATTTATT
CTGGACACAAATATAAAATTGATAAAATTGATATCTACAGCTATGGCACT
TATTATTGTTCCAGGGGAGAAATAAACAAATATTCAGTTGAAGTTAAAAA
GATTATATTAGTTAAAAATATAGTTCAAACAAAAGAAAAACCGATTGATG
AAGAAGTGACTTATATAGAAGCGCTTTACTCGACATCCAAAAAGATCCGT
TACAGATCTCCGAATGTAATCTCTAACGGTGATATTGTCTCCTGGGAACA
TCCTCCAGGAACCATTTTACTGGATTATTACAGAGACTTTTATATGAAAT
CCATTTATGAAAATTTCACTACTATTTATTATAGAATTAATAGATATGGA
GACCCTAGCATTAATAAAATTGGAAAACTTTTAATTTCAATTAAAAGATC
TGATGATATTGCTATGGACGTTCCAACTCCTTTAAAATATGGTTCGGAAA
TGAAAATTGATTGCCTGACTTTGGATGGTGAAGATGGTGAGGATGTTAAA
GTTATCTGGAAGAAAGATGACGTTGTTATTCATAATGGAAATACTTTGAC
GATTTCGTCTTTCAAAAAGGATGCTTTCGGAAAATACAGCTGTGAAATCA
TAAGGGGTGATCAAGAACGAAAAATTCGTTTTGTAAATTTGTGGCCACAA
CAGAAAATAGAAACCAAAATTGAAATGACCCCAGATCCAGGACAATATTA
TTTGTACCATTCGGGAGTTAAAAAAGAACTTCATTGTGAAATTCTTCGGG
TGGATAACAAATGGATAATGAAAGGAAGCGATATTATTTGGACCTTTAAC
GGCAGAAAGATTGATGTAAATGATAATATTTATAAAAGAAAATTAGCAAG
ATTAGATACAAATTCAGTGAGCATTCTTGTGATTAAAAATATGAATGAGG
AAAATGAAGGAACTTACAAATGTTATCAAAAGTCAGAAATCTTTTCCGCC
AAGCTATTACTAGAAAGAAGCGGAGTATTGATAGAAATTGCACCTCCGTT
GCAAGAGCTGGCGGATAATGTAAATCATATAGCTGAGTTGCACTGTAGAA
TAGATACAGCCAATATAAATTCAAGTTCTATCAATTGGAAGTTTATTCCA
GAAAATTCAAAATCAGAATTAGATCTTCCAACTGAGGCCAAAGTAGAAAG
ACCCTCAGCAGCATCTTCAACTTCTTTTGTTGTTATTGAAAATGTGCTCA
AAAAACACGAAGGTACTTACGTCTGTCAGGTATTAGATACGAAGGTATAT
GGGAGGATTGTTGTCAGAACTAAAGCAGTGCTGAAAGTTTCTCCAAAAGT
AGTTACTGTAAAACCTGGTGGAGGTGCCAGATTTGTATGCGAATTAATTG
GGGTTCAAGGGAAAGTTCTTTGGAGACGAATGGATAAAAAAAGTTTAACA
GTTTTTAAAGAAACCAGATTTGACAGTAAAATGCTAAGTTTACTAGAAGT
CAAAGATGCTACAAAGGATGATGATGGAACCGTCTATGAATGCGCTTTCA
ATAAACTAACTGATTATGTAACATTATACGTAAAGGAAGAATGCCCCCTA
AATCAACGTAAATGTAAAAATGAAACATGCATTGATGAAAACAAATTCTG
CGATGGTAAAAATGATTGTGGGGACAACTCAGATGAAGACCGCAAAAAAT
GCAATGAATGCAGTCCAAACTCAATCCATTGCGATTTCCTGAAAGATGCG
AATCCAAACAAAAGGTGCATTATTAAGCACTGGCAATGTGATGGAATAGA
CGACTGTGGAAATAACTTCGACGAGTTAAATTGTCCAGTTAAAAATAAAG
ACAAATGCATTGGAACACACTATTTGTGCAATAATAACCTCCTGATTCCT
CGTTCATATTGGTGTGATGGAGAGCCAGATTGTTCGTCAATGGAAGACGA
AGAAGACTGCAGTAATCCACAAATTATTGAACCCGTGAAATTTACTCCAA
TTTCTATTTTTACTAATTCGACTTTGACTATAACTTGCAAAATGTCTGGA
CGTCCTGTTCCAACAATTTCATGGAGATATAACTGGGACCATCTGCCAGA
AAATCTTGATTATAACATTACGACAACGGTGTCCAACTGTAGTGTAATAA
CGAGCAGTTTAACTGTGCAAAATATAAATACAGATCACAGTGGCATATAT
TCATGCGAGGGTATTTCACGTAGGAGAATAATAGCGCCAGACTTCTCCGT
ATCCGTTACAAAAGGACAAATATGTCAGAGGCCTTTCTATAATAATGATG
CGTGGTATCCACAGATGTGCATCAGGTGCTACTGTTCCAATCTAACAGAC
GAATGTTCAAGTGCTACGGGATATGCCACAAATCCTGTATTAATTGAAAG
CAGCATAAAGCCGTCCGATGCTGCTATCGTTAACTTTAAAACTAAAGAAT
ATTATAAGCCAGCTAGAGAAATTACATTTGCTAATAAAGCAGCAATGAAA
TATTTCATTAATGAAACGTATTATAAAAAATTGGTACCTAATCCGGATTA
TTATTTTGGGGGTGCTTTCAATATGGCGGGATCATGGTTGACAAGATATG
GATACCCTTTGACCTATAAATTGATTTTGTCTGGTGAAAATTCAGATTAC
CTCCCCGGTCCCTTGGTCGTGATAAAGGGCGAATCAGATTCGATTTACCA
TTGCAGTGTTAAATATCGCTTGCCTGTGTATGCATCCAATGAGGTGTTTG
AAAATAATATGCGAATATATTTATGGGAGCAGGACAATTGGTTCACTGAT
CACAGATGCACTTTGCCAGCGACTCGAAGAGATTTTATAAATGTGTTGAA
AAATGTACGATTAGTTTTGTTTAAAGTGAAATATTATAACGGACAAACCA
ATTTTCAAATGTCTAAAATTTCAATGCAAGAAGCAATTGAAACGACAAAT
AGTTATTCTTGGGCAGCAAAACTGGAGAAATGCAAATGCCCAGCGGGATA
TTCGGGATTATCGTGTGAAAATAAAGTCGAATAAAAGTTTTTCAAATTAT
CAAAATGGTGGACTTTAGTGTTAGTAAATAATAATAACTGTCTTTATCTT
ATTGCTATATGTTATACTTATATT
back to top

protein sequence of SMED30017714-orf-1

>SMED30017714-orf-1 ID=SMED30017714-orf-1|Name=SMED30017714-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1156bp
MSFNKVIPLFIFQFLISQTFGFQPTRNVSVNIKNSKFSPSRIHFVCPYIR
PDGDIIKYYKYVENNLVLIKEQNTSDGIVIKLKQLKDLGKYECSVLSKDK
TIRNSTLNIFDRSIIESPKLFVYKVADVVYVQQMNGTVELDCGSLEEESV
NWFRPPQYHIYSGHKYKIDKIDIYSYGTYYCSRGEINKYSVEVKKIILVK
NIVQTKEKPIDEEVTYIEALYSTSKKIRYRSPNVISNGDIVSWEHPPGTI
LLDYYRDFYMKSIYENFTTIYYRINRYGDPSINKIGKLLISIKRSDDIAM
DVPTPLKYGSEMKIDCLTLDGEDGEDVKVIWKKDDVVIHNGNTLTISSFK
KDAFGKYSCEIIRGDQERKIRFVNLWPQQKIETKIEMTPDPGQYYLYHSG
VKKELHCEILRVDNKWIMKGSDIIWTFNGRKIDVNDNIYKRKLARLDTNS
VSILVIKNMNEENEGTYKCYQKSEIFSAKLLLERSGVLIEIAPPLQELAD
NVNHIAELHCRIDTANINSSSINWKFIPENSKSELDLPTEAKVERPSAAS
STSFVVIENVLKKHEGTYVCQVLDTKVYGRIVVRTKAVLKVSPKVVTVKP
GGGARFVCELIGVQGKVLWRRMDKKSLTVFKETRFDSKMLSLLEVKDATK
DDDGTVYECAFNKLTDYVTLYVKEECPLNQRKCKNETCIDENKFCDGKND
CGDNSDEDRKKCNECSPNSIHCDFLKDANPNKRCIIKHWQCDGIDDCGNN
FDELNCPVKNKDKCIGTHYLCNNNLLIPRSYWCDGEPDCSSMEDEEDCSN
PQIIEPVKFTPISIFTNSTLTITCKMSGRPVPTISWRYNWDHLPENLDYN
ITTTVSNCSVITSSLTVQNINTDHSGIYSCEGISRRRIIAPDFSVSVTKG
QICQRPFYNNDAWYPQMCIRCYCSNLTDECSSATGYATNPVLIESSIKPS
DAAIVNFKTKEYYKPAREITFANKAAMKYFINETYYKKLVPNPDYYFGGA
FNMAGSWLTRYGYPLTYKLILSGENSDYLPGPLVVIKGESDSIYHCSVKY
RLPVYASNEVFENNMRIYLWEQDNWFTDHRCTLPATRRDFINVLKNVRLV
LFKVKYYNGQTNFQMSKISMQEAIETTNSYSWAAKLEKCKCPAGYSGLSC
ENKVE*
back to top
Aliases
The feature 'Basement membrane-specific heparan sulfate proteoglycan core protein' has the following synonyms
Synonym
laminin
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000072mouth
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR036179Ig-like_dom_sf
IPR002172LDrepeatLR_classA_rpt
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR000034Laminin_IV
IPR023415LDLR_class-A_CS
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004471malate dehydrogenase (decarboxylating) (NAD+) activity
GO:0051287NAD binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 774..795
score: 42.46
coord: 732..753
score: 47.12
coord: 686..707
score: 49.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 714..758
e-value: 5.5E-9
score: 45.8
coord: 763..800
e-value: 8.8E-7
score: 38.5
coord: 675..713
e-value: 2.4E-7
score: 40.4
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 675..712
e-value: 4.4E-6
score: 26.8
coord: 763..798
e-value: 1.6E-6
score: 28.2
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 714..757
score: 11.25
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 675..713
score: 12.375
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 763..799
score: 10.262
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 764..798
e-value: 2.28403E-7
score: 46.0458
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 715..756
e-value: 4.91146E-9
score: 50.6682
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 676..708
e-value: 5.56695E-11
score: 56.061
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 127..198
e-value: 9.6
score: 11.6
coord: 392..483
e-value: 6.5
score: 13.1
coord: 495..592
e-value: 0.084
score: 22.0
coord: 593..673
e-value: 2.1E-4
score: 30.7
coord: 301..378
e-value: 78.0
score: 3.7
coord: 809..898
e-value: 2.3E-4
score: 30.5
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 815..887
e-value: 6.1E-7
score: 39.1
coord: 133..188
e-value: 5.3
score: 0.2
coord: 398..476
e-value: 1.3
score: 5.9
coord: 501..577
e-value: 5.4
score: 0.1
IPR000034Laminin IVPFAMPF00052Laminin_Bcoord: 1005..1127
e-value: 4.3E-11
score: 42.8
IPR000034Laminin IVPROSITEPS51115LAMININ_IVAcoord: 947..1138
score: 15.52
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 589..674
e-value: 1.9E-6
score: 29.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 501..588
e-value: 1.1E-5
score: 27.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 801..901
e-value: 3.4E-12
score: 48.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 390..483
e-value: 1.9E-6
score: 29.9
NoneNo IPR availablePFAMPF13927Ig_3coord: 801..881
e-value: 2.7E-9
score: 37.5
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 675..936
NoneNo IPR availablePANTHERPTHR11640:SF79HEPARAN SULFATE PROTEOGLYCAN 2coord: 675..936
NoneNo IPR availableCDDcd00096Igcoord: 422..469
e-value: 0.00628333
score: 34.5253
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.679
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 675..712
e-value: 5.0E-9
score: 37.7
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 758..800
e-value: 3.5E-8
score: 34.9
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 713..756
e-value: 1.5E-7
score: 33.5
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 715..758
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 763..801
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 672..709
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 688..712
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 377..469
score: 8.629
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 280..371
score: 8.666
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 801..896
score: 11.297
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 493..572
score: 7.794
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 593..669
score: 6.978
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 803..884
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 419..475
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 588..663
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 307..361