26S proteasome non-ATPase regulatory subunit 7

Overview
Name26S proteasome non-ATPase regulatory subunit 7
Smed IDSMED30017710
Length (bp)1060
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome non-ATPase regulatory subunit 7 (SMED30017710) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 7 (SMED30017710) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 26S proteasome non-ATPase regulatory subunit 7 (SMED30017710) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 7 (SMED30017710) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017710

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30017710h1SMcG0008425 dd_Smed_v4_2665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30017710h1SMcG0008425 dd_Smed_v4_2665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Human
Match: PSMD7 (proteasome 26S subunit, non-ATPase 7 [Source:HGNC Symbol;Acc:HGNC:9565])

HSP 1 Score: 339.732 bits (870), Expect = 1.358e-115
Identity = 169/265 (63.77%), Postives = 222/265 (83.77%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNRE 925
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V    +P+N+ I+Y LQD+FNLLPDV L + +K+ Y+KTNDQM+V+Y+AS+IRS++ALH+LI NK+ NR+
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRD 284          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Human
Match: PSMD7 (proteasome 26S subunit, non-ATPase 7 [Source:HGNC Symbol;Acc:HGNC:9565])

HSP 1 Score: 212.616 bits (540), Expect = 1.578e-67
Identity = 111/169 (65.68%), Postives = 140/169 (82.84%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLS 637
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLR    S+   +S
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRCRTSSTCCQMS 188          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Human
Match: PSMD7 (proteasome 26S subunit, non-ATPase 7 [Source:HGNC Symbol;Acc:HGNC:9565])

HSP 1 Score: 209.534 bits (532), Expect = 1.049e-66
Identity = 109/158 (68.99%), Postives = 136/158 (86.08%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLR 604
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLR
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLR 177          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Human
Match: EIF3F (eukaryotic translation initiation factor 3 subunit F [Source:HGNC Symbol;Acc:HGNC:3275])

HSP 1 Score: 73.1738 bits (178), Expect = 9.054e-14
Identity = 62/276 (22.46%), Postives = 125/276 (45.29%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTK----TFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRI--KNQLMGLE-------GLKAH----LNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITN 907
            D Y R  +  G+ RV+G LLG + K  +E+TN ++VP  E    ++   +D ++ ++M+ + KKV+  E I+GWY +G  + ++ + I+E + R                    P   +L +D    +G ++ K    T   +P          + V++   D +   +  + +     N+++GL        G  A     L+ +  Y   V++  +  + ++   L  + N +P +  DD         ND ++V Y+A++ +S +AL++ + N
Sbjct:  104 DSYER--RNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNES---EDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSRE------------------APNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVN 356          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Human
Match: EIF3F (eukaryotic translation initiation factor 3 subunit F [Source:HGNC Symbol;Acc:HGNC:3275])

HSP 1 Score: 73.1738 bits (178), Expect = 9.054e-14
Identity = 62/276 (22.46%), Postives = 125/276 (45.29%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTK----TFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRI--KNQLMGLE-------GLKAH----LNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITN 907
            D Y R  +  G+ RV+G LLG + K  +E+TN ++VP  E    ++   +D ++ ++M+ + KKV+  E I+GWY +G  + ++ + I+E + R                    P   +L +D    +G ++ K    T   +P          + V++   D +   +  + +     N+++GL        G  A     L+ +  Y   V++  +  + ++   L  + N +P +  DD         ND ++V Y+A++ +S +AL++ + N
Sbjct:  104 DSYER--RNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNES---EDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSRE------------------APNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVN 356          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Celegans
Match: rpn-8 (Proteasome Regulatory Particle, Non-ATPase-like [Source:UniProtKB/TrEMBL;Acc:O61792])

HSP 1 Score: 313.538 bits (802), Expect = 3.491e-105
Identity = 161/272 (59.19%), Postives = 211/272 (77.57%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKD-VLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEE 943
            DH+NR+SK    KRVVGVLLG M+KD  L+I NS+AVPF+ED  DK+ WFLD DYLESM+ MF KV AKEKIVGWYH+GPKL +NDI INE  +R+    V+VI+D EPK   GLPTEAY+ + EVHDDGT   KTF+H+PS+IGAEEAEEVGVEHLLRDIKD + G+LSQRI +QLMGL GL++ L  I  YL  ++   +P+N+ ++Y++Q++ NLLPDV   D I SQ ++TNDQ++ +YM S++RS++ALH+LI NK++ ++ E  +E
Sbjct:   53 DHFNRVSKTQSVKRVVGVLLGSMKKDKTLDIGNSFAVPFDEDDKDKSTWFLDMDYLESMYGMFYKVAAKEKIVGWYHTGPKLHKNDIAINEQLKRFCPNPVLVIIDAEPKNI-GLPTEAYIEVQEVHDDGTPPIKTFEHVPSDIGAEEAEEVGVEHLLRDIKDQTAGTLSQRITDQLMGLRGLQSQLESIEKYLHDIVRGTLPVNHHVIYYVQEVLNLLPDVTHPDYIVSQNVQTNDQLMCVYMGSLVRSVVALHNLIDNKISLQKAEKEQE 323          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Celegans
Match: eif-3.F (Eukaryotic translation initiation factor 3 subunit F [Source:UniProtKB/Swiss-Prot;Acc:Q18967])

HSP 1 Score: 55.0694 bits (131), Expect = 1.988e-8
Identity = 23/69 (33.33%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  149 SKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWY 355
            +K +G ++ +G L+GY  K  +++TN +A+PF E   D  +   D  + + M S  KK +  E+ VGW+
Sbjct:   29 AKNTGQEKCMGTLMGYYEKGSIQVTNCFAIPFNESNDDLEI---DDQFNQQMISALKKTSPNEQPVGWF 94          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Fly
Match: Rpn8 (gene:FBgn0002787 transcript:FBtr0332921)

HSP 1 Score: 353.214 bits (905), Expect = 4.125e-121
Identity = 177/268 (66.04%), Postives = 223/268 (83.21%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMR-KDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKE 931
            DH+NR+ K    KRVVGVLLG  R K VL+++NS+AVPF+ED  DK+VWFLDHDYLE+M+ MFKKVNA+E++VGWYH+GPKL QNDI INEL RRY   SV+VI+D +PK+  GLPTEAY++++EVHDDG+ T+KTF+H+PSEIGAEEAEEVGVEHLLRDIKD+++GSLSQ+I NQLMGL+GL A L +I  YL  V +  +P+N+ I+Y LQDIFNLLPD+  D    + Y+KTNDQMLV+Y+ASM+RSI+ALH+LI NKL NR+ E
Sbjct:   23 DHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDL-GLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVYLASMVRSIIALHNLINNKLANRDAE 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Fly
Match: Rpn8 (gene:FBgn0002787 transcript:FBtr0072290)

HSP 1 Score: 353.214 bits (905), Expect = 4.125e-121
Identity = 177/268 (66.04%), Postives = 223/268 (83.21%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMR-KDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKE 931
            DH+NR+ K    KRVVGVLLG  R K VL+++NS+AVPF+ED  DK+VWFLDHDYLE+M+ MFKKVNA+E++VGWYH+GPKL QNDI INEL RRY   SV+VI+D +PK+  GLPTEAY++++EVHDDG+ T+KTF+H+PSEIGAEEAEEVGVEHLLRDIKD+++GSLSQ+I NQLMGL+GL A L +I  YL  V +  +P+N+ I+Y LQDIFNLLPD+  D    + Y+KTNDQMLV+Y+ASM+RSI+ALH+LI NKL NR+ E
Sbjct:   23 DHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDL-GLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVYLASMVRSIIALHNLINNKLANRDAE 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Fly
Match: Rpn8 (gene:FBgn0002787 transcript:FBtr0330237)

HSP 1 Score: 353.214 bits (905), Expect = 8.618e-121
Identity = 177/268 (66.04%), Postives = 223/268 (83.21%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMR-KDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKE 931
            DH+NR+ K    KRVVGVLLG  R K VL+++NS+AVPF+ED  DK+VWFLDHDYLE+M+ MFKKVNA+E++VGWYH+GPKL QNDI INEL RRY   SV+VI+D +PK+  GLPTEAY++++EVHDDG+ T+KTF+H+PSEIGAEEAEEVGVEHLLRDIKD+++GSLSQ+I NQLMGL+GL A L +I  YL  V +  +P+N+ I+Y LQDIFNLLPD+  D    + Y+KTNDQMLV+Y+ASM+RSI+ALH+LI NKL NR+ E
Sbjct:   23 DHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDL-GLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVYLASMVRSIIALHNLINNKLANRDAE 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Fly
Match: CSN6 (gene:FBgn0028837 transcript:FBtr0084265)

HSP 1 Score: 60.8474 bits (146), Expect = 4.667e-10
Identity = 65/271 (23.99%), Postives = 124/271 (45.76%), Query Frame = 2
Query:  131 DHYNRLSKASGSKR-VVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLA-IDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSS--IGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLIT--NKLTNRE 925
            +H+ R     G  R V G L+G  +   +EI NS+ +  +  +GD+ V  ++ DY       +K+V +    +GWY +G     +DIKI       N C +M+ ++   +  D LP + + + ID V  + T+    F  +   +  EEAE +GV+H+ R   + S     +++ +  Q   ++ L   +  +  Y+  V    +  N  IL     + + LP + +    +  Y + ND  L+ Y+ ++ +    +H  +   N L +R+
Sbjct:   66 EHWTRFRAQHGEPRQVYGALIGKQKGRNIEIMNSFELKTDV-IGDETV--INKDYYNKKEQQYKQVFSDLDFIGWYTTGDNPTADDIKIQRQIAAINECPIMLQLNPLSRSVDHLPLKLFESLIDLVDGEATM---LFVPLTYTLATEEAERIGVDHVARMTSNESGEKSVVAEHLVAQDSAIKMLNTRIKIVLQYIRDVEAGKLRANQEILREAYALCHRLPVMQVPAFQEEFYTQCNDVGLISYLGTLTKGCNDMHHFVNKFNMLYDRQ 330          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Fly
Match: eIF3f1 (gene:FBgn0037270 transcript:FBtr0078892)

HSP 1 Score: 60.077 bits (144), Expect = 6.152e-10
Identity = 43/143 (30.07%), Postives = 73/143 (51.05%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEI 559
            D + R  + + S RV+G LLG + K V+E+TN + VP +E   D  V   +  Y   M+ + +KVN+ E +VGW+ +G  +  +   I+E + R  +  V + VD    +   +   AY+ I ++   G  +   F  IP E+
Sbjct:   20 DAFER--RNADSHRVIGTLLGSVDKGVVEVTNCFCVPHKEH--DDQVE-AELSYALDMYDLNRKVNSNESVVGWWATGNDVTNHSSVIHEYYARECNNPVHLTVDTS-LQGGRMGLRAYVCI-QLGVPGGKSGCMFTPIPVEL 155          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Zebrafish
Match: psmd7 (proteasome 26S subunit, non-ATPase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5541])

HSP 1 Score: 343.199 bits (879), Expect = 4.228e-117
Identity = 171/270 (63.33%), Postives = 224/270 (82.96%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTE 940
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL ++Y   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V    +P+N+ I+Y LQD+FNLLPDV L + +K+ Y+KTNDQMLV+Y+AS+IRS++ALH+LI NK+ NR+ E  E
Sbjct:   21 DHFNRIGKVGSQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKQYCSNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIKSYLEKVATGKLPINHQIIYQLQDVFNLLPDVNLQEFVKAFYLKTNDQMLVVYLASLIRSVVALHNLINNKIANRDAEKKE 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Zebrafish
Match: psmd7 (proteasome 26S subunit, non-ATPase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5541])

HSP 1 Score: 326.635 bits (836), Expect = 3.470e-110
Identity = 171/300 (57.00%), Postives = 224/300 (74.67%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHD------------------------------DGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTE 940
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL ++Y   SV+VI+DV+PK+  GLPTEAY++++EVHD                              DGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V    +P+N+ I+Y LQD+FNLLPDV L + +K+ Y+KTNDQMLV+Y+AS+IRS++ALH+LI NK+ NR+ E  E
Sbjct:   21 DHFNRIGKVGSQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKQYCSNSVLVIIDVKPKDL-GLPTEAYISVEEVHDVSFSCISYMFKVICIDLICLMLTVMHFLLQDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIKSYLEKVATGKLPINHQIIYQLQDVFNLLPDVNLQEFVKAFYLKTNDQMLVVYLASLIRSVVALHNLINNKIANRDAEKKE 319          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Zebrafish
Match: eif3f (eukaryotic translation initiation factor 3, subunit F [Source:ZFIN;Acc:ZDB-GENE-100215-2])

HSP 1 Score: 70.4774 bits (171), Expect = 2.173e-13
Identity = 65/258 (25.19%), Postives = 129/258 (50.00%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKN--QLMGLEG-LKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHD 895
            D Y R  +  G+ RV+G LLG   K  +++TN ++VP  E   +  V   D ++ ++M+ + KKV+  E IVGWY +G  + ++ + I+E + R     + + VD    +S+ +   AY++  ++   G      F  +  +    + E +GV+ L R    +S G  +    +  Q+ G  G ++  L  +  Y+  V++  +  + S+   L D+ N +P +  +D         ND ++V Y+A++ ++ +AL++
Sbjct:   29 DSYER--RNEGASRVIGTLLGTADKHSVDVTNCFSVPHNESEDEVAV---DMEFAKNMYELHKKVSPSEVIVGWYATGFDITEHSVLIHEYYSREAPNPIHLTVDTA-LQSNKMNIRAYVS-SQMGVPGKTVGVMFTPLSVKYIYYDTERIGVDLLQR--TRASPGRTNGLTTDLAQVAGAAGRVQEMLATVLSYIEDVLSGKVMADNSVGRFLMDLVNKVPKIPAEDFENMLNSNINDLLMVTYLANLTQAQIALNE 277          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Xenopus
Match: nnt (nicotinamide nucleotide transhydrogenase [Source:Xenbase;Acc:XB-GENE-950270])

HSP 1 Score: 337.806 bits (865), Expect = 5.399e-115
Identity = 169/265 (63.77%), Postives = 222/265 (83.77%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNRE 925
            DH+NR+ K    KRVVGVLLG   K +L+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V +  +P+N+ I+Y LQD+FNLLPDV L + +K+ Y+KTNDQMLV+Y+AS+IRS++ALH+LI NK+ NR+
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWHKKILDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVSSGKLPINHQIIYQLQDVFNLLPDVNLQEFVKAFYLKTNDQMLVVYLASLIRSVVALHNLINNKIANRD 284          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Xenopus
Match: rabl3 (RAB, member of RAS oncogene family-like 3 [Source:Xenbase;Acc:XB-GENE-6258935])

HSP 1 Score: 72.7886 bits (177), Expect = 4.475e-14
Identity = 60/272 (22.06%), Postives = 129/272 (47.43%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKN-----------QLMGLEG--LKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITN 907
            D Y R ++ +G  RV+G LLG   K  +E+TN ++VP  E   +  V   D ++ ++M+ + KKV + E+IVGWY +G  + ++ + I+E + R     + + VD    + + +  +AY++             +   +P +        + V+++  D +   +  +++   N           Q +G+    L+  L+ +  Y   V++  +  + ++   L D+   +P +  +D         ND ++V Y+A++ +S +AL++ + N
Sbjct:   21 DSYERRNEGAG--RVIGTLLGTTDKHSVEVTNCFSVPHNESEDEVAV---DMEFAKNMYELHKKVTSTEQIVGWYATGNDITEHSVLIHEYYSREATNPIHMTVDTS-LQGNRMNIKAYIS-------------SPMGVPGKTMGVMFTPLTVQYVYYDTERIGVDLITKTCANPNRSIGLTTDLQQVGVAANRLQDSLSTVLQYAEDVLSGKVTADNTVGRFLMDLVTQVPKIDPEDFEAMLNSNINDLLMVTYLANLTQSQIALNEKLLN 273          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Xenopus
Match: rabl3 (RAB, member of RAS oncogene family-like 3 [Source:Xenbase;Acc:XB-GENE-6258935])

HSP 1 Score: 73.1738 bits (178), Expect = 5.990e-14
Identity = 60/272 (22.06%), Postives = 129/272 (47.43%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKN-----------QLMGLEG--LKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITN 907
            D Y R ++ +G  RV+G LLG   K  +E+TN ++VP  E   +  V   D ++ ++M+ + KKV + E+IVGWY +G  + ++ + I+E + R     + + VD    + + +  +AY++             +   +P +        + V+++  D +   +  +++   N           Q +G+    L+  L+ +  Y   V++  +  + ++   L D+   +P +  +D         ND ++V Y+A++ +S +AL++ + N
Sbjct:   56 DSYERRNEGAG--RVIGTLLGTTDKHSVEVTNCFSVPHNESEDEVAV---DMEFAKNMYELHKKVTSTEQIVGWYATGNDITEHSVLIHEYYSREATNPIHMTVDTS-LQGNRMNIKAYIS-------------SPMGVPGKTMGVMFTPLTVQYVYYDTERIGVDLITKTCANPNRSIGLTTDLQQVGVAANRLQDSLSTVLQYAEDVLSGKVTADNTVGRFLMDLVTQVPKIDPEDFEAMLNSNINDLLMVTYLANLTQSQIALNEKLLN 308          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Xenopus
Match: cpe (carboxypeptidase E [Source:Xenbase;Acc:XB-GENE-952270])

HSP 1 Score: 48.521 bits (114), Expect = 9.242e-6
Identity = 55/261 (21.07%), Postives = 120/261 (45.98%), Query Frame = 2
Query:  131 DHYNRLSKASGSK-RVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLA-IDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSI--GSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLI 901
            DH+ R+    G   +V+G L+G      +E+ NS+ +     + ++ +  ++ +Y  +    FK+V    + +GWY +G     +DI +++         + + ++   K +D LP   Y + ID V+ + T+      +    +  EEAE +GV+H+ R     S    ++++ +  Q   ++ L + +  I +Y+       +P N+ IL     + + LP +  D      Y + ND  L+ Y+ ++ ++   ++  +
Sbjct:   58 DHWIRMRSQEGRPVQVIGALIGKQEGRNIEVMNSFELL--SQINEEKI-TINKEYYYTKEEQFKQVFKDMEFLGWYTTGGTPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTD-LPVSVYESVIDIVNGEATMLLAELSYT---LATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVRLILEYVRAAEAGEVPFNHEILREASALCHCLPVLSTDKFKMDFYDQCNDVGLMSYLGTITKTCNTMNQFV 311          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Mouse
Match: Psmd7 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 [Source:MGI Symbol;Acc:MGI:1351511])

HSP 1 Score: 338.961 bits (868), Expect = 1.551e-115
Identity = 168/265 (63.40%), Postives = 222/265 (83.77%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNRE 925
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V +  +P+N+ I+Y LQD+FNLLPD  L + +K+ Y+KTNDQM+V+Y+AS+IRS++ALH+LI NK+ NR+
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDASLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRD 284          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Mouse
Match: Eif3f (eukaryotic translation initiation factor 3, subunit F [Source:MGI Symbol;Acc:MGI:1913335])

HSP 1 Score: 72.0182 bits (175), Expect = 1.400e-13
Identity = 62/276 (22.46%), Postives = 124/276 (44.93%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTK----TFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRI--KNQLMGLE-------GLKAH----LNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITN 907
            D Y R  +  G+ RV+G LLG + K  +E+TN ++VP  E    ++   +D ++ ++M+ + KKV+  E I+GWY +G  + ++ + I+E + R                    P   +L +D     G ++ K    T   +P          + V++   D +   +  + +     N+++GL        G  A     L+ +  Y   V++  +  + ++   L  + N +P +  DD         ND ++V Y+A++ +S +AL++ + N
Sbjct:  108 DSYER--RNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNES---EDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSRE------------------APNPIHLTVDTGLQHGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVN 360          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Mouse
Match: Cops6 (COP9 signalosome subunit 6 [Source:MGI Symbol;Acc:MGI:1349439])

HSP 1 Score: 51.6026 bits (122), Expect = 6.389e-7
Identity = 60/274 (21.90%), Postives = 126/274 (45.99%), Query Frame = 2
Query:  131 DHYNRLSKASGSK-RVVGVLLGYMRKDVLEITNSYAV---PFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLA-IDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSI--GSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLIT--NKLTNRE 925
            DH+ R+    G   +V+G L+G      +E+ NS+ +     EE +       +D +Y  +    FK+V  + + +GWY +G     +DI +++         + + ++   K +D LP   + + ID ++ + T+    F  +   +  EEAE +GV+H+ R     S    ++++ +  Q   ++ L + +  I +Y+       +P N+ IL     + + LP +  D      Y + ND  L+ Y+ ++ ++   ++  +   N L +R+
Sbjct:   23 DHWIRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKI------IIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTD-LPVSVFESVIDIINGEATM---LFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQ 286          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Mouse
Match: Cops6 (COP9 signalosome subunit 6 [Source:MGI Symbol;Acc:MGI:1349439])

HSP 1 Score: 51.2174 bits (121), Expect = 8.037e-7
Identity = 60/274 (21.90%), Postives = 126/274 (45.99%), Query Frame = 2
Query:  131 DHYNRLSKASGSK-RVVGVLLGYMRKDVLEITNSYAV---PFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLA-IDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSI--GSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLIT--NKLTNRE 925
            DH+ R+    G   +V+G L+G      +E+ NS+ +     EE +       +D +Y  +    FK+V  + + +GWY +G     +DI +++         + + ++   K +D LP   + + ID ++ + T+    F  +   +  EEAE +GV+H+ R     S    ++++ +  Q   ++ L + +  I +Y+       +P N+ IL     + + LP +  D      Y + ND  L+ Y+ ++ ++   ++  +   N L +R+
Sbjct:   50 DHWIRMRSQEGRPMQVIGALIGKQEGRNIEVMNSFELLSHTVEEKI------IIDKEYYYTKEEQFKQVFKELEFLGWYTTGGPPDPSDIHVHKQVCEIIESPLFLKLNPMTKHTD-LPVSVFESVIDIINGEATM---LFAELTYTLATEEAERIGVDHVARMTATGSGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQ 313          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. UniProt/SwissProt
Match: sp|P26270|PSMD7_DROME (26S proteasome non-ATPase regulatory subunit 7 OS=Drosophila melanogaster OX=7227 GN=Rpn8 PE=1 SV=6)

HSP 1 Score: 353.214 bits (905), Expect = 4.135e-120
Identity = 177/268 (66.04%), Postives = 223/268 (83.21%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMR-KDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKE 931
            DH+NR+ K    KRVVGVLLG  R K VL+++NS+AVPF+ED  DK+VWFLDHDYLE+M+ MFKKVNA+E++VGWYH+GPKL QNDI INEL RRY   SV+VI+D +PK+  GLPTEAY++++EVHDDG+ T+KTF+H+PSEIGAEEAEEVGVEHLLRDIKD+++GSLSQ+I NQLMGL+GL A L +I  YL  V +  +P+N+ I+Y LQDIFNLLPD+  D    + Y+KTNDQMLV+Y+ASM+RSI+ALH+LI NKL NR+ E
Sbjct:   23 DHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLENMYGMFKKVNARERVVGWYHTGPKLHQNDIAINELVRRYCPNSVLVIIDAKPKDL-GLPTEAYISVEEVHDDGSPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQKITNQLMGLKGLNAQLRDIKQYLQRVGDSKMPINHQIVYQLQDIFNLLPDITNDQFTGTMYVKTNDQMLVVYLASMVRSIIALHNLINNKLANRDAE 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. UniProt/SwissProt
Match: sp|Q3ZBD0|PSMD7_BOVIN (26S proteasome non-ATPase regulatory subunit 7 OS=Bos taurus OX=9913 GN=PSMD7 PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 3.210e-116
Identity = 171/270 (63.33%), Postives = 224/270 (82.96%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTE 940
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V    +P+N+ I+Y LQD+FNLLPDV L + +K+ Y+KTNDQM+V+Y+AS+IRS++ALH+LI NK+ NR+ E  E
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRGYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKE 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. UniProt/SwissProt
Match: sp|P51665|PSMD7_HUMAN (26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 6.520e-115
Identity = 169/265 (63.77%), Postives = 222/265 (83.77%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNRE 925
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V    +P+N+ I+Y LQD+FNLLPDV L + +K+ Y+KTNDQM+V+Y+AS+IRS++ALH+LI NK+ NR+
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRD 284          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. UniProt/SwissProt
Match: sp|P26516|PSMD7_MOUSE (26S proteasome non-ATPase regulatory subunit 7 OS=Mus musculus OX=10090 GN=Psmd7 PE=1 SV=2)

HSP 1 Score: 338.961 bits (868), Expect = 1.085e-114
Identity = 168/265 (63.40%), Postives = 222/265 (83.77%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNRE 925
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V +  +P+N+ I+Y LQD+FNLLPD  L + +K+ Y+KTNDQM+V+Y+AS+IRS++ALH+LI NK+ NR+
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVASGKLPINHQIIYQLQDVFNLLPDASLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRD 284          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. UniProt/SwissProt
Match: sp|O24412|PSD7A_ARATH (26S proteasome non-ATPase regulatory subunit 7 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPN8A PE=1 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 2.136e-99
Identity = 150/272 (55.15%), Postives = 211/272 (77.57%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTL-TTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEE 943
            DHYNR++K S SKRVVGVLLG   + V+++TNSYAVPFEED  D ++WFLDH+Y ESMF MFK++NAKE +VGWY +GPKL++ND+ ++ LF  Y    V+VI+DV+PKE  G+PT+AY A++EV ++ T  + K F H+ +EI A E EE+GVEHLLRD+KD++I +L+  +  +L  L+GL A L EI  YL LV+   +PLN+ ILYHLQD+FNLLP++ +++++K+  +KTND MLV+Y++S+IRS++ALH+LI NKL N+E E  E+
Sbjct:   29 DHYNRVAKDS-SKRVVGVLLGSSSRGVVDVTNSYAVPFEEDDKDPSIWFLDHNYHESMFHMFKRINAKEHVVGWYSTGPKLRENDLDVHALFNGYVPNPVLVIIDVQPKEL-GIPTKAYYAVEEVKENATQKSQKVFVHVSTEIAAHEVEEIGVEHLLRDVKDTTISTLATEVTAKLTALKGLDARLREIRSYLDLVIEGKLPLNHEILYHLQDVFNLLPNLNVNELVKAFSVKTNDMMLVIYLSSLIRSVIALHNLINNKLLNKEHEKAED 298          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. TrEMBL
Match: K1Q9Z6 (26S proteasome non-ATPase regulatory subunit 7 OS=Crassostrea gigas OX=29159 GN=CGI_10009677 PE=4 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 7.238e-128
Identity = 202/294 (68.71%), Postives = 251/294 (85.37%), Query Frame = 2
Query:   68 VNDSSKISKXXXXXXXXXXXXDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMD 949
            V D +KI+KVVVHPLVLLSVVDH+NR+ K   +KRVVGVLLG  R+ +L+++NS+AVPF+ED  DK VWFLDHDYLESM+SMFKKVNA+E+IVGWYH+GPKL QND+ INEL R+Y   SV+V++D +PK+  GLPTEAY+A++EVHDDGT TTKTF H+PSEIGAEEAEEVGVEHLLRDIKD+++GSLSQRI NQLMGL+GL AH+N+I  YL  V +K +P+N+ I+Y LQD+FNLLPDV L D +KS Y+KTNDQMLV+Y+AS+IRSI+ALH+LI+NK+ NR+ E  E  D
Sbjct:    3 VTDPNKITKVVVHPLVLLSVVDHFNRMGKVGNAKRVVGVLLGSNRQGILDVSNSFAVPFDEDDKDKTVWFLDHDYLESMYSMFKKVNARERIVGWYHTGPKLHQNDVAINELLRKYCPNSVLVVIDAKPKDL-GLPTEAYIAVEEVHDDGTPTTKTFDHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQRITNQLMGLKGLHAHVNDINSYLQKVTSKQLPVNHQIVYQLQDVFNLLPDVNLQDFVKSVYVKTNDQMLVVYLASLIRSIIALHNLISNKIQNRDAEKNEGKD 295          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. TrEMBL
Match: A0A0R3TJL0 (MPN domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7274 PE=4 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.717e-126
Identity = 204/313 (65.18%), Postives = 252/313 (80.51%), Query Frame = 2
Query:   41 SNLSQISKTVNDSSKISKXXXXXXXXXXXXDHYNRLSKASGS-KRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSV 976
            +N   I     +  KISKV VHPLVLL VVDH+NR+ K SG  KRVVGVLLG +R  +L+++N +AVPFEEDL D NVWFLDHDYLE+MF+MFKKVNA+E+IVGWYHSGPKL  NDIKINELFR+Y   SV+V+VDV+  ESDG+PTEAY+A++EVHDDGT TTKTF H+ SEIGAEEAEEVGVEHLLRDIKDSS+GSL+QRI  +L GL G+   L+EI++YL LV +K +P+NY ++Y LQD+FNLLPDV L DM++S  + +NDQML +Y+A ++R+ILALHDLI NKL NRE E  E+  KK+  SV+ 
Sbjct:    4 ANPDPIKVKKTEHPKISKVTVHPLVLLGVVDHFNRVGKISGGQKRVVGVLLGALRGSILDVSNCFAVPFEEDLADPNVWFLDHDYLENMFAMFKKVNARERIVGWYHSGPKLCTNDIKINELFRKYTPNSVLVVVDVKTNESDGIPTEAYIAVEEVHDDGTPTTKTFDHLLSEIGAEEAEEVGVEHLLRDIKDSSLGSLTQRINAKLAGLCGMLHQLDEIHNYLQLVTSKQLPINYQVMYKLQDMFNLLPDVELSDMVRSLNMTSNDQMLNIYVACVMRAILALHDLINNKLANRESERNEDEGKKVPKSVAA 316          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. TrEMBL
Match: A0A210QH02 (26S proteasome non-ATPase regulatory subunit 7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13924 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 5.987e-126
Identity = 199/292 (68.15%), Postives = 249/292 (85.27%), Query Frame = 2
Query:   74 DSSKISKXXXXXXXXXXXXDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMD 949
            D SKISKVVVHPLVLLSVVDH+NR+ K    KRVVGVLLG  R+ VL+++NS+AVPF+ED  DK+VWFLDHDYLESM+ MFKKVNA+EK+VGWYH+GPKL QND+ INEL RRY   SV+V++D +PK+  GLPTEAY++++EVHDDGT T+KTF H+PSEIGAEEAEEVGVEHLLRDIKD+++GSLSQRI NQLMGL+GL +H+ +I +YL  V ++ +P+N+ I+Y LQD+FNLLPD+ L D +KS Y+KTNDQMLV+Y+AS+IRS++ALH+LI NKL NRE E +E  D
Sbjct:    5 DPSKISKVVVHPLVLLSVVDHFNRMGKVGNVKRVVGVLLGSNRQGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLESMYGMFKKVNAREKVVGWYHTGPKLDQNDVAINELIRRYCPNSVLVVIDAKPKDL-GLPTEAYISVEEVHDDGTPTSKTFDHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQRITNQLMGLKGLHSHITDINNYLQKVTSQQLPVNHQIIYQLQDVFNLLPDINLQDFVKSVYVKTNDQMLVVYLASLIRSVIALHNLIGNKLQNREAEKSEVKD 295          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. TrEMBL
Match: A0A0R3SAR5 (MPN domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1471 PE=4 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 3.929e-125
Identity = 204/311 (65.59%), Postives = 254/311 (81.67%), Query Frame = 2
Query:   41 SNLSQISKTVNDSSKISKXXXXXXXXXXXXDHYNRLSKASGS-KRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSV 970
            SN+ ++ K   +  KISKV VHPLVLL VVDH+NR+ K SG  KRVVGVLLG +R  VL+++N +AVPFEEDL D NVWFLDHDYLE+MF+MFKKVNA+E+IVGWYHSGPKL  NDIKINELFR+Y   SV+V+VDV+  ESDG+PTEAY+A++EVHDDGT TTKTF H+ SEIGAEEAEEVGVEHLLRDIKDSS+GSL+QRI  +L GL G+   L+EI++YL LV +K +P+N+ ++Y LQD+FNLLPDV ++DMI+S  + +NDQML +Y+A ++R+ILALHDLI NKL NRE E  E+  KK+   V
Sbjct:   12 SNVIKVKKP--EHPKISKVTVHPLVLLGVVDHFNRVGKISGGQKRVVGVLLGALRGSVLDVSNCFAVPFEEDLTDPNVWFLDHDYLENMFAMFKKVNARERIVGWYHSGPKLYTNDIKINELFRKYTPNSVLVVVDVKTNESDGIPTEAYIAVEEVHDDGTPTTKTFDHLLSEIGAEEAEEVGVEHLLRDIKDSSLGSLTQRIDAKLGGLSGMLRQLDEIHNYLQLVTSKQLPINHQVMYKLQDMFNLLPDVGMNDMIRSLNMTSNDQMLNIYVACVMRAILALHDLINNKLANRESERNEDEGKKVSKPV 320          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. TrEMBL
Match: U6JFN5 (26S proteasome non-ATPase regulatory subunit 7 OS=Echinococcus granulosus OX=6210 GN=EGR_04682 PE=4 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 2.109e-124
Identity = 201/295 (68.14%), Postives = 243/295 (82.37%), Query Frame = 2
Query:   74 DSSKISKXXXXXXXXXXXXDHYNRLSKASGS-KRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKK 955
            D  KISKV VHPLVLL VVDH+NR+ K SG  KRVVGVLLG +R   L+++N +AVPFEEDL D NVWFLD+DYLE+MFSMFKKVNA+E+IVGWYHSGPKL  NDIKINELFR+Y   SV+V+VDV+  ESDG+PTEAY+A++EVHDDGT TTKTF H+ SEIGAEEAEEVGVEHLLRDIKDSS+GSL+QRI  ++ GL G+   L EI +YL LV  K IP+N+ ++Y LQD+FNLLPDV L DM++S  + +NDQMLV+Y+AS++R++LALHDLI NKL NRE E  E+  KK
Sbjct:   15 DHPKISKVTVHPLVLLGVVDHFNRVGKISGGQKRVVGVLLGALRGSTLDVSNCFAVPFEEDLTDPNVWFLDNDYLENMFSMFKKVNARERIVGWYHSGPKLCTNDIKINELFRKYTSNSVLVVVDVKTNESDGIPTEAYIAVEEVHDDGTPTTKTFDHLLSEIGAEEAEEVGVEHLLRDIKDSSLGSLTQRIDAKISGLSGMLRQLEEIQEYLQLVTTKQIPINHQVMYKLQDMFNLLPDVRLQDMVRSLNMTSNDQMLVIYVASVMRAVLALHDLINNKLANRESERNEDEGKK 309          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Cavefish
Match: psmd7 (proteasome 26S subunit, non-ATPase 7 [Source:NCBI gene;Acc:103042519])

HSP 1 Score: 343.584 bits (880), Expect = 2.707e-117
Identity = 172/270 (63.70%), Postives = 224/270 (82.96%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTE 940
            DH+NR+ K    KRVVGVLLG  +K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL ++Y   SV+VI+DV+PK+  GLPTEAY++++EVHDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V    +P+N+ I+Y LQD+FNLLPDV L + IK+ Y+KTNDQMLV+Y+AS+IRS++ALH+LI NK+ NR+ E  E
Sbjct:   21 DHFNRIGKVGSQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKQYCSNSVLVIIDVKPKDL-GLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIKSYLEKVATGKLPINHQIIYQLQDVFNLLPDVNLQEFIKAFYLKTNDQMLVVYLASLIRSVVALHNLINNKIANRDAEKKE 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Cavefish
Match: eif3f (eukaryotic translation initiation factor 3 subunit F [Source:NCBI gene;Acc:103028840])

HSP 1 Score: 74.7146 bits (182), Expect = 6.378e-15
Identity = 64/267 (23.97%), Postives = 127/267 (47.57%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTL----TTKTFKHIPSE--------IXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHD 895
            D Y R  +  G+ RV+G LLG + K  +E+TN ++VP  E   +  V   D ++ ++M+ + KKV+  E I+GWY +G  + ++ + I+E + R     + + VD    +S+ +   AY++        T+    T  T K++  +        +    A       L  D+  + +GS + RI+            L  +  Y+  V++  +  + S+  +L D+ N +P +  +D         ND ++V Y+A++ ++ +AL++
Sbjct:   20 DSYER--RNEGASRVIGTLLGTIDKHSVEVTNCFSVPHNESEDEVAV---DMEFAKNMYELHKKVSPSEVIIGWYATGYDITEHSVLIHEYYSREAQNPIHLTVDTA-LQSNKMNIRAYVSAQMGVPGKTVGVMFTPLTVKYVYYDTERIGVDLLQRTRASPNRTNGLTSDL--AQVGSAAGRIQEM----------LTTVLAYIEDVLSGKVMADNSVGRYLMDLVNKVPKIPAEDFESMLNSNINDLLMVTYLANLTQAQIALNE 268          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Cavefish
Match: COPS6 (COP9 signalosome subunit 6 [Source:HGNC Symbol;Acc:HGNC:21749])

HSP 1 Score: 56.225 bits (134), Expect = 1.391e-8
Identity = 61/262 (23.28%), Postives = 126/262 (48.09%), Query Frame = 2
Query:  131 DHYNRLSKASG-SKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLA-IDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIG---SLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLI 901
            DH+ RL    G + +V+G L+G      +E+ NS+ + F     D+ +  +D +Y  +    FK+V    + +GWY +G    Q+DI I++         + + ++   K +D LP   + + ID ++ + T+    F  +   +  EEAE +GV+H+ R +  +  G   ++++ +  Q   ++ L + +  I +Y+  V    +P N+ IL     + + LP +         Y + ND  L+ Y+ ++ ++  +++  I
Sbjct:   23 DHWIRLRSQEGRAMQVIGALIGKQEGRNIEVMNSFELLFHTT--DERI-HIDKEYYYTKEEQFKQVFKDMEFLGWYTTGGPPDQSDIHIHKQVCEIIESPLFLKLNPMTKHTD-LPVSVFESVIDIINGEATM---LFAELTYTLATEEAERIGVDHVAR-MTATGTGENSTVAEHLIAQHSAIKMLHSRVKLILEYVKAVEAGEVPFNHEILREANALCHRLPVLSTLKFKTDFYDQCNDVGLMAYLGTITKTCNSMNQFI 276          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Sea Lamprey
Match: psmd7 (proteasome 26S subunit, non-ATPase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5541])

HSP 1 Score: 352.829 bits (904), Expect = 1.138e-121
Identity = 178/275 (64.73%), Postives = 227/275 (82.55%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKK 955
            DH+NR+ K    KRVVGVLLG   K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY   SV+VI+D +PK+  GLPTEAY+A++EVHDDGT T+KTF+H+PSEIGAEEAEEVGVEHLLRDIKD+++GSLSQRI NQ+ GL GL++ L +I  YL  V   ++P+N+ I+Y LQD+FNLLPDV L + IKS Y+KTNDQMLV+Y+A++IRS++ALH+LI NKL NRE E  E  +K+
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWYKGVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCSNSVLVIIDAKPKDL-GLPTEAYIAVEEVHDDGTPTSKTFEHVPSEIGAEEAEEVGVEHLLRDIKDTTVGSLSQRITNQVHGLRGLQSRLGDIRTYLDRVAAGSMPINHQIVYQLQDVFNLLPDVDLREFIKSFYLKTNDQMLVVYLAALIRSVVALHNLINNKLANREAERKEGQEKE 294          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Sea Lamprey
Match: eif3f (eukaryotic translation initiation factor 3, subunit F [Source:ZFIN;Acc:ZDB-GENE-100215-2])

HSP 1 Score: 69.3218 bits (168), Expect = 1.221e-13
Identity = 68/273 (24.91%), Postives = 130/273 (47.62%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGT-------LTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVM--------NKNIPLNYSILYHLQDIFNLLPDVFLDD---MIKSQYIKTNDQMLVLYMASMIRSILALHD 895
            D Y R  +   +KRV+G LLG + K  +E+TN ++VP  E   +  V   D ++ ++M+ + KKV   E+IVGWY +G  + ++ + I+E + R     + + +D   +  + +  +AY++        T       L+ K   + P  I            +++  +     S ++R  +    L  + A   +I D L+LV+         K +P N ++   L D+ N +P +  +D   MI S     ND ++V Y++++ ++ LAL++
Sbjct:   35 DSYER--RNEDAKRVIGTLLGTVDKQNVEVTNCFSVPHNESEDEVAV---DMEFAKNMYELHKKVTPNEQIVGWYATGYDITEHSVLIHEYYSRETQNPIHLTIDTTLRGGN-MSIKAYVSASMGAPGKTMGVMFTPLSVKYEYYDPERI---------GVEIIQRTR-----SNNKRTVSMTSELTQVGAAAAQIQDMLTLVLQYVEDVLSGKVVPDN-TVGRFLMDLVNKVPKLAPEDFEAMINSN---INDLLMVTYLSNLTKAQLALNE 283          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Yeast
Match: RPN8 (Essential non-ATPase regulatory subunit of the 26S proteasome; has similarity to the human p40 proteasomal subunit and to another S. cerevisiae regulatory subunit, Rpn11p [Source:SGD;Acc:S000005787])

HSP 1 Score: 267.7 bits (683), Expect = 2.602e-88
Identity = 141/293 (48.12%), Postives = 211/293 (72.01%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCS-VMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDD-----------------MIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKK 955
            DHY R ++   +KR VGV+LG      + +TNS+A+PFEED  + +VWFLDH+Y+E+M  M KK+NAKEK++GWYHSGPKL+ +D+KINELF++Y   + +++IVDV+ ++  GLPT+AY+AI++V DDGT T KTF H+P  I AEEAEE+GVEHLLRD++D + G LS R+ NQL  L+GL++ L ++ +YL  V+NK +P+N++IL  LQD+FNLLP++   D                 + K+  +KTND+++V+Y+++++RSI+A  DLI NK+ N++ +     DK+
Sbjct:   20 DHYER-TQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVK-QQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKDKQ 310          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Nematostella
Match: EDO45776 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRK5])

HSP 1 Score: 349.362 bits (895), Expect = 6.379e-120
Identity = 175/270 (64.81%), Postives = 224/270 (82.96%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTE 940
            DH+NR+ K    KRVVGVLLG  RK VL++ N +AVPF+ED  D+NVWFLDHDYLE+M++MFKKVNA+E+IVGWYH+GPKL +ND+ INEL RRY   SV+VI+D +PK+   LPT+AY+A++EVHDDGT TTKTF+HIPSEIGAEEAEEVGVEHLLRDIK+ + G+LSQRI NQL  L+GL A L +I DYL  V  K +P+N++I+Y LQD+FNLLP++ ++D  K+  +KTNDQMLV+Y+AS+IRSI+ALH+LI+NK+TNR+ E  E
Sbjct:   23 DHFNRMGKVGSQKRVVGVLLGSRRKGVLDVANCFAVPFDEDDRDQNVWFLDHDYLENMYAMFKKVNARERIVGWYHTGPKLHRNDVVINELIRRYCSNSVLVIIDAKPKDL-RLPTDAYVAVEEVHDDGTPTTKTFEHIPSEIGAEEAEEVGVEHLLRDIKNLTAGTLSQRITNQLTSLKGLHARLGDIRDYLEKVATKKLPVNHTIIYELQDVFNLLPNLDIEDFCKAVTVKTNDQMLVVYVASLIRSIIALHNLISNKVTNRDAEKDE 291          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Nematostella
Match: EDO36347 (Eukaryotic translation initiation factor 3 subunit F [Source:UniProtKB/TrEMBL;Acc:A7SIV6])

HSP 1 Score: 73.9442 bits (180), Expect = 4.655e-15
Identity = 64/247 (25.91%), Postives = 119/247 (48.18%), Query Frame = 2
Query:  164 SKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLP--TEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIG-SLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHD 895
            +KRV+G LLG + K V+EI + + VP  E   +  V     +Y +SM+ + +K N  E+IVGWY +G  + ++ + I+E + R  +  V + VD   K   GL    + Y ++ ++   G      F  IP E+     E+VGV+ L R         SL   +++     + L   L  +  Y+  V+  ++P +  +   L    N +P +  ++          D ++++Y++S+ ++ LAL +
Sbjct:   29 AKRVIGTLLGTVDKGVVEIRSCFGVPHNESADEVAVEL---EYAKSMYELSQKANPNEQIVGWYATGSDVTEHSLLIHEYYSRETNNPVHMTVDTTLK---GLKMGIKTYQSV-KMGVPGKTEGTMFSQIPCEVKLTGPEKVGVDVLQRTKSTPKKAVSLISDMQHVTGATDRLLEMLETVITYVEEVLAGSVPADNVVGRDLTSFVNSVPKMTAEEFEAMLNSNMQDLLMIVYLSSLCKTQLALGE 268          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Nematostella
Match: EDO35377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLN0])

HSP 1 Score: 67.3958 bits (163), Expect = 9.406e-13
Identity = 71/270 (26.30%), Postives = 127/270 (47.04%), Query Frame = 2
Query:  131 DHYNRLSKASG--SKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYL----ESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLA-IDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSI--GSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLP----DVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLI 901
            +HY R+    G  + +VVG LLG      +EI NS+ + F  D  D     ++ +Y     E    +F++V      +GWY +G   + +D+ I++     N   + + ++   + +D LP   Y + ID V+ +   T   F  IP  +  EEAE +GV+H+ R     ++   ++S  +  Q   ++ L A +  I +Y+  V     P N+ I+     +   LP    D+F  D     Y + ND ML+ Y+A++ +   +L++ I
Sbjct:   35 EHYTRIRAQEGKPNPQVVGALLGTQDGRSMEIFNSFELQF--DSFDDGHIVINMEYYKTKEEQCKDIFRQVFKNLDFLGWYTTGSGAQGSDLGIHKQICEINESPIFLKLNPLARTND-LPISMYESVIDLVNGE---TRMLFVEIPYTLATEEAERIGVDHVARLSSSGTVDGATVSDHLLAQYNAIKMLHARVKMIMEYVKAVKAGEAPCNHEIMRDALSLCQRLPVMKTDIFKGDF----YDQCNDVMLMCYLATVTKGCNSLNEFI 294          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Medaka
Match: psmd7 (proteasome 26S subunit, non-ATPase 7 [Source:NCBI gene;Acc:101161802])

HSP 1 Score: 340.117 bits (871), Expect = 4.703e-116
Identity = 171/270 (63.33%), Postives = 224/270 (82.96%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTE 940
            DH+NR+ K    KRVVGVLLG   K VL+++NS+AVPF+ED  D +VWFLDHDYLE+M+ MFKKVNA+E+IVGWYH+GPKL +NDI INEL +RY + SV+VI+DV+PK+  GLPTEAY++++E+HDDGT T+KTF+H+ SEIGAEEAEEVGVEHLLRDIKD+++G+LSQRI NQ+ GL+GL + L +I  YL  V    +P+N+ I+Y LQD+FNLLPDV L +  K+ Y+KTNDQMLV+Y+AS+IRS++ALH+LI NK++NR+ E  E
Sbjct:   21 DHFNRIGKVGNQKRVVGVLLGSWHKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELIKRYCNNSVLVIIDVKPKDL-GLPTEAYISVEEIHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLERVAAGKLPINHQIIYQLQDVFNLLPDVNLLEFTKAFYLKTNDQMLVVYLASLIRSVVALHNLINNKISNRDAEKKE 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Medaka
Match: eif3f (eukaryotic translation initiation factor 3 subunit F [Source:NCBI gene;Acc:101160586])

HSP 1 Score: 78.5666 bits (192), Expect = 3.087e-16
Identity = 67/263 (25.48%), Postives = 127/263 (48.29%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTL----TTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAH----LNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHD 895
            D Y R  +  G+ RV+G LLG + K  +E+TN ++VP  E   +  V   D ++ ++M+ + K+V+  E I+GWY +G  + ++ + I+E + R     + + VD    +S  +   AYL+        T+    T  T K+I          E     LL+  +D+   S S+ + + L  + G  A     L  +  Y+  V++  +  + S+   L D+ N +P +  +D         ND ++V Y++++ ++ +ALH+
Sbjct:   20 DSYER--RNEGASRVIGTLLGTVDKHSIEVTNCFSVPHNESEDEVAV---DMEFAKNMYELHKRVSPTEVIIGWYATGFDITEHSVLIHEYYSREASNPIHLTVDTA-LQSGKMNIRAYLSAQMGVPGKTVGVMFTPLTVKYI------YYDTERIGVDLLQRTRDAP--SRSKGLTSDLSQVGGAAARVQDMLTTVLAYIDDVLSGKVAADNSVGRFLTDLVNKVPTIPPEDFENMLNSNINDLLMVTYLSNLTQAQIALHE 268          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Medaka
Match: COPS6 (COP9 signalosome subunit 6 [Source:NCBI gene;Acc:101166310])

HSP 1 Score: 54.299 bits (129), Expect = 8.259e-8
Identity = 64/272 (23.53%), Postives = 128/272 (47.06%), Query Frame = 2
Query:  131 DHYNRLSKASGSK-RVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLA-IDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIG---SLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLIT--NKLTNRE 925
            DH+ R+    G   +V+G L+G      +E+ NS+ +     + DK    +D +Y  +    FK+V    + +GWY +G    Q+DI I++         + + ++   K +D LP   Y + ID +  + T+    F  +   +  EEAE +GV+H+ R +  +  G   ++++ +  Q   ++ L + +  I +Y+  V    +P N+ IL     + + LP +         Y + ND  L+ Y+ ++ ++  +++  I   N L +R+
Sbjct:   94 DHWIRIRSQEGRPMQVIGALIGKQEGRNIEVMNSFEL-MSHTIDDKV--HIDKEYYYTKEEQFKQVFKDMEFLGWYTTGGPPDQSDIHIHKQVCEIIESPLFLKLNPMTKHTD-LPVSVYESVIDIISGEATM---LFAELTYTLATEEAERIGVDHVAR-MTATGTGENSTVAEHLIAQHSAIKMLHSRVKIILEYVKAVEAGEVPFNHEILREANALCHRLPVLSTIKFKTDFYDQCNDVGLMAYLGTITKTCNSMNQFINKFNVLYDRQ 357          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Medaka
Match: COPS6 (COP9 signalosome subunit 6 [Source:NCBI gene;Acc:101166310])

HSP 1 Score: 51.2174 bits (121), Expect = 6.928e-7
Identity = 59/259 (22.78%), Postives = 119/259 (45.95%), Query Frame = 2
Query:  131 DHYNRLSKASGSK-RVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLA-IDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLI 901
            DH+ R+    G   +V+G L+G      +E+ NS+ +     + DK    +D +Y  +    FK+V    + +GWY +G    Q+DI I++         + + ++   K +D LP   Y + ID +  + T+    F  +   +  EEAE +GV+H+ R    ++ G+         +GL+     ++  +  +   M++ +P N+ IL     + + LP +         Y + ND  L+ Y+ ++ ++  +++  I
Sbjct:   42 DHWIRIRSQEGRPMQVIGALIGKQEGRNIEVMNSFEL-MSHTIDDK--VHIDKEYYYTKEEQFKQVFKDMEFLGWYTTGGPPDQSDIHIHKQVCEIIESPLFLKLNPMTKHTD-LPVSVYESVIDIISGEATM---LFAELTYTLATEEAERIGVDHVAR---MTATGTGENSTGEGGLGLQQTHNSIHVCHGTVRF-MSREVPFNHEILREANALCHRLPVLSTIKFKTDFYDQCNDVGLMAYLGTITKTCNSMNQFI 289          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Planmine SMEST
Match: SMESG000004074.1 (SMESG000004074.1)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 315/315 (100.00%), Postives = 315/315 (100.00%), Query Frame = 2
Query:   38 MSNLSQISKTVNDSSKISKXXXXXXXXXXXXDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS 982
            MSNLSQISKTVNDSSKISKVVVHPLVLLSVVDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIGAEEAEEVGVEHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS
Sbjct:    1 MSNLSQISKTVNDSSKISKVVVHPLVLLSVVDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIGAEEAEEVGVEHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS 315          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Planmine SMEST
Match: SMESG000004091.1 (SMESG000004091.1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 315/330 (95.45%), Postives = 315/330 (95.45%), Query Frame = 2
Query:   38 MSNLSQISKTVNDSSKISKXXXXXXXXXXXXDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYA---------------VPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS 982
            MSNLSQISKTVNDSSKISKVVVHPLVLLSVVDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYA               VPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIGAEEAEEVGVEHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS
Sbjct:    4 MSNLSQISKTVNDSSKISKVVVHPLVLLSVVDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAGKKNNINLNFYSSNLVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIGAEEAEEVGVEHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS 333          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Planmine SMEST
Match: SMESG000004091.1 (SMESG000004091.1)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 315/330 (95.45%), Postives = 315/330 (95.45%), Query Frame = 2
Query:   38 MSNLSQISKTVNDSSKISKXXXXXXXXXXXXDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYA---------------VPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS 982
            MSNLSQISKTVNDSSKISKVVVHPLVLLSVVDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYA               VPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIGAEEAEEVGVEHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS
Sbjct:    1 MSNLSQISKTVNDSSKISKVVVHPLVLLSVVDHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAGKKNNINLNFYSSNLVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIGAEEAEEVGVEHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVKS 330          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Planmine SMEST
Match: SMESG000030216.1 (SMESG000030216.1)

HSP 1 Score: 465.692 bits (1197), Expect = 4.776e-166
Identity = 232/283 (81.98%), Postives = 262/283 (92.58%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIXXXXXXXXXXXHLLRDIKDSSIGSLSQRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLPDVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENTEEMDKKIDHSVSVK 979
            DHY+RLSK++G KRVVGV+LG+MRK+VLEITNS+AVPFEED+GDK+VWF+DHDYLE+MF MFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYN  SVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIGAEE+EEVGVEHLLRDIKDSSIGSL+Q+I+NQL+GL GLKA+LNEI+DYLSLVM+K IP+NY I+YHLQD+ N LPD+   DMIKSQYIK NDQMLVLY+ S+IR+IL+LHDLI NKLTNREKE  EE DKK D ++ +K
Sbjct:   22 DHYSRLSKSAGIKRVVGVILGFMRKNVLEITNSFAVPFEEDIGDKDVWFMDHDYLENMFGMFKKVNAKEKIVGWYHSGPKLKQNDIKINELFRRYNSNSVMVIVDVEPKESDGLPTEAYLAIDEVHDDGTLTTKTFKHIPSEIGAEESEEVGVEHLLRDIKDSSIGSLAQKIQNQLLGLRGLKANLNEIFDYLSLVMDKRIPINYQIIYHLQDMLNFLPDISFKDMIKSQYIKVNDQMLVLYIGSLIRAILSLHDLIVNKLTNREKEIKEETDKKGDQNILIK 304          
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Planmine SMEST
Match: SMESG000005863.1 (SMESG000005863.1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.134e-9
Identity = 32/81 (39.51%), Postives = 48/81 (59.26%), Query Frame = 2
Query:  131 DHYNRLSKASGSKRVVGVLLGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKEKIVGWYHSGPKL 373
            D + R S  +   RV+G LLGY     + +TNS+AVP  E+  D  V F+  ++ ++M  +  KVN  EKIVGWY +G ++
Sbjct:   19 DAFERRSDVNS--RVIGTLLGYTDSRDIHVTNSFAVPHTEN--DTEV-FMSIEFNQTMIGLNGKVNPSEKIVGWYSTGSEI 94          
The following BLAST results are available for this feature:
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMD71.358e-11563.77proteasome 26S subunit, non-ATPase 7 [Source:HGNC ... [more]
PSMD71.578e-6765.68proteasome 26S subunit, non-ATPase 7 [Source:HGNC ... [more]
PSMD71.049e-6668.99proteasome 26S subunit, non-ATPase 7 [Source:HGNC ... [more]
EIF3F9.054e-1422.46eukaryotic translation initiation factor 3 subunit... [more]
EIF3F9.054e-1422.46eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpn-83.491e-10559.19Proteasome Regulatory Particle, Non-ATPase-like [... [more]
eif-3.F1.988e-833.33Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpn84.125e-12166.04gene:FBgn0002787 transcript:FBtr0332921[more]
Rpn84.125e-12166.04gene:FBgn0002787 transcript:FBtr0072290[more]
Rpn88.618e-12166.04gene:FBgn0002787 transcript:FBtr0330237[more]
CSN64.667e-1023.99gene:FBgn0028837 transcript:FBtr0084265[more]
eIF3f16.152e-1030.07gene:FBgn0037270 transcript:FBtr0078892[more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
psmd74.228e-11763.33proteasome 26S subunit, non-ATPase 7 [Source:ZFIN;... [more]
psmd73.470e-11057.00proteasome 26S subunit, non-ATPase 7 [Source:ZFIN;... [more]
eif3f2.173e-1325.19eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nnt5.399e-11563.77nicotinamide nucleotide transhydrogenase [Source:X... [more]
rabl34.475e-1422.06RAB, member of RAS oncogene family-like 3 [Source:... [more]
rabl35.990e-1422.06RAB, member of RAS oncogene family-like 3 [Source:... [more]
cpe9.242e-621.07carboxypeptidase E [Source:Xenbase;Acc:XB-GENE-952... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Psmd71.551e-11563.40proteasome (prosome, macropain) 26S subunit, non-A... [more]
Eif3f1.400e-1322.46eukaryotic translation initiation factor 3, subuni... [more]
Cops66.389e-721.90COP9 signalosome subunit 6 [Source:MGI Symbol;Acc:... [more]
Cops68.037e-721.90COP9 signalosome subunit 6 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26270|PSMD7_DROME4.135e-12066.0426S proteasome non-ATPase regulatory subunit 7 OS=... [more]
sp|Q3ZBD0|PSMD7_BOVIN3.210e-11663.3326S proteasome non-ATPase regulatory subunit 7 OS=... [more]
sp|P51665|PSMD7_HUMAN6.520e-11563.7726S proteasome non-ATPase regulatory subunit 7 OS=... [more]
sp|P26516|PSMD7_MOUSE1.085e-11463.4026S proteasome non-ATPase regulatory subunit 7 OS=... [more]
sp|O24412|PSD7A_ARATH2.136e-9955.1526S proteasome non-ATPase regulatory subunit 7 hom... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1Q9Z67.238e-12868.7126S proteasome non-ATPase regulatory subunit 7 OS=... [more]
A0A0R3TJL01.717e-12665.18MPN domain-containing protein OS=Rodentolepis nana... [more]
A0A210QH025.987e-12668.1526S proteasome non-ATPase regulatory subunit 7 OS=... [more]
A0A0R3SAR53.929e-12565.59MPN domain-containing protein OS=Hymenolepis dimin... [more]
U6JFN52.109e-12468.1426S proteasome non-ATPase regulatory subunit 7 OS=... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
psmd72.707e-11763.70proteasome 26S subunit, non-ATPase 7 [Source:NCBI ... [more]
eif3f6.378e-1523.97eukaryotic translation initiation factor 3 subunit... [more]
COPS61.391e-823.28COP9 signalosome subunit 6 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psmd71.138e-12164.73proteasome 26S subunit, non-ATPase 7 [Source:ZFIN;... [more]
eif3f1.221e-1324.91eukaryotic translation initiation factor 3, subuni... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPN82.602e-8848.12Essential non-ATPase regulatory subunit of the 26S... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO457766.379e-12064.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363474.655e-1525.91Eukaryotic translation initiation factor 3 subunit... [more]
EDO353779.406e-1326.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
psmd74.703e-11663.33proteasome 26S subunit, non-ATPase 7 [Source:NCBI ... [more]
eif3f3.087e-1625.48eukaryotic translation initiation factor 3 subunit... [more]
COPS68.259e-823.53COP9 signalosome subunit 6 [Source:NCBI gene;Acc:1... [more]
COPS66.928e-722.78COP9 signalosome subunit 6 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004074.10.000e+0100.00SMESG000004074.1[more]
SMESG000004091.10.000e+095.45SMESG000004091.1[more]
SMESG000004091.10.000e+095.45SMESG000004091.1[more]
SMESG000030216.14.776e-16681.98SMESG000030216.1[more]
SMESG000005863.11.134e-939.51SMESG000005863.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017710 ID=SMED30017710|Name=26S proteasome non-ATPase regulatory subunit 7|organism=Schmidtea mediterranea sexual|type=transcript|length=1060bp
TTCCGATCTTTTTTTTTAAACTTAGCTTATTGTAATTATGTCTAACTTAT
CACAAATTTCTAAAACTGTTAATGATTCTTCAAAAATTTCGAAAGTTGTC
GTCCATCCTTTAGTTTTGTTAAGTGTTGTTGATCACTATAATAGACTTAG
TAAGGCATCGGGTAGTAAAAGAGTAGTCGGTGTTTTATTAGGTTATATGC
GAAAAGATGTTTTAGAAATAACTAATAGTTATGCTGTTCCATTTGAAGAA
GACTTAGGTGACAAAAATGTGTGGTTTTTAGATCACGATTACTTGGAAAG
CATGTTTTCTATGTTTAAAAAAGTTAATGCCAAAGAAAAGATTGTTGGTT
GGTATCACTCTGGGCCTAAATTGAAACAGAATGATATTAAAATTAACGAA
TTATTCCGTAGATATAACCATTGTTCTGTAATGGTTATAGTTGATGTTGA
ACCTAAAGAAAGTGATGGATTACCCACTGAAGCTTATTTAGCAATTGATG
AAGTTCATGATGATGGAACGTTGACTACTAAAACATTTAAACATATTCCT
TCCGAGATAGGCGCTGAGGAAGCAGAAGAGGTTGGCGTAGAACATTTATT
AAGAGACATAAAAGATTCATCAATTGGTAGTTTATCGCAAAGAATAAAAA
ATCAATTAATGGGATTAGAAGGTTTGAAGGCTCATTTAAATGAAATTTAT
GACTATTTATCATTGGTTATGAATAAAAACATCCCATTAAACTATTCGAT
TCTCTATCACTTGCAAGATATTTTCAATTTATTACCCGACGTATTTCTCG
ATGACATGATTAAATCGCAATATATTAAAACCAATGACCAAATGCTTGTT
CTGTACATGGCATCGATGATTCGATCGATTTTAGCACTTCACGATTTGAT
AACCAATAAATTAACGAACCGAGAAAAGGAAAATACCGAAGAAATGGATA
AGAAAATCGATCATTCTGTTTCAGTGAAATCATAATAATATTGATTTTTA
AATAAATATTTGTTGTTTCTTATTTGTGCAAAATTTAAATAGAAATTATT
GATTTTTTTG
back to top

protein sequence of SMED30017710-orf-1

>SMED30017710-orf-1 ID=SMED30017710-orf-1|Name=SMED30017710-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
MSNLSQISKTVNDSSKISKVVVHPLVLLSVVDHYNRLSKASGSKRVVGVL
LGYMRKDVLEITNSYAVPFEEDLGDKNVWFLDHDYLESMFSMFKKVNAKE
KIVGWYHSGPKLKQNDIKINELFRRYNHCSVMVIVDVEPKESDGLPTEAY
LAIDEVHDDGTLTTKTFKHIPSEIGAEEAEEVGVEHLLRDIKDSSIGSLS
QRIKNQLMGLEGLKAHLNEIYDYLSLVMNKNIPLNYSILYHLQDIFNLLP
DVFLDDMIKSQYIKTNDQMLVLYMASMIRSILALHDLITNKLTNREKENT
EEMDKKIDHSVSVKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR037518MPN
IPR033858MPN_RPN7_8
IPR000555JAMM/MPN+_dom
IPR024969Rpn11/EIF3F_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0000502proteasome complex
GO:0005838proteasome regulatory particle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000555JAB1/MPN/MOV34 metalloenzyme domainSMARTSM00232pad1_6coord: 19..155
e-value: 1.1E-33
score: 127.9
IPR000555JAB1/MPN/MOV34 metalloenzyme domainPFAMPF01398JABcoord: 17..127
e-value: 2.8E-32
score: 111.2
NoneNo IPR availableGENE3DG3DSA:3.40.140.10coord: 13..197
e-value: 4.8E-71
score: 239.7
NoneNo IPR availablePANTHERPTHR10540EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT F-RELATEDcoord: 17..306
NoneNo IPR availablePANTHERPTHR10540:SF1226S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 7coord: 17..306
IPR024969Rpn11/EIF3F, C-terminalPFAMPF13012MitMem_regcoord: 178..288
e-value: 1.8E-29
score: 102.4
IPR037518MPN domainPROSITEPS50249MPNcoord: 20..156
score: 24.877
IPR03385826S Proteasome non-ATPase regulatory subunit 7/8CDDcd08062MPN_RPN7_8coord: 19..298
e-value: 1.82846E-162
score: 451.652