Protocadherin-11 X-linked

Overview
NameProtocadherin-11 X-linked
Smed IDSMED30017705
Length (bp)3096
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-11 X-linked (SMED30017705) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30017705) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-11 X-linked (SMED30017705) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30017705) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017705

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30017705h1SMcG0007970 dd_Smed_v4_15181_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30017705h1SMcG0007970 SmedASXL_015564SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30017705h1SMcG0007970 dd_Smed_v6_15181_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30017705h1SMcG0007970 dd_Smed_v4_15181_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 272.322 bits (695), Expect = 7.189e-76
Identity = 239/870 (27.47%), Postives = 404/870 (46.44%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLC----RFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-----FIECPEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP-SSNPDYAIITN--FRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRL 2642
            Y++ EE    + +GN++ DL L  ++  K L   T   F     +    +I  +    +      ++DREKLC    R +H                      CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P A+D D+ +N    Y L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F +     I V I E A +G ++  + A D DIG N+K+ FS +  L  + A   F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P     +I  P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V               F L   + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + + EN      ++K+ A+D D G NA++ Y +  +    F +++ +G L  ++ +D E+  +   TI  KD G P  T+   V V+I D ND  P          V E++P+   V  ++V DPD G    V++++L   + F   +    +  N+ FDRE  + Y+  V   D G+   ++S  +TI + D+NDN+P    +   P    S + +  S     G  +  +   D+D   NA++ Y  +  + +  F +  ++GN+ L   C V+DLG  R+++K  D G P  LFS++                 EL+   ++ P + N + A +++     V I++  + G    V+++F+   V+ ++A  L
Sbjct:   49 YTIREEIPENVLIGNLLKDLNL-SLIPNKSL--TTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----------------------CFYEVEVAILP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVFKETE---IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS-NLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP-ARAMVL-VNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP---FRLRPVFSNQ-----------FLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKP----VFIVPPYNYSYELVLPSTNP--GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHL 863          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 272.322 bits (695), Expect = 7.189e-76
Identity = 239/870 (27.47%), Postives = 404/870 (46.44%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLC----RFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-----FIECPEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP-SSNPDYAIITN--FRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRL 2642
            Y++ EE    + +GN++ DL L  ++  K L   T   F     +    +I  +    +      ++DREKLC    R +H                      CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P A+D D+ +N    Y L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F +     I V I E A +G ++  + A D DIG N+K+ FS +  L  + A   F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P     +I  P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V               F L   + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + + EN      ++K+ A+D D G NA++ Y +  +    F +++ +G L  ++ +D E+  +   TI  KD G P  T+   V V+I D ND  P          V E++P+   V  ++V DPD G    V++++L   + F   +    +  N+ FDRE  + Y+  V   D G+   ++S  +TI + D+NDN+P    +   P    S + +  S     G  +  +   D+D   NA++ Y  +  + +  F +  ++GN+ L   C V+DLG  R+++K  D G P  LFS++                 EL+   ++ P + N + A +++     V I++  + G    V+++F+   V+ ++A  L
Sbjct:   49 YTIREEIPENVLIGNLLKDLNL-SLIPNKSL--TTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----------------------CFYEVEVAILP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVFKETE---IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS-NLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP-ARAMVL-VNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP---FRLRPVFSNQ-----------FLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKP----VFIVPPYNYSYELVLPSTNP--GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHL 863          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 272.322 bits (695), Expect = 8.687e-76
Identity = 239/870 (27.47%), Postives = 404/870 (46.44%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLC----RFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-----FIECPEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP-SSNPDYAIITN--FRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRL 2642
            Y++ EE    + +GN++ DL L  ++  K L   T   F     +    +I  +    +      ++DREKLC    R +H                      CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P A+D D+ +N    Y L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F +     I V I E A +G ++  + A D DIG N+K+ FS +  L  + A   F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P     +I  P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V               F L   + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + + EN      ++K+ A+D D G NA++ Y +  +    F +++ +G L  ++ +D E+  +   TI  KD G P  T+   V V+I D ND  P          V E++P+   V  ++V DPD G    V++++L   + F   +    +  N+ FDRE  + Y+  V   D G+   ++S  +TI + D+NDN+P    +   P    S + +  S     G  +  +   D+D   NA++ Y  +  + +  F +  ++GN+ L   C V+DLG  R+++K  D G P  LFS++                 EL+   ++ P + N + A +++     V I++  + G    V+++F+   V+ ++A  L
Sbjct:   60 YTIREEIPENVLIGNLLKDLNL-SLIPNKSL--TTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----------------------CFYEVEVAILP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVFKETE---IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS-NLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP-ARAMVL-VNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP---FRLRPVFSNQ-----------FLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKP----VFIVPPYNYSYELVLPSTNP--GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHL 874          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 271.552 bits (693), Expect = 1.304e-75
Identity = 239/870 (27.47%), Postives = 404/870 (46.44%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLC----RFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-----FIECPEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP-SSNPDYAIITN--FRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRL 2642
            Y++ EE    + +GN++ DL L  ++  K L   T   F     +    +I  +    +      ++DREKLC    R +H                      CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P A+D D+ +N    Y L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F +     I V I E A +G ++  + A D DIG N+K+ FS +  L  + A   F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P     +I  P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V               F L   + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + + EN      ++K+ A+D D G NA++ Y +  +    F +++ +G L  ++ +D E+  +   TI  KD G P  T+   V V+I D ND  P          V E++P+   V  ++V DPD G    V++++L   + F   +    +  N+ FDRE  + Y+  V   D G+   ++S  +TI + D+NDN+P    +   P    S + +  S     G  +  +   D+D   NA++ Y  +  + +  F +  ++GN+ L   C V+DLG  R+++K  D G P  LFS++                 EL+   ++ P + N + A +++     V I++  + G    V+++F+   V+ ++A  L
Sbjct:   60 YTIREEIPENVLIGNLLKDLNL-SLIPNKSL--TTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEH----------------------CFYEVEVAILP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVFKETE---IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS-NLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP-ARAMVL-VNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP---FRLRPVFSNQ-----------FLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKP----VFIVPPYNYSYELVLPSTNP--GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHL 874          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 269.626 bits (688), Expect = 4.654e-75
Identity = 232/845 (27.46%), Postives = 391/845 (46.27%), Query Frame = 3
Query:   30 VNFRYFFFLYMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFE--------LSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            ++ R F+ L  L+     C+         L   I     Y++ EE    + +GNI  DL +  + +       +L +   S+A     ++   S+  +      ++DREKLC             +G     EN+   CF  + + +L   +   ++ I++IV D NDN P+F  P   I I E    +  +   IP A D D   N    Y L N +  F +  ++     K   L   Q LDRE+KD Y++ I+  D G P   S ++ L V + D+ND++P F +     + V I E A +G ++  + A D DIG+N+++++    ++  +     F +N +TG I V   LDRE      + V+ SD  S P      +T+ + D NDN P I+    +II    G +    ++   D       N    LI +    S K ++V  +   +I++ + F  +        L T+S+LD E    +S  I+  D+G P L+ + L+ + + D+NDN P F++   E+ V EN      +  + A+D D G NAD++Y +  N    F +++ +G L      D E  ++   T+  +D G+P   + A V VT+ D ND  P          V+E++PK + V  ++V D D G    V++++L   + FV    +  + +N+ FDRE    Y+  V   D GQP  +++  +TI + D+NDN P    ++ SP    S + +  S     G  +A ++  D D   NA+L Y  +  + K  F + P +GN+ L    + +D+G  RLV+ + D G P+    L L+   V+  + N  Y
Sbjct:    1 MDLRDFYLLAALIA----CL--------RLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDA-PLVKVSSSTGEIFTTSNRIDREKLC-------------AGASYAEENE---CFFELEVVILP-NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLIN--SRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAI-LQVTVSDVNDNRPVFKE---GQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPA-TKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR--ATVTINVTDVNDNPPNIDL--RYIISPINGTV----YLSEKD-----PVNTKIALITV----SDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP----VVISPPSNTSFKLVPLSAIP--GSVVAEVFAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGNASY 783          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 191.045 bits (484), Expect = 6.415e-49
Identity = 194/692 (28.03%), Postives = 303/692 (43.79%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLT--NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGIN-------ADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKP----YFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            T+ V V D+ DN PIF+  ++   I+E+ AP      S+  A D D   N +I Y L   N K+   I     A    I     LDRE      + + A D G P   S ++ + + ++D+ND+ P F+ +S N   V I E   I   IAT+ A D D G N K+ +S+      S  +    I+ STG + +   +D +    +   +   D   P  S+++ LT+ + D ND+AP +   +  I +EEN      VG + A D DSG             P    K S    E     + S +    + TT +LDRE  + YSL +   D G+P L+ S  I++++ D NDN P F +  + + + E     S ++ LKA DND           AD   F I ++     I   SG+L +      + HK + + I   DQG         V+V I D+N   P    +  +  + EH P G  V TL   D D G    +  ++   ++   FR    + ++  + + DRE    +S++V   D+  P L  S  + + + DINDN P+ T          S+   + S   P+G S   +   D DI  N  + YF++ES        F L   SG L+++S           L I  +D GTP L +  E+ + + D   + P +
Sbjct:  255 TVVVHVLDVQDNSPIFEKDSYFGEIRED-APIGTTVLSV-FARDLDSGENGEIEYSLGEGNGKNLLAIN----AKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAM-VEITVVDVNDNAPVFASDSYN---VTILENITIPAVIATVKATDEDFGTNGKVHYSM----ASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSG-------------PNGIIKYSMEGSEDFIIDEDSGL----IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKR------QDHK-VRVEISATDQG--GLQGRCVVNVFIDDVNSA-PYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS---------SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF 892          

HSP 2 Score: 173.711 bits (439), Expect = 1.653e-43
Identity = 175/633 (27.65%), Postives = 299/633 (47.24%), Query Frame = 3
Query:  492 IIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD----HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF-------RN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE 2339
            + +TI VI  DIND+ P        I ++E  A  +   +    AID+D   N  I Y +   +D     +I   +   I   + LDRE   +Y + + A D G P SL+ S  + V + DIND+ P F K+  N   V ISE+   G  I T+ A DND   + K+ + + E   + +++    I      + V  EL R+ ++ V + +  +D G         + V I+D N    F + P +  I E+    S +G+    +KA D D G ++     + +I  +  F++   +               ++S +S LDRE+ +T+S+++   D+ SP L+ S  I +++ D NDN P F  S++   + E+    +S L++ A D DIG N  + YF+  +        F +++TSG L     +D E+   I + I  +D+G+PS +  + + +T+ D+ND  P+    S +  +AE+ P G+ V T+   D D G   ++S  +    +  +F       +N  + +LT  EFD E         +   +GQ  L++++ + I +SD+NDN+P L        V + N+  +      IGF  A       D +QNA L YF+ E++
Sbjct:  463 VPLTINVI--DINDHAPTLIAAQKMITLEENVAIGEEVGRVY--AIDEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP-SLNTSTTIAVVLKDINDNAPTFDKKEYN---VTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSI--LDIGDQGAILSVSGELKRQDHK-VRVEISATDQGG--LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEH----SPIGYPVITLKAEDHDRGDNARI---VYSIDSSQFFRIDPSS--------------GDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDF-----VILMNRFDNVQMARQIGFIPAF------DPDQNATLEYFLEEND 1041          

HSP 3 Score: 148.288 bits (373), Expect = 1.086e-35
Identity = 121/447 (27.07%), Postives = 210/447 (46.98%), Query Frame = 3
Query: 1020 DSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD-HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLL-TNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYF 2351
            DS +   F ++  +G I +   +DRE+ +   L V   +   P  S S  + V + D  DN+P  E    F  I E+    +TV  + A D+DSG +      L      N   ++           KS V    + T + LDRE +S   L ++  D G+P+  ++ ++ I V D NDN P F   ++ + ++EN    + +  +KA+D D G N  + Y + ++       I+ ++G++   E ID  ++  IT  I  KD   P+ ++T  + + + D+ND  P+L++     ++ E++  G  V  +  ID D+GP G +  ++   E+  +  +  L+ T    DRE   +YS+ V  RD G P L  S  + + + DINDN P                 ++ S + P G  I T+   D+D +Q  ++TY I E+++  F
Sbjct:  206 DSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAIN----------AKSGV----IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDK---------KEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVF 626          

HSP 4 Score: 117.472 bits (293), Expect = 3.543e-26
Identity = 93/353 (26.35%), Postives = 161/353 (45.61%), Query Frame = 3
Query: 1419 ELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREI----NDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRL 2462
            E+     +DRE +  + L +  ++   P +S S  + + V D  DN P F + ++  ++ E+    ++VL + A D D G N ++ Y +   N  +   IN  SG +    P+D E    I + +   D+G+P   +TA V +T+ D+ND  P   S S N ++ E++    V+ T+   D D G  G+V  ++    +      ++  T     RE     N   + ++  +D  QP L++++ LTI + DIND+ P L           + + I+      IG  +  +Y  D+D   N  + Y +  SE   FI+  DSG +K            + L +  +D GTP L
Sbjct:  221 EIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS-SSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLI---------AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED--FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSL 561          

HSP 5 Score: 63.1586 bits (152), Expect = 1.076e-9
Identity = 61/269 (22.68%), Postives = 112/269 (41.64%), Query Frame = 3
Query: 1707 FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEK-PYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            F ++  SG++   + +D E   +  + +   ++  P+ + +  V V + D+ D  P     S    + E  P GT V ++   D D+G  GE+  +L     K +     ++  + T    DRE      + VI  D G P+  ++ ++ IT+ D+NDN P              +  ++      I   IAT+   D+D   N ++ Y +  S       +   +G + L       +      VI+ +D   P L S + L I+V+D
Sbjct:  213 FTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFAS---------DSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVID 471          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 177.948 bits (450), Expect = 5.894e-45
Identity = 169/627 (26.95%), Postives = 282/627 (44.98%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI------AIDQDIELNAKILYRLTNHKD--KFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENK---FVFR----NLNLLTNLEFDREINDKYSILVI---LRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI 2327
            + + V D+NDN P+F   ++ + I E          +IP       A D+D   N K+ Y + +       TI Y      L+    + +D  K      +I A D  +P +LS ++ LT+N+IDIND  P     +  +I+  + E   IG+ +  ++A D D G N  +++S+          E F I++ +G I     LDRE      L V   D G+P  + S  + V++ D NDNAP  +  E N  I E     S +  +KA D D            + K T   + ++  + S   I         LS +  L R++     + I   D G   L    ++++ + D N + P+F+   F +++ E+      V+ LKA D+D G NA ++Y I  +    F I+ +SGD+     +D E     ++ +   D  SP   T+  + V + D+ND  P   S S   +++E +P GT    +S ID D GP G V   L    +     +FR    +  L  + + DRE   +++++V+    RD G P L+ +  +T+T+SD+NDN P    L         +  +  +   P+G ++ TI   D D   NA +++ I
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENI--------TIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLR----ERID-AKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLIA-AQKMIT--LEENVAIGEEVGRVYAIDEDSGPNGIIKYSME-------GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE-----------DQKITYRIEEADREVFSILDIGDQGAI---LSVSGELKRQD-HKVRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI--DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE---QFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQL---------SYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI 572          

HSP 2 Score: 172.94 bits (437), Expect = 2.620e-43
Identity = 175/633 (27.65%), Postives = 298/633 (47.08%), Query Frame = 3
Query:  492 IIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD----HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF-------RN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE 2339
            + +TI VI  DIND+ P        I ++E  A  +        AID+D   N  I Y +   +D     +I   +   I   + LDRE   +Y + + A D G P SL+ S  + V + DIND+ P F K+  N   V ISE+   G  I T+ A DND   + K+ + + E   + +++    I      + V  EL R+ ++ V + +  +D G         + V I+D N    F + P +  I E+    S +G+    +KA D D G ++     + +I  +  F++   +               ++S +S LDRE+ +T+S+++   D+ SP L+ S  I +++ D NDN P F  S++   + E+    +S L++ A D DIG N  + YF+  +        F +++TSG L     +D E+   I + I  +D+G+PS +  + + +T+ D+ND  P+    S +  +AE+ P G+ V T+   D D G   ++S  +    +  +F       +N  + +LT  EFD E         +   +GQ  L++++ + I +SD+NDN+P L        V + N+  +      IGF  A       D +QNA L YF+ E++
Sbjct:  104 VPLTINVI--DINDHAPTLIAAQKMITLEENVAIGE--EVGRVYAIDEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP-SLNTSTTIAVVLKDINDNAPTFDKKEYN---VTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSI--LDIGDQGAILSVSGELKRQDHK-VRVEISATDQGG--LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEH----SPIGYPVITLKAEDHDRGDNARI---VYSIDSSQFFRIDPSS--------------GDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDF-----VILMNRFDNVQMARQIGFIPAF------DPDQNATLEYFLEEND 682          

HSP 3 Score: 170.629 bits (431), Expect = 1.322e-42
Identity = 159/579 (27.46%), Postives = 254/579 (43.87%), Query Frame = 3
Query:  834 LTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGIN-------ADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKP----YFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            + + ++D+ND+ P F+ +S N   V I E   I   IAT+ A D D G N K+ +S+      S  +    I+ STG + +   +D +    +   +   D   P  S+++ LT+ + D ND+AP +   +  I +EEN      VG + A D DSG             P    K S    E     + S +    + TT +LDRE  + YSL +   D G+P L+ S  I++++ D NDN P F +  + + + E     S ++ LKA DND           AD   F I ++     I   SG+L +      + HK + + I   DQG         V+V I D+N   P    +  +  + EH P G  V TL   D D G    +  ++   ++   FR    + ++  + + DRE    +S++V   D+  P L  S  + + + DINDN P+ T          S+   + S   P+G S   +   D DI  N  + YF++ES        F L   SG L+++S           L I  +D GTP L +  E+ + + D   + P +
Sbjct:    2 VEITVVDVNDNAPVFASDSYN---VTILENITIPAVIATVKATDEDFGTNGKVHYSM----ASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSG-------------PNGIIKYSMEGSEDFIIDEDSGL----IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKR------QDHK-VRVEISATDQG--GLQGRCVVNVFIDDVNSA-PYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS---------SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF 533          

HSP 4 Score: 113.235 bits (282), Expect = 6.593e-25
Identity = 77/279 (27.60%), Postives = 138/279 (49.46%), Query Frame = 3
Query: 1521 LISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD-HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLL-TNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYF 2351
            ++ I V D NDN P F   ++ + ++EN    + +  +KA+D D G N  + Y + ++       I+ ++G++   E ID  ++  IT  I  KD   P+ ++T  + + + D+ND  P+L++     ++ E++  G  V  +  ID D+GP G +  ++   E+  +  +  L+ T    DRE   +YS+ V  RD G P L  S  + + + DINDN P                 ++ S + P G  I T+   D+D +Q  ++TY I E+++  F
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDK---------KEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVF 267          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 145.206 bits (365), Expect = 1.038e-34
Identity = 146/548 (26.64%), Postives = 245/548 (44.71%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI----AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNP-SVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR---NLNLLTNLEFDREINDKYSILVILRDNGQPR 2120
            I + + D+NDN PIF    + + ++E   P +      P+    A D D     ++ Y + +    F+I  +         PL       + ++ +++ A D G   S   S N+ + +ID +   P+FS+    + +   +E    G  I ++       G  SK+++S+     D     +F I++ TG I+V   LD +++++V L +  +       SN   + + I D NDN P F        I E+         ++A D D   +      +I+  P +S ++                FT +LST S+LD E    Y L +   D G P  S++  + I V D NDN P F +S + ++V+EN    + V K+ A D D   N  ++Y  ITN    F I++  G++Y    ID E    + I+I  +D+G P  ++TA   +++ D+ND PPS +  S+ P  V    P  T + T+  +DPD G  G V        + FV +   ++ L   L    E + + S  VI+ D G PR
Sbjct:  627 ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEE------PLLVVSASDMDSGTFGEVSYHILSESSSFSINPV-TGEVFAQKPL------ARGRFHLVVSAKDGGGQSS-ENSANIHITVIDKDTKTPQFSRSKYEIRT---TEDILPGIAIGSV-------GAMSKVKYSIYSGDQD----HNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSG--ESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQ--------------FTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYR-ITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCL--SITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLS--VIVSDQGVPR 1125          

HSP 2 Score: 136.732 bits (343), Expect = 4.400e-32
Identity = 189/772 (24.48%), Postives = 329/772 (42.62%), Query Frame = 3
Query:  276 ASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKE-EQAPSDWNYQSIPIAIDQD-----------IELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVH-LFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL---STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLE--FDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLT----HLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            A+ K+++++ D   S+ L    KVD            +S   S+  I +++ + +  F ++++ + E  E    + I V V+D NDN P F      + I E  Q  + +   ++P   D D           ++ N   +++L + K    ++   + N         LDRE +DKY ++IEA D GKP  + G L  ++ IID ND+ P FS+   +  +  +S    IG  + T+ A D DIG NS++ + +  K T + +  +F I++S G I     L   +  S H + V+ SD GSP  S+S  +T+ +     ++P ++    +++E N   L   ST+G I A    +    +    LI     +S      T ++  Y+         L    ILDRE  S + L  L   +G   + + +L++I   D NDN P +H S   I +  N+    S   L A D D+G N  + Y ++        I++ +G ++    ID     +I   +  +D GSP+ +T   V   + D    PP          + E  P GT +  +   +   G    +  +L   +       ++    ++  FD E    Y   VI  +      T++ L++I + D+NDN P       HL    G K          +EP+      +   D D     +++Y I  SE   F ++P +G +      +    G F LV+  +D G     +   + I V+D  +  P ++
Sbjct:   52 AAPKYFVVFPDEQTSKFL----KVDE-----------RSGEIST--IAHLDYEKRSKFDIVAVKVEESGE---TIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSF---ALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVN-------GQLDREFRDKYELLIEAQDGGKPAKI-GQLRCSIEIIDANDNAPVFSR---SRYTASVSANISIGSHLITVQATDADIGENSRISYDI--KKTSAPSNSNFAISQS-GVITTTASL---LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDI--IWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIG----SSALCPQQTDQAHVYL---------LLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTI--GDINDNAPQWHSSQIHISL--NRTQGGS-RTLTAKDPDLGQNGWIRYSVLDT--ELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPK---------PEEPL----LVVSASDMDSGTFGEVSYHIL-SESSSFSINPVTGEVFAQKPLA---RGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFS 742          

HSP 3 Score: 128.257 bits (321), Expect = 1.506e-29
Identity = 175/779 (22.46%), Postives = 312/779 (40.05%), Query Frame = 3
Query:  249 TLTFFPWSQASSKFYMIYKDSANSQKLV----LQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQ-------------EGMIIVT--IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWE-------NKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            T+T    + +S    +I+   +NS  L+    L   V R  + + Q+  +K ++  S  +C  + D    ++L+   +L+ +             +G II+     + + DINDN P +      I +   Q  S         A D D+  N  I Y + +       + + I  E  +I    T+D     +    + A D G P +LS  L +  +++D     P+F K    L  V I E   IG  +  + A+++  GN+ ++++SL  +       EH  ++  +G + +    D E  +S    VI ++  S   +++  +++ + D NDN P F     +  + E       +  + A DMDSG     S  +++   ++SF ++ VT E   + +K +                   + LV+   D G     NS  I I V D++   P F RS +EI+  E+ +   ++         +G  + + Y I + + DH F I++ +G +Y    +D + H  + + I        S  T   V + I+D ND PP   S  +  S+ E +        +   D D    GEV  +++          ++F  +   L T    D E    Y + V   D G P  ++++ L I + D+NDN P             S  T+      P    +  +   D D  +N Q+ Y I    + YF +    GN+    +     +    + I  +D G P   S     I V+D
Sbjct:  324 TITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQ-QYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGS-----RTLTAKDPDLGQNGWIRYSVLD------TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSP-ALSTDLQVVADLLDTESKPPQFEKA---LWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQ------DEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANS--ETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILS--ESSSFSINPVTGE--VFAQKPLAR---------------GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAI-------GSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQ--VVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQ---LSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEK---------SWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE-YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLD 1037          

HSP 4 Score: 100.138 bits (248), Expect = 6.786e-21
Identity = 137/622 (22.03%), Postives = 243/622 (39.07%), Query Frame = 3
Query:  654 KILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVT--LESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDG 2501
            +I Y L N  +  T+  +       +   +T D EK+  Y   + A +     S S    +++ + D+ND+ P F     +L    + E  K  + +  + A D D G   ++ + +   L++S +   F IN  TG +     L R  +   HL V   D G     NS  + + + D++   P F          E+      +G +       GA S     + +    ++F +   T  +  T Y+   +  T  L+  + L                      SN   + I + D NDN P F  S  EI + E+         ++ASD D   N ++ Y II+ +   +  I+Q +G L     +D+E  +   + +   D G P  ++   + + + D+ND  P          V E+ P  T+V  +   D D+   G++   +      F    +  N+ T    DRE+     I ++  D G P  +++    I++ D+NDN P            +S   I      P+  +I TI   D D   N  + Y   + +   F++   +G++ L    + SD    RL + V D G PR   +  + + +  G
Sbjct:  574 RIRYSLQNQDEHLTVDTMSGT----VCIQKTFDFEKQKSYQTTVIATNANSETSTS---LISIRLKDVNDNWPIFYPNEYHLT---VREGPKPEEPLLVVSASDMDSGTFGEVSYHI---LSESSS---FSINPVTGEVFAQKPLARGRF---HLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGE------------------SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSC----------LSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRA-QLQSSLFVVK-SNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKG 1139          

HSP 5 Score: 89.3521 bits (220), Expect = 1.290e-17
Identity = 131/574 (22.82%), Postives = 230/574 (40.07%), Query Frame = 3
Query:  840 VNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDS--------GNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            + I DIND+ P++    ++     IS     G +  T+ A D D+G N  +++S+ +        E   I+K TG I V N +D  I   +   V   D GSP  S  + +   + D     P F +      I E+    + +  + A +   G S      L N        L+  T+  T  I+K+  F            E   +Y   ++  +  S   +++ LISI + D NDN P F+ + + + V E       +L + ASD D G   ++ Y I++    +F IN  +G+++  +P+   R     + +  KD G  S   +A +H+T+ D +   P            E +  G  + ++       G   +V  ++   +    F        +      D +++D  ++L+ ++       +N   + I I D NDN P+ +  +    V+IS +       EP       +   D D  +N ++ Y I  S       HP S        G L   S        +++L +K  D G P   S + L IHV+D   + P++
Sbjct:  429 LTIGDINDNAPQWHSSQIH-----ISLNRTQGGS-RTLTAKDPDLGQNGWIRYSVLD-------TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQN----QDEHLTVDTMSGTVCIQKTFDF------------EKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE-SSSFSINPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHD--TVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSL----VEISIRE-DLKLHEP----FYVVQASDKDKKKNGEVRYSIISS-------HPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF 942          

HSP 6 Score: 80.4925 bits (197), Expect = 6.294e-15
Identity = 77/300 (25.67%), Postives = 133/300 (44.33%), Query Frame = 3
Query: 1677 YFIITNVDHT---FMINQTSGDLYQIEPIDFERHKQITI-TIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWEN-----KFVFRNLN------LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAII 2531
            YF++   + T     +++ SG++  I  +D+E+  +  I  +  ++ G      T  + V + D ND  PS     +   ++E    GT     +V D D GP  +V   ++   N     K   R +N      L+ N + DRE  DKY +L+  +D G+P     +  +I I D NDN P  +          S  T S S    IG  + T+   D DI +N++++Y I ++  P       S +  + +T S+    +  +++   D+G+P L S   + I V+    S+P   II
Sbjct:   56 YFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGE-----TIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGD-GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSR---------SRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDII 340          

HSP 7 Score: 73.9442 bits (180), Expect = 6.462e-13
Identity = 176/746 (23.59%), Postives = 284/746 (38.07%), Query Frame = 3
Query:  324 KLVLQKKVDREKLCRFQHTLSKSKIFSS-GCICNMENDNKICFMLISLSLLEFQEGMIIV------------TIRVIVNDINDNPPIFQLPNFT---IMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRF-SKESLNLIS----VFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLY-QIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDV-PPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALL-----PWENKF--VFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFI-LHPDSGNLKLN--STCSVSDL--GSFRLVIKVQDNGTP 2456
            K +L   +  E   RFQ    K  I S+ G I  +  D +             QE ++I+            T+RV V D NDN P  QL   T   + I E     D  ++    A D DI  N K  + L       ++  +    +L +  L +L   K     I +  +D G P      L +  N ++I++  P+  +K  L  +       I E    GQ IA +          + L +S+ E   DS      F   S G I    ELDREI E   L VI +  G   +     + V +N+ NDN P     +   + EN    S V  + A D+D            N+ P   F +S+ + ++ T+      FT  +  T+ LD E +  ++L I   D      +N   ++I VSD NDN P F +  ++  V     +       K   +D+     L Y +       F +   SG L+ ++ P   ER+    +T+   D G PSF+T+  V V I +      P          V E+   G  +  LS         GE S         P  +K   + +   L      DRE    +   V + +             + + D NDN P  T +            +S       G  I  I   D D  +N +++Y I        + L+PD+G+++LN  +   + +    +++++++ +D+G P
Sbjct: 1651 KRILATGMTEESRFRFQGNAPKFSINSTTGSISVLPLDREAS-----------QEHLLIIILTDGGSRNDSCTVRVTVADQNDNKP--QLDASTPSELEIAESSRVGDVLHRF--RASDMDIGQNGKFSFELLEDSSG-SLDLVPETGDLVLRRLSSLQSWK-----IKLRVVDHGVP-----GLYVEKN-LEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPE------LAGLTYSIVEGNIDSA-----FSVDSEGVIRTNLELDREILERYSLKVIGTGSG---QQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVD------------NLAPLRYFLVSDSSGQTPTHFNID-QFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFA-KIEAHDLDARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERY---LVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLS---------GEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVA---------YYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHP 2317          

HSP 8 Score: 68.1662 bits (165), Expect = 3.229e-11
Identity = 61/220 (27.73%), Postives = 104/220 (47.27%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRS 1157
            +T+ + V D+NDN P F+   +T+ + E   P         +A D+D   N +I+YR+TN  + F I   ++ N   +   +++DRE      I I A D G P   S + +  ++++D+ND+ P      L++  + +   + +   I TI A D D G N  +       L  +      F+ KS G +++  +L+        L VIVSD G P +S
Sbjct:  926 MTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPK--TIVGKVVARDKDSLENGQIVYRITNGSEYFGIDE-KLGN---VYTKRSIDREVISHVDISIVAEDKGVPPR-SSTASARISVLDVNDNPP----SCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSV-------LYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKS 1127          

HSP 9 Score: 66.2402 bits (160), Expect = 1.237e-10
Identity = 127/532 (23.87%), Postives = 221/532 (41.54%), Query Frame = 3
Query:  402 SSGCI-CNMENDNKICFMLISLSLLEFQEGMIIVT-IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAID-QDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQT-LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQA-KIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIND-ENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSF---KLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD-HTFMINQTSGDL----YQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIK--DMNDVPPSLVSYSMNPSVAEHMPKGTVVQTL 1946
            S G I  N+E D +I     SL ++    G  I T + V VN++NDN P F       M K  + P +    S    +  +D++  A + Y L +     T  +  I        L   LD E   ++ + I+A D G  D+ +   NLT+ + DIND+ P FSK    L    +S      GQ  A I AHD D      L +SL +      +   F +   +GA+ +  ++     E   + V  +D G P  S S+ ++VII + E  + P  E  E  F + EN    S +G ++  ++    S      + + + +  F   K   + +      ++     F++     +D E +++  +   CH              ++V D+NDN+P F    + + + ++  +   + ++ ASD D G N  + Y I++  D +   +N  +G +    +    +D   +    I +  +D G P+      V V++K    +   P  V       V E    GTV+Q +
Sbjct: 1878 SEGVIRTNLELDREI-LERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFP------MSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD-GSFDTFT---NLTIFVSDINDNAPTFSKP---LYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQG-----SSSIFRVAPESGALFM--KVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMEN----SKIG-LQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVE----IDNEMMTSQKVQCKCH--------------VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKI 2363          

HSP 10 Score: 54.299 bits (129), Expect = 6.295e-7
Identity = 37/139 (26.62%), Postives = 69/139 (49.64%), Query Frame = 3
Query: 2049 LEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLF 2465
            L  DRE + ++ +++IL D G     +S  + +T++D NDN+P+L     S         +  +    +G  +      D DI QN + ++ + E       L P++G+L L     +S L S+++ ++V D+G P L+
Sbjct: 1685 LPLDREASQEHLLIIILTDGGS--RNDSCTVRVTVADQNDNKPQLDASTPS--------ELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLR---RLSSLQSWKIKLRVVDHGVPGLY 1810          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 114.005 bits (284), Expect = 3.655e-25
Identity = 147/591 (24.87%), Postives = 255/591 (43.15%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIG-NNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESV---HLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI--IEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVI--LCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMI------NQTS-GDLYQIEPIDFER-------HKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALL--PWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSI---LLTITISDINDNRP 2177
            V +++++ND+NDN P F+   +   +KE +      +  I I    D++ ++ + Y L        I +    +   I   + LD E  D+Y +++ A D G+ ++ +   N+ ++I D+ND+ P+F  E     +  I E   I + +  + A D D    +S++ + L  +  D    E F I K +G I +   LDR+    V   +  V   D           + V + D NDN+P    PE     IEENR  + + G     ++A D D   + N + +   ++     KL N   ES   I ++    F + +   LDRE  S    +I    +D G P       ++I V+D NDN PFF ++ +E  V E     ++V+   A D D     ++  + ++     F +       Q+S G L   +P+D+E        H  I ++ G  D         A VHV + D ND  P +   + +  V E +P+GT +   +  D D G      +     P     + ++  L      DRE    Y++++   DN     +N+I   ++ + + D+NDN P
Sbjct: 1319 VKVQIVINDVNDNAPSFEEQKYIGRVKESEGEG---HDVITIKA-HDLDKHSNLRYHLIGAGGG-RIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATT---NVYIHIEDVNDNAPQF--EQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGAD----EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF--PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRN----KLING--ESVFRIDQNTGKIFAMRS---LDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD-------AEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDN-----SNNIGRQMVAVYLQDVNDNGP 1870          

HSP 2 Score: 101.293 bits (251), Expect = 2.911e-21
Identity = 171/709 (24.12%), Postives = 290/709 (40.90%), Query Frame = 3
Query:  567 IMIKEEQAPSDWNYQSIP-----IAIDQDIELNAKIL----------------YRLT---NHKDKFTIKYIQI-----ANE-LKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKI--------GQTIATIFAHDNDI-GNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSD-------CGSPPRSNSMALTVIINDENDNAPFIECPENFI--IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVL-KLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQI---TITIGCKDQGSPSFTTTAYVHVTIKDMND----VPPSLVSYSMNPSVAEHMPKGTV---VQTLSVIDPDTGPG----GEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILR--DNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATI-YFHDDDINQNAQLTYFIHESEKPYFILHPDS-------GNLKLNSTCSVSDL---GSFRLVIKVQDN 2447
            ++ K+++AP    +Q+ P     I +D+++ELN  IL                Y+LT      +K   K+ Q       NE +++  ++ LD E+ + Y + + A D      ++ +    V + D+ND  P+F+   ++L +  I E+           G+ I T+ A D D  G  +++ + +  +  +    +HF I++ TG I    + DRE  +   L V  SD         + P  +++ + ++IND NDNAP  E  + +I  ++E+ GE   V  IKA D+D    SN    LI             T   T ++K+             LD E    Y LV++  D    R + +  + I + D NDN P F +  +   V+E  V++  VL  + A+D D    +  + + +     D  F I + SG +  ++ +D +    +      +   D         A V V ++D+ND     P  L  Y        H   G     VQ     DP T       G V   L+  E+  VFR       +      DREI+ +   ++ +R  D G P       +TI ++D+NDN         +P  + +    S     PIG ++ +   F  D+  ++   TY + E E  YF +  D        G L++       D+     F L I+V D 
Sbjct: 1083 VLDKQQKAPK---WQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS--RVASTKTFVVEVRDVNDVVPQFT---VDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGE-ANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFE-EQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAG-GGRIPFGVRTDSGTIFVKEP------------LDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHS-DGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGES--VFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDN---------APFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSE-ESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG 1750          

HSP 3 Score: 95.9005 bits (237), Expect = 1.303e-19
Identity = 127/494 (25.71%), Postives = 226/494 (45.75%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKY-IQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDS-YAMEHFFINKSTGAIHVWNELDR----EIYESVHLFVIVSDCGS----PPRSNSMALTVIIN--DENDNAP-FIECPENFIIEE-----NRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI----------ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSP-SFTTTAYVHVTIKDMNDVPP 1874
            +E  + +TIR+  +D+NDN P F  P +T  ++E+  P +     +  A+D+D   N++I Y + NH   F+I    +I+ ++++   Q    E+   Y   + A D G+P SLS S  + +   + ND    F   S    + F++E A+ G  +  I A D D     ++ +S  +K   S   M  F I++ TG + + + +      E    ++L VIV D GS    P ++++   T++I   D N+N P F +C +   I +      + +  T+  ++A D DS A+ +    L        +   + + ++    +++ V T   S   + DRE      + +   D G   L      S+ V D NDN P F R ++E  V   +   +SV+ + A DND   NA++ Y +            ++D   ++N+ SG++  I+PI  +  K I   I   D G P +  ++A V + + D     P
Sbjct:  622 RESHVDLTIRI--DDVNDNVPTFTRPLYTAQVRED-IPLNQTILKV-TAVDKDTGDNSRITYSVDNHN--FSINSNGEISAKVRLDADQL--NERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQ--YTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL--------YYTQSESRKAFVIDRQTGVLT--PSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVI-ADDNGIPEALQSSAQVTLNVLDKQQKAP 1091          

HSP 4 Score: 92.4337 bits (228), Expect = 1.541e-18
Identity = 175/730 (23.97%), Postives = 308/730 (42.19%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDR------EKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDI--NDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHD----NDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECP-ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSP-RLSNSKLISILVSDQNDNIP-FFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLY-FIITNVDHT-----FMINQTSGDL---YQIEPIDF-ERHKQITITIGCKDQGS----PSFTTTAYVH--VTIKDMNDVPPSLVSYSMNPSVAEHMPKGT------VVQTLSVIDPDTGPGGEVSVALL--PWENKFVF---RNLNLLT---NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI---------HESEKPYF-ILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPR-LFSLLELIIHVVDGPSSNPDY 2522
            TIR+ V DI D PP F      ++      P+        +A D+  + ++ +LY+        TI  I  A    + P   + R      E+ D Y I  +A+D    D+ +  L+  V I++I  ++  P+F+K+      V +SE   +  ++  + A       D  +   + +SL E  T     + F I+ STG IH+   LD +      L  +        R + + LT+ I+D NDN P    P     + E+     T+  + A D D+G +S  +  + N          N ++ S   I   +     L    + +R  +  Y   +   D+G P  LS+S +I I   + ND    F   S +   V E+    + V++++A D D     ++ Y F+  N   T     F I++ +G +   + +   D  E    I +T+  +D GS    PS T T+Y    + I+D+N+  P     +    +A+ M +GT       +  +   D D+   G++  +L     E++  F   R   +LT   ++ FDRE   +  + V   D G   L      ++ + DINDN P+          + S +T S S  E +G S+ T++  D+D   NA++TY +         H+++  +F +++  SG + L     +     F   +   DNG P  L S  ++ ++V+D     P +
Sbjct:  408 TIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYK--------TIDVIP-AGSFIVDPKSGVVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLS-EVAILEILADERPPQFAKQEY---EVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSL-EGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN---------HNFSINSNGEISAKV----RLDADQLNERHFV--YRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIM-EGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFE--------RPSYET-SVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK-TQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW 1093          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 114.005 bits (284), Expect = 3.655e-25
Identity = 147/591 (24.87%), Postives = 255/591 (43.15%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIG-NNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESV---HLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI--IEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVI--LCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMI------NQTS-GDLYQIEPIDFER-------HKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALL--PWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSI---LLTITISDINDNRP 2177
            V +++++ND+NDN P F+   +   +KE +      +  I I    D++ ++ + Y L        I +    +   I   + LD E  D+Y +++ A D G+ ++ +   N+ ++I D+ND+ P+F  E     +  I E   I + +  + A D D    +S++ + L  +  D    E F I K +G I +   LDR+    V   +  V   D           + V + D NDN+P    PE     IEENR  + + G     ++A D D   + N + +   ++     KL N   ES   I ++    F + +   LDRE  S    +I    +D G P       ++I V+D NDN PFF ++ +E  V E     ++V+   A D D     ++  + ++     F +       Q+S G L   +P+D+E        H  I ++ G  D         A VHV + D ND  P +   + +  V E +P+GT +   +  D D G      +     P     + ++  L      DRE    Y++++   DN     +N+I   ++ + + D+NDN P
Sbjct: 1319 VKVQIVINDVNDNAPSFEEQKYIGRVKESEGEG---HDVITIKA-HDLDKHSNLRYHLIGAGGG-RIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATT---NVYIHIEDVNDNAPQF--EQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGAD----EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF--PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRN----KLING--ESVFRIDQNTGKIFAMRS---LDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD-------AEAAVHVALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDN-----SNNIGRQMVAVYLQDVNDNGP 1870          

HSP 2 Score: 101.293 bits (251), Expect = 2.911e-21
Identity = 171/709 (24.12%), Postives = 290/709 (40.90%), Query Frame = 3
Query:  567 IMIKEEQAPSDWNYQSIP-----IAIDQDIELNAKIL----------------YRLT---NHKDKFTIKYIQI-----ANE-LKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKI--------GQTIATIFAHDNDI-GNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSD-------CGSPPRSNSMALTVIINDENDNAPFIECPENFI--IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVL-KLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQI---TITIGCKDQGSPSFTTTAYVHVTIKDMND----VPPSLVSYSMNPSVAEHMPKGTV---VQTLSVIDPDTGPG----GEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILR--DNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATI-YFHDDDINQNAQLTYFIHESEKPYFILHPDS-------GNLKLNSTCSVSDL---GSFRLVIKVQDN 2447
            ++ K+++AP    +Q+ P     I +D+++ELN  IL                Y+LT      +K   K+ Q       NE +++  ++ LD E+ + Y + + A D      ++ +    V + D+ND  P+F+   ++L +  I E+           G+ I T+ A D D  G  +++ + +  +  +    +HF I++ TG I    + DRE  +   L V  SD         + P  +++ + ++IND NDNAP  E  + +I  ++E+ GE   V  IKA D+D    SN    LI             T   T ++K+             LD E    Y LV++  D    R + +  + I + D NDN P F +  +   V+E  V++  VL  + A+D D    +  + + +     D  F I + SG +  ++ +D +    +      +   D         A V V ++D+ND     P  L  Y        H   G     VQ     DP T       G V   L+  E+  VFR       +      DREI+ +   ++ +R  D G P       +TI ++D+NDN         +P  + +    S     PIG ++ +   F  D+  ++   TY + E E  YF +  D        G L++       D+     F L I+V D 
Sbjct: 1083 VLDKQQKAPK---WQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS--RVASTKTFVVEVRDVNDVVPQFT---VDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGE-ANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFE-EQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAG-GGRIPFGVRTDSGTIFVKEP------------LDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHS-DGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGES--VFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDN---------APFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSE-ESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG 1750          

HSP 3 Score: 95.9005 bits (237), Expect = 1.303e-19
Identity = 127/494 (25.71%), Postives = 226/494 (45.75%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKY-IQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDS-YAMEHFFINKSTGAIHVWNELDR----EIYESVHLFVIVSDCGS----PPRSNSMALTVIIN--DENDNAP-FIECPENFIIEE-----NRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI----------ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSP-SFTTTAYVHVTIKDMNDVPP 1874
            +E  + +TIR+  +D+NDN P F  P +T  ++E+  P +     +  A+D+D   N++I Y + NH   F+I    +I+ ++++   Q    E+   Y   + A D G+P SLS S  + +   + ND    F   S    + F++E A+ G  +  I A D D     ++ +S  +K   S   M  F I++ TG + + + +      E    ++L VIV D GS    P ++++   T++I   D N+N P F +C +   I +      + +  T+  ++A D DS A+ +    L        +   + + ++    +++ V T   S   + DRE      + +   D G   L      S+ V D NDN P F R ++E  V   +   +SV+ + A DND   NA++ Y +            ++D   ++N+ SG++  I+PI  +  K I   I   D G P +  ++A V + + D     P
Sbjct:  622 RESHVDLTIRI--DDVNDNVPTFTRPLYTAQVRED-IPLNQTILKV-TAVDKDTGDNSRITYSVDNHN--FSINSNGEISAKVRLDADQL--NERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQ--YTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSL--------YYTQSESRKAFVIDRQTGVLT--PSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVI-ADDNGIPEALQSSAQVTLNVLDKQQKAP 1091          

HSP 4 Score: 92.4337 bits (228), Expect = 1.541e-18
Identity = 175/730 (23.97%), Postives = 308/730 (42.19%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDR------EKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDI--NDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHD----NDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECP-ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSP-RLSNSKLISILVSDQNDNIP-FFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLY-FIITNVDHT-----FMINQTSGDL---YQIEPIDF-ERHKQITITIGCKDQGS----PSFTTTAYVH--VTIKDMNDVPPSLVSYSMNPSVAEHMPKGT------VVQTLSVIDPDTGPGGEVSVALL--PWENKFVF---RNLNLLT---NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI---------HESEKPYF-ILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPR-LFSLLELIIHVVDGPSSNPDY 2522
            TIR+ V DI D PP F      ++      P+        +A D+  + ++ +LY+        TI  I  A    + P   + R      E+ D Y I  +A+D    D+ +  L+  V I++I  ++  P+F+K+      V +SE   +  ++  + A       D  +   + +SL E  T     + F I+ STG IH+   LD +      L  +        R + + LT+ I+D NDN P    P     + E+     T+  + A D D+G +S  +  + N          N ++ S   I   +     L    + +R  +  Y   +   D+G P  LS+S +I I   + ND    F   S +   V E+    + V++++A D D     ++ Y F+  N   T     F I++ +G +   + +   D  E    I +T+  +D GS    PS T T+Y    + I+D+N+  P     +    +A+ M +GT       +  +   D D+   G++  +L     E++  F   R   +LT   ++ FDRE   +  + V   D G   L      ++ + DINDN P+          + S +T S S  E +G S+ T++  D+D   NA++TY +         H+++  +F +++  SG + L     +     F   +   DNG P  L S  ++ ++V+D     P +
Sbjct:  408 TIRIHVADI-DEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLYK--------TIDVIP-AGSFIVDPKSGVVRTGWSKYERGDTYRISAQAMDLSPSDNTTSQLS-EVAILEILADERPPQFAKQEY---EVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSL-EGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN---------HNFSINSNGEISAKV----RLDADQLNERHFV--YRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIM-EGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFE--------RPSYET-SVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK-TQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW 1093          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 211.46 bits (537), Expect = 2.984e-55
Identity = 196/706 (27.76%), Postives = 319/706 (45.18%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELK-------IAPLQTLDREKKDKYLIIIEAIDCGKPDS--LSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIG---QTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSG-DLYQI-EPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL-------LPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHES--EKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            T++V V D ND+ P F+   F   I+E           I + A DQDI  NA+I Y +    D   +   Q     +       I+   +LDRE  D Y +++ A D     S   + + ++ V ++D ND+ P+FS+ +    +V + E    G    T+A I A D D GNN+ +++++    T S     F I+  +G + +   LD E   S  L +   D GSP RSN+  L V + D NDNAP     +    +E+  E   VG+    ++A+D D GA++  +  +   +  ++F L+      T +++          T   LDRE    ++  ++  D G P  S S  + I V D NDN P F+   +E  V E++   + V  + A+D D   ++ L Y I T N    F I   +G  L  I + +D+++ K+  +T+   D G  S   TA VH+ I D N+  P   +   + SV E  P GT V  +S  D D G   +++ +L       L   + F    +   ++TN   DRE    Y + V  +D G P L+++  + I ++D+NDN         +P  K      S      +G S+  +   D D+  N ++ Y + +   E   F++ P SG ++ N       +  F L     D G+P L S +E+ I + D   S P +A
Sbjct:  449 TLQVNVLDCNDHSPTFEAEQFEASIREGATVGS---TVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY---TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS----QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ---FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI--SERDDNFPLA--VDPRTGWVQ----------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDN---------APAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA 1114          

HSP 2 Score: 210.69 bits (535), Expect = 5.051e-55
Identity = 179/700 (25.57%), Postives = 320/700 (45.71%), Query Frame = 3
Query:  507 RVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQ-TLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEH------FFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPP---RSNSMALTVIINDENDNAP-FIECPENFIIEENR---GELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN---LLT---NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHE-------SEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            R +  ++ +  P F+   +   + EEQ        ++     +D E ++ ++Y + +  D  +    ++ +   +     +LDRE  D +   + A D   P   SG+  L VN++D ND  P F  E        I E A +G T+ T+ A D DIG N+++++ + E +TD   +        F I+  +G I   + LDRE  +S HL V  +D  S     R+ + ++ V + D+NDN P F E      + E++    E +TV  I+A D D G ++     +I     + F + +++               ++S    LD E++ +Y LVI   D GSP  SN+  + + V D NDN P F+ S F+  V+EN     ++++++A D+D G NA++ Y I    D+    ++  +G +  I+P+D E   +    +  KD G P  + ++ V +T++D+ND  P+        +V E  P GT V T++  DPD        +       +F   + N   L+T   +L++ +E   ++ + V   D+G    T ++   I I+D N+  P   +         +  + S     P+G ++  +   D D+  NAQ+TY ++E       S  P F ++P +G +  N+         + L +  +D G P L    ++ I V D   + P +
Sbjct:  346 RRVRRELRNQSPYFEQALYVASVLEEQPAG----AAVTTVRARDPE-DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPR-SGTTTLQVNVLDCNDHSPTFEAEQF---EASIREGATVGSTVITLRATDQDIGKNAEIEYGI-EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS--------------GDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQE--KRFLLTVAATDSGGRSDTATV--HINITDANNFAPIFEN---------APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF 1007          

HSP 3 Score: 188.734 bits (478), Expect = 4.373e-48
Identity = 193/751 (25.70%), Postives = 328/751 (43.68%), Query Frame = 3
Query:  384 SKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVT--IRVIVNDINDNPPIFQLPNFTIMIKEEQ-APSDWNYQSIPIAIDQDIELNAKILYRLT--NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL----STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI-------ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPW---ENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI---HESEKPYFILHPDSGNLKLNSTCSV---SDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNP---DYAII-TNFR 2543
            S+S + S+    + E  +    ++ +  L   Q      T  ++V V D NDN P F    +T+ + E+Q   ++ N  +   A D D   NA I Y +   N + +F+I  +       ++ ++ LD E    Y ++I A D G P S S +  L VN+ID ND+ PRF           + E   +G  I  + A+D+D G N+++ +S++E+  D++ +    ++  TG +     LDRE        V+  D G PP+S S ++ + + D NDN P    P+ +  E N GE     + V  + A D D    S    ++        F +++        I +S            LD +    + L +   D+G    S++  + I ++D N+  P F  + +   V E+    ++VL + A+D+D+G+NA + Y +       + + D  F IN  +G +    P+D E      +T+  KD G+PS + T  V + + D+ND  P+  S     S+ E    GT V  ++  DPD G  G +   L      +  FV    +  + TN   DRE    + +  I  D G P L++++ + I + D+ND+ P                T+      P+G  +  I+ HD D   NA + Y I    +S     +  P S   +L +   +   S    F LV++     +P L +   + I V D   + P   D+ +I  NFR
Sbjct:  525 SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS----GDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQ---ESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER-DDNFPLA---VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYY--EANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQS------------LDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPD-PFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFAS---------DKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFR 1231          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 211.46 bits (537), Expect = 3.256e-55
Identity = 196/706 (27.76%), Postives = 319/706 (45.18%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELK-------IAPLQTLDREKKDKYLIIIEAIDCGKPDS--LSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIG---QTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSG-DLYQI-EPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL-------LPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHES--EKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            T++V V D ND+ P F+   F   I+E           I + A DQDI  NA+I Y +    D   +   Q     +       I+   +LDRE  D Y +++ A D     S   + + ++ V ++D ND+ P+FS+ +    +V + E    G    T+A I A D D GNN+ +++++    T S     F I+  +G + +   LD E   S  L +   D GSP RSN+  L V + D NDNAP     +    +E+  E   VG+    ++A+D D GA++  +  +   +  ++F L+      T +++          T   LDRE    ++  ++  D G P  S S  + I V D NDN P F+   +E  V E++   + V  + A+D D   ++ L Y I T N    F I   +G  L  I + +D+++ K+  +T+   D G  S   TA VH+ I D N+  P   +   + SV E  P GT V  +S  D D G   +++ +L       L   + F    +   ++TN   DRE    Y + V  +D G P L+++  + I ++D+NDN         +P  K      S      +G S+  +   D D+  N ++ Y + +   E   F++ P SG ++ N       +  F L     D G+P L S +E+ I + D   S P +A
Sbjct:  449 TLQVNVLDCNDHSPTFEAEQFEASIREGATVGS---TVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY---TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS----QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ---FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI--SERDDNFPLA--VDPRTGWVQ----------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDN---------APAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA 1114          

HSP 2 Score: 210.69 bits (535), Expect = 5.416e-55
Identity = 179/700 (25.57%), Postives = 320/700 (45.71%), Query Frame = 3
Query:  507 RVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQ-TLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEH------FFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPP---RSNSMALTVIINDENDNAP-FIECPENFIIEENR---GELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN---LLT---NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHE-------SEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            R +  ++ +  P F+   +   + EEQ        ++     +D E ++ ++Y + +  D  +    ++ +   +     +LDRE  D +   + A D   P   SG+  L VN++D ND  P F  E        I E A +G T+ T+ A D DIG N+++++ + E +TD   +        F I+  +G I   + LDRE  +S HL V  +D  S     R+ + ++ V + D+NDN P F E      + E++    E +TV  I+A D D G ++     +I     + F + +++               ++S    LD E++ +Y LVI   D GSP  SN+  + + V D NDN P F+ S F+  V+EN     ++++++A D+D G NA++ Y I    D+    ++  +G +  I+P+D E   +    +  KD G P  + ++ V +T++D+ND  P+        +V E  P GT V T++  DPD        +       +F   + N   L+T   +L++ +E   ++ + V   D+G    T ++   I I+D N+  P   +         +  + S     P+G ++  +   D D+  NAQ+TY ++E       S  P F ++P +G +  N+         + L +  +D G P L    ++ I V D   + P +
Sbjct:  346 RRVRRELRNQSPYFEQALYVASVLEEQPAG----AAVTTVRARDPE-DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPR-SGTTTLQVNVLDCNDHSPTFEAEQF---EASIREGATVGSTVITLRATDQDIGKNAEIEYGI-EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS--------------GDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQE--KRFLLTVAATDSGGRSDTATV--HINITDANNFAPIFEN---------APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF 1007          

HSP 3 Score: 188.734 bits (478), Expect = 4.768e-48
Identity = 193/751 (25.70%), Postives = 328/751 (43.68%), Query Frame = 3
Query:  384 SKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVT--IRVIVNDINDNPPIFQLPNFTIMIKEEQ-APSDWNYQSIPIAIDQDIELNAKILYRLT--NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL----STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI-------ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPW---ENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI---HESEKPYFILHPDSGNLKLNSTCSV---SDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNP---DYAII-TNFR 2543
            S+S + S+    + E  +    ++ +  L   Q      T  ++V V D NDN P F    +T+ + E+Q   ++ N  +   A D D   NA I Y +   N + +F+I  +       ++ ++ LD E    Y ++I A D G P S S +  L VN+ID ND+ PRF           + E   +G  I  + A+D+D G N+++ +S++E+  D++ +    ++  TG +     LDRE        V+  D G PP+S S ++ + + D NDN P    P+ +  E N GE     + V  + A D D    S    ++        F +++        I +S            LD +    + L +   D+G    S++  + I ++D N+  P F  + +   V E+    ++VL + A+D+D+G+NA + Y +       + + D  F IN  +G +    P+D E      +T+  KD G+PS + T  V + + D+ND  P+  S     S+ E    GT V  ++  DPD G  G +   L      +  FV    +  + TN   DRE    + +  I  D G P L++++ + I + D+ND+ P                T+      P+G  +  I+ HD D   NA + Y I    +S     +  P S   +L +   +   S    F LV++     +P L +   + I V D   + P   D+ +I  NFR
Sbjct:  525 SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS----GDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQ---ESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER-DDNFPLA---VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYY--EANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQS------------LDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPD-PFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFAS---------DKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFR 1231          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 211.46 bits (537), Expect = 3.256e-55
Identity = 196/706 (27.76%), Postives = 319/706 (45.18%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELK-------IAPLQTLDREKKDKYLIIIEAIDCGKPDS--LSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIG---QTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSG-DLYQI-EPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL-------LPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHES--EKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            T++V V D ND+ P F+   F   I+E           I + A DQDI  NA+I Y +    D   +   Q     +       I+   +LDRE  D Y +++ A D     S   + + ++ V ++D ND+ P+FS+ +    +V + E    G    T+A I A D D GNN+ +++++    T S     F I+  +G + +   LD E   S  L +   D GSP RSN+  L V + D NDNAP     +    +E+  E   VG+    ++A+D D GA++  +  +   +  ++F L+      T +++          T   LDRE    ++  ++  D G P  S S  + I V D NDN P F+   +E  V E++   + V  + A+D D   ++ L Y I T N    F I   +G  L  I + +D+++ K+  +T+   D G  S   TA VH+ I D N+  P   +   + SV E  P GT V  +S  D D G   +++ +L       L   + F    +   ++TN   DRE    Y + V  +D G P L+++  + I ++D+NDN         +P  K      S      +G S+  +   D D+  N ++ Y + +   E   F++ P SG ++ N       +  F L     D G+P L S +E+ I + D   S P +A
Sbjct:  449 TLQVNVLDCNDHSPTFEAEQFEASIREGATVGS---TVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY---TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS----QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ---FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI--SERDDNFPLA--VDPRTGWVQ----------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDN---------APAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA 1114          

HSP 2 Score: 210.69 bits (535), Expect = 5.416e-55
Identity = 179/700 (25.57%), Postives = 320/700 (45.71%), Query Frame = 3
Query:  507 RVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQ-TLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEH------FFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPP---RSNSMALTVIINDENDNAP-FIECPENFIIEENR---GELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN---LLT---NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHE-------SEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            R +  ++ +  P F+   +   + EEQ        ++     +D E ++ ++Y + +  D  +    ++ +   +     +LDRE  D +   + A D   P   SG+  L VN++D ND  P F  E        I E A +G T+ T+ A D DIG N+++++ + E +TD   +        F I+  +G I   + LDRE  +S HL V  +D  S     R+ + ++ V + D+NDN P F E      + E++    E +TV  I+A D D G ++     +I     + F + +++               ++S    LD E++ +Y LVI   D GSP  SN+  + + V D NDN P F+ S F+  V+EN     ++++++A D+D G NA++ Y I    D+    ++  +G +  I+P+D E   +    +  KD G P  + ++ V +T++D+ND  P+        +V E  P GT V T++  DPD        +       +F   + N   L+T   +L++ +E   ++ + V   D+G    T ++   I I+D N+  P   +         +  + S     P+G ++  +   D D+  NAQ+TY ++E       S  P F ++P +G +  N+         + L +  +D G P L    ++ I V D   + P +
Sbjct:  346 RRVRRELRNQSPYFEQALYVASVLEEQPAG----AAVTTVRARDPE-DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPR-SGTTTLQVNVLDCNDHSPTFEAEQF---EASIREGATVGSTVITLRATDQDIGKNAEIEYGI-EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS--------------GDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQE--KRFLLTVAATDSGGRSDTATV--HINITDANNFAPIFEN---------APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF 1007          

HSP 3 Score: 188.734 bits (478), Expect = 4.768e-48
Identity = 193/751 (25.70%), Postives = 328/751 (43.68%), Query Frame = 3
Query:  384 SKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVT--IRVIVNDINDNPPIFQLPNFTIMIKEEQ-APSDWNYQSIPIAIDQDIELNAKILYRLT--NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL----STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI-------ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPW---ENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI---HESEKPYFILHPDSGNLKLNSTCSV---SDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNP---DYAII-TNFR 2543
            S+S + S+    + E  +    ++ +  L   Q      T  ++V V D NDN P F    +T+ + E+Q   ++ N  +   A D D   NA I Y +   N + +F+I  +       ++ ++ LD E    Y ++I A D G P S S +  L VN+ID ND+ PRF           + E   +G  I  + A+D+D G N+++ +S++E+  D++ +    ++  TG +     LDRE        V+  D G PP+S S ++ + + D NDN P    P+ +  E N GE     + V  + A D D    S    ++        F +++        I +S            LD +    + L +   D+G    S++  + I ++D N+  P F  + +   V E+    ++VL + A+D+D+G+NA + Y +       + + D  F IN  +G +    P+D E      +T+  KD G+PS + T  V + + D+ND  P+  S     S+ E    GT V  ++  DPD G  G +   L      +  FV    +  + TN   DRE    + +  I  D G P L++++ + I + D+ND+ P                T+      P+G  +  I+ HD D   NA + Y I    +S     +  P S   +L +   +   S    F LV++     +P L +   + I V D   + P   D+ +I  NFR
Sbjct:  525 SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS----GDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQ---ESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER-DDNFPLA---VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYY--EANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQS------------LDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPD-PFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFAS---------DKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFR 1231          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 211.46 bits (537), Expect = 3.410e-55
Identity = 196/706 (27.76%), Postives = 319/706 (45.18%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELK-------IAPLQTLDREKKDKYLIIIEAIDCGKPDS--LSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIG---QTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSG-DLYQI-EPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL-------LPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHES--EKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            T++V V D ND+ P F+   F   I+E           I + A DQDI  NA+I Y +    D   +   Q     +       I+   +LDRE  D Y +++ A D     S   + + ++ V ++D ND+ P+FS+ +    +V + E    G    T+A I A D D GNN+ +++++    T S     F I+  +G + +   LD E   S  L +   D GSP RSN+  L V + D NDNAP     +    +E+  E   VG+    ++A+D D GA++  +  +   +  ++F L+      T +++          T   LDRE    ++  ++  D G P  S S  + I V D NDN P F+   +E  V E++   + V  + A+D D   ++ L Y I T N    F I   +G  L  I + +D+++ K+  +T+   D G  S   TA VH+ I D N+  P   +   + SV E  P GT V  +S  D D G   +++ +L       L   + F    +   ++TN   DRE    Y + V  +D G P L+++  + I ++D+NDN         +P  K      S      +G S+  +   D D+  N ++ Y + +   E   F++ P SG ++ N       +  F L     D G+P L S +E+ I + D   S P +A
Sbjct:  449 TLQVNVLDCNDHSPTFEAEQFEASIREGATVGS---TVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY---TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS----QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ---FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI--SERDDNFPLA--VDPRTGWVQ----------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDN---------APAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA 1114          

HSP 2 Score: 210.69 bits (535), Expect = 5.574e-55
Identity = 179/700 (25.57%), Postives = 320/700 (45.71%), Query Frame = 3
Query:  507 RVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQ-TLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEH------FFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPP---RSNSMALTVIINDENDNAP-FIECPENFIIEENR---GELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN---LLT---NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHE-------SEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            R +  ++ +  P F+   +   + EEQ        ++     +D E ++ ++Y + +  D  +    ++ +   +     +LDRE  D +   + A D   P   SG+  L VN++D ND  P F  E        I E A +G T+ T+ A D DIG N+++++ + E +TD   +        F I+  +G I   + LDRE  +S HL V  +D  S     R+ + ++ V + D+NDN P F E      + E++    E +TV  I+A D D G ++     +I     + F + +++               ++S    LD E++ +Y LVI   D GSP  SN+  + + V D NDN P F+ S F+  V+EN     ++++++A D+D G NA++ Y I    D+    ++  +G +  I+P+D E   +    +  KD G P  + ++ V +T++D+ND  P+        +V E  P GT V T++  DPD        +       +F   + N   L+T   +L++ +E   ++ + V   D+G    T ++   I I+D N+  P   +         +  + S     P+G ++  +   D D+  NAQ+TY ++E       S  P F ++P +G +  N+         + L +  +D G P L    ++ I V D   + P +
Sbjct:  346 RRVRRELRNQSPYFEQALYVASVLEEQPAG----AAVTTVRARDPE-DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPR-SGTTTLQVNVLDCNDHSPTFEAEQF---EASIREGATVGSTVITLRATDQDIGKNAEIEYGI-EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS--------------GDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQE--KRFLLTVAATDSGGRSDTATV--HINITDANNFAPIFEN---------APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF 1007          

HSP 3 Score: 188.734 bits (478), Expect = 4.778e-48
Identity = 193/751 (25.70%), Postives = 328/751 (43.68%), Query Frame = 3
Query:  384 SKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVT--IRVIVNDINDNPPIFQLPNFTIMIKEEQ-APSDWNYQSIPIAIDQDIELNAKILYRLT--NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL----STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI-------ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPW---ENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI---HESEKPYFILHPDSGNLKLNSTCSV---SDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNP---DYAII-TNFR 2543
            S+S + S+    + E  +    ++ +  L   Q      T  ++V V D NDN P F    +T+ + E+Q   ++ N  +   A D D   NA I Y +   N + +F+I  +       ++ ++ LD E    Y ++I A D G P S S +  L VN+ID ND+ PRF           + E   +G  I  + A+D+D G N+++ +S++E+  D++ +    ++  TG +     LDRE        V+  D G PP+S S ++ + + D NDN P    P+ +  E N GE     + V  + A D D    S    ++        F +++        I +S            LD +    + L +   D+G    S++  + I ++D N+  P F  + +   V E+    ++VL + A+D+D+G+NA + Y +       + + D  F IN  +G +    P+D E      +T+  KD G+PS + T  V + + D+ND  P+  S     S+ E    GT V  ++  DPD G  G +   L      +  FV    +  + TN   DRE    + +  I  D G P L++++ + I + D+ND+ P                T+      P+G  +  I+ HD D   NA + Y I    +S     +  P S   +L +   +   S    F LV++     +P L +   + I V D   + P   D+ +I  NFR
Sbjct:  525 SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS----GDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQ---ESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER-DDNFPLA---VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYY--EANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQS------------LDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPD-PFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFAS---------DKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFR 1231          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0330601)

HSP 1 Score: 211.075 bits (536), Expect = 3.737e-55
Identity = 196/706 (27.76%), Postives = 319/706 (45.18%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELK-------IAPLQTLDREKKDKYLIIIEAIDCGKPDS--LSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIG---QTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSG-DLYQI-EPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL-------LPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHES--EKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            T++V V D ND+ P F+   F   I+E           I + A DQDI  NA+I Y +    D   +   Q     +       I+   +LDRE  D Y +++ A D     S   + + ++ V ++D ND+ P+FS+ +    +V + E    G    T+A I A D D GNN+ +++++    T S     F I+  +G + +   LD E   S  L +   D GSP RSN+  L V + D NDNAP     +    +E+  E   VG+    ++A+D D GA++  +  +   +  ++F L+      T +++          T   LDRE    ++  ++  D G P  S S  + I V D NDN P F+   +E  V E++   + V  + A+D D   ++ L Y I T N    F I   +G  L  I + +D+++ K+  +T+   D G  S   TA VH+ I D N+  P   +   + SV E  P GT V  +S  D D G   +++ +L       L   + F    +   ++TN   DRE    Y + V  +D G P L+++  + I ++D+NDN         +P  K      S      +G S+  +   D D+  N ++ Y + +   E   F++ P SG ++ N       +  F L     D G+P L S +E+ I + D   S P +A
Sbjct:  449 TLQVNVLDCNDHSPTFEAEQFEASIREGATVGS---TVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY---TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS----QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ---FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI--SERDDNFPLA--VDPRTGWVQ----------TIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRS--DTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDN---------APAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFA 1114          

HSP 2 Score: 210.69 bits (535), Expect = 5.846e-55
Identity = 179/700 (25.57%), Postives = 320/700 (45.71%), Query Frame = 3
Query:  507 RVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQ-TLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEH------FFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPP---RSNSMALTVIINDENDNAP-FIECPENFIIEENR---GELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN---LLT---NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHE-------SEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            R +  ++ +  P F+   +   + EEQ        ++     +D E ++ ++Y + +  D  +    ++ +   +     +LDRE  D +   + A D   P   SG+  L VN++D ND  P F  E        I E A +G T+ T+ A D DIG N+++++ + E +TD   +        F I+  +G I   + LDRE  +S HL V  +D  S     R+ + ++ V + D+NDN P F E      + E++    E +TV  I+A D D G ++     +I     + F + +++               ++S    LD E++ +Y LVI   D GSP  SN+  + + V D NDN P F+ S F+  V+EN     ++++++A D+D G NA++ Y I    D+    ++  +G +  I+P+D E   +    +  KD G P  + ++ V +T++D+ND  P+        +V E  P GT V T++  DPD        +       +F   + N   L+T   +L++ +E   ++ + V   D+G    T ++   I I+D N+  P   +         +  + S     P+G ++  +   D D+  NAQ+TY ++E       S  P F ++P +G +  N+         + L +  +D G P L    ++ I V D   + P +
Sbjct:  346 RRVRRELRNQSPYFEQALYVASVLEEQPAG----AAVTTVRARDPE-DSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPR-SGTTTLQVNVLDCNDHSPTFEAEQF---EASIREGATVGSTVITLRATDQDIGKNAEIEYGI-EAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS--------------GDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQE--KRFLLTVAATDSGGRSDTATV--HINITDANNFAPIFEN---------APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF 1007          

HSP 3 Score: 188.348 bits (477), Expect = 5.007e-48
Identity = 193/751 (25.70%), Postives = 328/751 (43.68%), Query Frame = 3
Query:  384 SKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVT--IRVIVNDINDNPPIFQLPNFTIMIKEEQ-APSDWNYQSIPIAIDQDIELNAKILYRLT--NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL----STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI-------ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPW---ENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI---HESEKPYFILHPDSGNLKLNSTCSV---SDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNP---DYAII-TNFR 2543
            S+S + S+    + E  +    ++ +  L   Q      T  ++V V D NDN P F    +T+ + E+Q   ++ N  +   A D D   NA I Y +   N + +F+I  +       ++ ++ LD E    Y ++I A D G P S S +  L VN+ID ND+ PRF           + E   +G  I  + A+D+D G N+++ +S++E+  D++ +    ++  TG +     LDRE        V+  D G PP+S S ++ + + D NDN P    P+ +  E N GE     + V  + A D D    S    ++        F +++        I +S            LD +    + L +   D+G    S++  + I ++D N+  P F  + +   V E+    ++VL + A+D+D+G+NA + Y +       + + D  F IN  +G +    P+D E      +T+  KD G+PS + T  V + + D+ND  P+  S     S+ E    GT V  ++  DPD G  G +   L      +  FV    +  + TN   DRE    + +  I  D G P L++++ + I + D+ND+ P                T+      P+G  +  I+ HD D   NA + Y I    +S     +  P S   +L +   +   S    F LV++     +P L +   + I V D   + P   D+ +I  NFR
Sbjct:  525 SRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMS----GDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQ---ESVLENVPVGYNIIRVQAYDSDEGANAEITYSISER-DDNFPLA---VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-PKYY--EANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQS------------LDYKQEKRFLLTVAATDSGGR--SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPD-PFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFAS---------DKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFR 1231          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 289.271 bits (739), Expect = 3.682e-82
Identity = 230/806 (28.54%), Postives = 382/806 (47.39%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKL--CRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEF--QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL---------STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHV 2492
            Y ++EEQ P   +G++  D  L     L +LE       P+ +   K   I+           +  +DRE L  CR                    N  K CF+   +S+ +    +   ++  R+ V DINDN P F  P  T+ + E          SIP+A D+D E N    Y LT   +   +  +Q+A +      ++  L +LDRE KD Y + I+A+D G P   S +L L V I D ND+ P+F K S       ++E + IG ++  + A+D+D+G N +++++L++ +     +    I++S+G I+V   LDRE   ++  +V+  D G  P+S+   +++ + D+NDNAP +E     ++  + G           + V  ++  D D G ++  +C +    P   F+L   +  S    +K     + L TT+ LD E +  Y + I+  D+G+P LS++  + + V+D NDN P F  + FE++  E       V+++ ASD D G NA+L+Y II  ++    F I+  SG++    P+D E   +    +   D+G PS   TA V + + D ND  P  +    + SV E+MP  + V  ++V D D G   +V +++ P   KFV +N    +L+++ FDRE    Y+  +   D G P  ++ + +TI + D NDN P +T    S  +++S      S  E        +   D D   NA+L Y I     P+  F + P +G + L    +    G  RLVIKV D G P   ++  + I+V
Sbjct:   27 YRVHEEQPPSTLIGSLAADQGLPDTGHLYKLEVGA----PYLRVDGKTGDIF---------TTEIPIDRETLKDCR--------------------NKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALF--SIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSAL-LRVVIADANDNAPKFEKSSYE---AEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKL--LRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP---FQLRPASDSSVDNKRK-----YFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVE-------VVEAEDIDSGSNAELVYSI-AGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYV 775          

HSP 2 Score: 144.821 bits (364), Expect = 1.025e-34
Identity = 115/408 (28.19%), Postives = 188/408 (46.08%), Query Frame = 3
Query: 1440 LDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI---ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPS-------LVSYSMN-PSVAEHMPKGTVVQTLSVIDPDTGP--------GGEVSVALLPWENKFV--FRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI--HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVI 2594
            LDRE   +Y L I   D G+P   +S L+ ++++D NDN P F +S++E +V EN     SVL++KA+D+D+G N ++ Y +   I  V     I+++SG +Y   P+D E    +   +  +D+G    ++  YV + + D ND  P+       LV++S    +++E MP GT V  + V D D G          G+V   L P  +  V   R   L T    D E    Y + ++  D+G P L+++  L + ++D NDN P     I SP +      + F+ +   G  +  +   D D   NA+L Y I    S +  F + P+SG ++  S         +   +   D G P       ++I V+D   ++P +               L G SFSV+
Sbjct:  201 LDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSP-----IFSPTLF----EVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKF--------------MLSGYSFSVL 585          

HSP 3 Score: 130.183 bits (326), Expect = 3.438e-30
Identity = 113/382 (29.58%), Postives = 182/382 (47.64%), Query Frame = 3
Query:  738 LQT---LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKP-TNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHR---SNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHT-FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKD 1856
            LQT   LD E+   Y + I A+D G P +LS + +L V + D ND+ P FS     L  V  +E+ + G+ +  + A D D G N++L +S+   + DS     F I+ ++G +   + LDRE  +     V  +D G P    +  + + + D NDN P F+    +F + EN   LS VG +   DMD G ++      ++++P    F + N     T  I  SI F          DRE  S+Y+  +   D G P  S+   ++I V D+NDN P   +   S+F I++       S V  ++A D D G NA+L+Y I     H  F I+ ++G++   + +  +      + I   D+G PS    A VH+ + +
Sbjct:  421 LQTTTPLDYERVRDYRVEIVAVDSGNP-ALSSTNSLKVQVTDTNDNSPIFSP---TLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSI---IADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQ---LSVEPDVGKFVIQN----GTGTILSSISF----------DREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSF-IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNE 777          

HSP 4 Score: 117.472 bits (293), Expect = 3.254e-26
Identity = 103/357 (28.85%), Postives = 160/357 (44.82%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQI-ANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPEN--FI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNI 1559
            +++V V D NDN PIF    F +   EE  P +   + +  A D D   NA+++Y +    D  T    +I  N  ++     LDRE KD+Y   + A D G P S  G+  + + ++D ND+ P+F    L+  S  + E       +  +   D D G N+++Q S+   +        F I   TG I      DRE   S    +   D G PPRS+ + +T+ + DENDNAP +  P N  FI +       S V  ++A D+DSG+++     +    P + F           YI  S     E++ T  L R++   + LVI   D G P      L+ I V++   N+
Sbjct:  454 SLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVV--ASDADSGTNAELVYSII--ADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVP-SHRGTATVVIKVLDRNDNDPKFM---LSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVG------KFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLF-----------YISPS---NGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANV 782          

HSP 5 Score: 73.9442 bits (180), Expect = 9.011e-13
Identity = 70/252 (27.78%), Postives = 114/252 (45.24%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAI----DQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVI-VSDCGSPPRSNSMALTVIINDENDNAPFIEC 1220
              G   V I+V+  D NDN P F L  ++  + E   P        P+ +    D D   NA++   +     KF I+         I    + DREK+  Y   ++A+D G P   S  + +T+N++D ND+ P  +K S N   + +S  A     +  + A D D G+N++L +S+          + F+I+ S G I +  EL R+ +  +H  VI VSD G P R     + + +N+   N   +E 
Sbjct:  555 HRGTATVVIKVL--DRNDNDPKFMLSGYSFSVLENMPPLS------PVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQ----NGTGTILSSISFDREKESSYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVVTKPS-NSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSI----AGGNPHDLFYISPSNGEITLTKELTRK-HSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVSHVEA 787          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 289.271 bits (739), Expect = 2.377e-81
Identity = 230/806 (28.54%), Postives = 382/806 (47.39%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKL--CRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEF--QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL---------STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHV 2492
            Y ++EEQ P   +G++  D  L     L +LE       P+ +   K   I+           +  +DRE L  CR                    N  K CF+   +S+ +    +   ++  R+ V DINDN P F  P  T+ + E          SIP+A D+D E N    Y LT   +   +  +Q+A +      ++  L +LDRE KD Y + I+A+D G P   S +L L V I D ND+ P+F K S       ++E + IG ++  + A+D+D+G N +++++L++ +     +    I++S+G I+V   LDRE   ++  +V+  D G  P+S+   +++ + D+NDNAP +E     ++  + G           + V  ++  D D G ++  +C +    P   F+L   +  S    +K     + L TT+ LD E +  Y + I+  D+G+P LS++  + + V+D NDN P F  + FE++  E       V+++ ASD D G NA+L+Y II  ++    F I+  SG++    P+D E   +    +   D+G PS   TA V + + D ND  P  +    + SV E+MP  + V  ++V D D G   +V +++ P   KFV +N    +L+++ FDRE    Y+  +   D G P  ++ + +TI + D NDN P +T    S  +++S      S  E        +   D D   NA+L Y I     P+  F + P +G + L    +    G  RLVIKV D G P   ++  + I+V
Sbjct:   27 YRVHEEQPPSTLIGSLAADQGLPDTGHLYKLEVGA----PYLRVDGKTGDIF---------TTEIPIDRETLKDCR--------------------NKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENT--HMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSAL-LRVVIADANDNAPKFEKSSYE---AEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKL--LRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP---FQLRPASDSSVDNKRK-----YFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVE-------VVEAEDIDSGSNAELVYSI-AGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYV 775          

HSP 2 Score: 143.665 bits (361), Expect = 2.731e-34
Identity = 115/408 (28.19%), Postives = 188/408 (46.08%), Query Frame = 3
Query: 1440 LDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFI---ITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPS-------LVSYSMN-PSVAEHMPKGTVVQTLSVIDPDTGP--------GGEVSVALLPWENKFV--FRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI--HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVI 2594
            LDRE   +Y L I   D G+P   +S L+ ++++D NDN P F +S++E +V EN     SVL++KA+D+D+G N ++ Y +   I  V     I+++SG +Y   P+D E    +   +  +D+G    ++  YV + + D ND  P+       LV++S    +++E MP GT V  + V D D G          G+V   L P  +  V   R   L T    D E    Y + ++  D+G P L+++  L + ++D NDN P     I SP +      + F+ +   G  +  +   D D   NA+L Y I    S +  F + P+SG ++  S         +   +   D G P       ++I V+D   ++P +               L G SFSV+
Sbjct:  201 LDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSP-----IFSPTLF----EVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKF--------------MLSGYSFSVL 585          

HSP 3 Score: 130.568 bits (327), Expect = 3.657e-30
Identity = 113/382 (29.58%), Postives = 182/382 (47.64%), Query Frame = 3
Query:  738 LQT---LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKP-TNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHR---SNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHT-FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKD 1856
            LQT   LD E+   Y + I A+D G P +LS + +L V + D ND+ P FS     L  V  +E+ + G+ +  + A D D G N++L +S+   + DS     F I+ ++G +   + LDRE  +     V  +D G P    +  + + + D NDN P F+    +F + EN   LS VG +   DMD G ++      ++++P    F + N     T  I  SI F          DRE  S+Y+  +   D G P  S+   ++I V D+NDN P   +   S+F I++       S V  ++A D D G NA+L+Y I     H  F I+ ++G++   + +  +      + I   D+G PS    A VH+ + +
Sbjct:  421 LQTTTPLDYERVRDYRVEIVAVDSGNP-ALSSTNSLKVQVTDTNDNSPIFSP---TLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSI---IADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQ---LSVEPDVGKFVIQN----GTGTILSSISF----------DREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSF-IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNE 777          

HSP 4 Score: 117.472 bits (293), Expect = 3.882e-26
Identity = 103/357 (28.85%), Postives = 160/357 (44.82%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQI-ANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPEN--FI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNI 1559
            +++V V D NDN PIF    F +   EE  P +   + +  A D D   NA+++Y +    D  T    +I  N  ++     LDRE KD+Y   + A D G P S  G+  + + ++D ND+ P+F    L+  S  + E       +  +   D D G N+++Q S+   +        F I   TG I      DRE   S    +   D G PPRS+ + +T+ + DENDNAP +  P N  FI +       S V  ++A D+DSG+++     +    P + F           YI  S     E++ T  L R++   + LVI   D G P      L+ I V++   N+
Sbjct:  454 SLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVV--ASDADSGTNAELVYSII--ADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVP-SHRGTATVVIKVLDRNDNDPKFM---LSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVG------KFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLF-----------YISPS---NGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANV 782          

HSP 5 Score: 73.559 bits (179), Expect = 1.245e-12
Identity = 70/252 (27.78%), Postives = 114/252 (45.24%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAI----DQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVI-VSDCGSPPRSNSMALTVIINDENDNAPFIEC 1220
              G   V I+V+  D NDN P F L  ++  + E   P        P+ +    D D   NA++   +     KF I+         I    + DREK+  Y   ++A+D G P   S  + +T+N++D ND+ P  +K S N   + +S  A     +  + A D D G+N++L +S+          + F+I+ S G I +  EL R+ +  +H  VI VSD G P R     + + +N+   N   +E 
Sbjct:  555 HRGTATVVIKVL--DRNDNDPKFMLSGYSFSVLENMPPLS------PVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQ----NGTGTILSSISFDREKESSYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVVTKPS-NSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSI----AGGNPHDLFYISPSNGEITLTKELTRK-HSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVSHVEA 787          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 277.33 bits (708), Expect = 5.021e-78
Identity = 225/796 (28.27%), Postives = 379/796 (47.61%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIECP-------ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISF--SYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELI 2483
            Y++ EEQ   + +GN+  DL L+    +K    + L F P  + +    ++  +++  + L    ++DREKLC        S +F          + K C+  I +++L   E   +V IR ++ DINDN P+FQ     I I E  A +  +   +P A D DI +N    Y L     +F +  I+     K   L   Q+LDRE KD +++ I+  D G P   S ++ L V + D+ND++P F       + V + E A +G ++  + A D D+G+N+++ FS + +++ S    HF I+ +TG I V   LDRE+     L V+ SD  S P       TVI+N  D NDN P I+            ++ EN    + +  I   D DS  +   +C   +  P   F+L  V  +            F L T + LD E    Y++ I+  D+G P L+ S ++ I + D+NDN+P F +   ++ + EN    + ++K+ A+D D G NA ++Y +  +    F I+  SG L  ++ +D E+ ++ + T+  +D G+    +   V + ++D ND  P+      N  V E++P    V  ++V D D G    V+++++  ++ F+   +   +  N+ FDRE    Y+ +V   D G  + T+   +TI + D+NDNRP          +  SN +     S   P G  +  ++  D+D   NA+L Y  I  S +  F +   +GN+ L      +D G  RLV+KV+D G P     + L+
Sbjct:   28 YTVKEEQPENVRIGNLRKDLNLNLDPDIKL--SSALQFKPVYK-TGDVPLVKVEASTGEILTTANRIDREKLC--------SGVF----------NEKRCYYEIEVAVLP-DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAIN--SRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAI-LQVTVSDVNDNRPVFKDSE---VEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPS-TKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSR----ATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVP---FRLKPVFNDQ-----------FLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFV-------IPSSNYSYDLVPSNTSP-GSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQPESLHAIALV 768          

HSP 2 Score: 152.525 bits (384), Expect = 3.698e-37
Identity = 172/662 (25.98%), Postives = 293/662 (44.26%), Query Frame = 3
Query:  627 IDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREK--------KDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTG----AIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLIN-IKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIP------FFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIE---PIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLP-WENKFVFRNLNLLTNL--EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAI 2528
            +D DI+L++ + ++         +  ++ +    +     +DREK        K  Y  I  A+    PD +   + +   I DIND+ P F      +I++ I E   I        A D DIG N    + L + +++ + ++   I    G     + V   LDRE  ++  + + V D G+PP+S++  L V ++D NDN P  +  E  + + EN    ++V  + A D D G+++       N I P+     +   ++STT +         ++    LDRE    + L++L  D GS   S + +I + V+D NDN+P        +  N  + + EN    + +  +  +D D  +N  +  +  T+ D  F +     D + +E   P+D+E  ++  I I   D G P   T+A V + IKD ND  P      +  S+ E+   GT +  +S  D D+G    +  +L P   + F   + + + ++    DRE  +KYS  VI RDNG   L +++ + + + D NDN P  TH              +F   E  P+  ++  I   D D   NA +T  I    K  FI+ P +G +K N T       S+  V+K  D G  +  S  ++ I+VVD   + P + I
Sbjct:   51 LDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAV---LPDEIFRLVKIRFLIEDINDNAPLFQS---TVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSE-FGLD--IIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFA---IDSTTGL---------ITVKQPLDREVNPVHKLIVLASD-GSSTPSRATVI-VNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCY--TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTH-----------PEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIING-KDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVI 675          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 276.174 bits (705), Expect = 3.106e-77
Identity = 225/796 (28.27%), Postives = 379/796 (47.61%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIECP-------ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISF--SYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELI 2483
            Y++ EEQ   + +GN+  DL L+    +K    + L F P  + +    ++  +++  + L    ++DREKLC        S +F          + K C+  I +++L   E   +V IR ++ DINDN P+FQ     I I E  A +  +   +P A D DI +N    Y L     +F +  I+     K   L   Q+LDRE KD +++ I+  D G P   S ++ L V + D+ND++P F       + V + E A +G ++  + A D D+G+N+++ FS + +++ S    HF I+ +TG I V   LDRE+     L V+ SD  S P       TVI+N  D NDN P I+            ++ EN    + +  I   D DS  +   +C   +  P   F+L  V  +            F L T + LD E    Y++ I+  D+G P L+ S ++ I + D+NDN+P F +   ++ + EN    + ++K+ A+D D G NA ++Y +  +    F I+  SG L  ++ +D E+ ++ + T+  +D G+    +   V + ++D ND  P+      N  V E++P    V  ++V D D G    V+++++  ++ F+   +   +  N+ FDRE    Y+ +V   D G  + T+   +TI + D+NDNRP          +  SN +     S   P G  +  ++  D+D   NA+L Y  I  S +  F +   +GN+ L      +D G  RLV+KV+D G P     + L+
Sbjct:   28 YTVKEEQPENVRIGNLRKDLNLNLDPDIKL--SSALQFKPVYK-TGDVPLVKVEASTGEILTTANRIDREKLC--------SGVF----------NEKRCYYEIEVAVLP-DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAIN--SRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAI-LQVTVSDVNDNRPVFKDSE---VEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPS-TKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSR----ATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVP---FRLKPVFNDQ-----------FLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFV-------IPSSNYSYDLVPSNTSP-GSVVTRVFAIDNDTGMNAELQYSIIGGSLRGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQPESLHAIALV 768          

HSP 2 Score: 151.754 bits (382), Expect = 8.696e-37
Identity = 172/662 (25.98%), Postives = 293/662 (44.26%), Query Frame = 3
Query:  627 IDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREK--------KDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTG----AIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLIN-IKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIP------FFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIE---PIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLP-WENKFVFRNLNLLTNL--EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAI 2528
            +D DI+L++ + ++         +  ++ +    +     +DREK        K  Y  I  A+    PD +   + +   I DIND+ P F      +I++ I E   I        A D DIG N    + L + +++ + ++   I    G     + V   LDRE  ++  + + V D G+PP+S++  L V ++D NDN P  +  E  + + EN    ++V  + A D D G+++       N I P+     +   ++STT +         ++    LDRE    + L++L  D GS   S + +I + V+D NDN+P        +  N  + + EN    + +  +  +D D  +N  +  +  T+ D  F +     D + +E   P+D+E  ++  I I   D G P   T+A V + IKD ND  P      +  S+ E+   GT +  +S  D D+G    +  +L P   + F   + + + ++    DRE  +KYS  VI RDNG   L +++ + + + D NDN P  TH              +F   E  P+  ++  I   D D   NA +T  I    K  FI+ P +G +K N T       S+  V+K  D G  +  S  ++ I+VVD   + P + I
Sbjct:   51 LDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAV---LPDEIFRLVKIRFLIEDINDNAPLFQS---TVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSE-FGLD--IIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFA---IDSTTGL---------ITVKQPLDREVNPVHKLIVLASD-GSSTPSRATVI-VNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCY--TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTH-----------PEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIING-KDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVI 675          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 261.151 bits (666), Expect = 4.342e-72
Identity = 230/845 (27.22%), Postives = 382/845 (45.21%), Query Frame = 3
Query:   30 VNFRYFFFLYMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFE--------LSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE-KPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            ++ R FF L  LV   FW           L   I     Y + EE    + +GNI  DL +  + S      N +         +    +  ++   +      ++DREKLC           F          ++  C   I + +L   +   ++ I++IV D NDN P+F  P   I I E    +  +  +IP A D D   N+   Y L N +  F +  ++     K   L   Q LDRE+KD Y++ ++  D G P   S ++ L V + D+ND++P F KES   I V I E + +G ++  + A D D+G N+++++    +++ +     F +N +TG I V   LDRE      L V+ SD  S P      +T+ + D NDNAP I+    +II    G +          +      N    LI +    S K ++V  +   +I+K + F  +        L T+++LD E    Y   I+  D+G P L+ + L+ + + D+NDN P F +   E+ V+EN +    +  + A+D D G NA+++Y +  N    F +++ +G L      D E  ++   T+  +D G+ +  + A V VTI D ND  P          V+E++PK + V  ++V D D G    V +++L     F+    +  + +N+ FDRE    Y+  V   DNG P  +++  +TI + D+NDN P    ++  P    S + +  S     G  +A ++  D D   NA+L Y I     +  F + P +GN+ L    +++D+G  RLV+ + D G P+    L L+   V+    N  Y
Sbjct:    1 MDLRDFFLLATLVAC-FW-----------LDPTIAQELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTG--EIFTTSNRIDREKLC-------PGPSF----------EDSECSFEIEVVILP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLIN--SRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAI-LQVTVTDVNDNRPVF-KESQ--IEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPA-TRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPAR--ATITINVTDVNDNAPNIDL--RYIISPTNGTVM---------LSEKDPINTKIALITV----SDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTP----IVIYPPSNTSFKLVPLSAIP--GSVVAEVFAVDGDTGMNAELKYTIVSGNVRSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHTLVLVFLFVNDTVGNSSY 782          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 291.197 bits (744), Expect = 1.485e-82
Identity = 257/905 (28.40%), Postives = 416/905 (45.97%), Query Frame = 3
Query:   57 YMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYK---------DSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC-----PENFIIE-ENRGELST-VGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGS-FRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY-----------AIITNFR----------IVLIVIPTLIGISFSVILLFVIKTVQKQKANR 2639
            Y+L +L   CI+    F +   ++      Y + EE    + +GN++ DL L              T  P      +F ++YK         +    +      ++DREKLC        S IF+         +NK CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  S+P AID D+ +N    Y L   ++ F +  I+     K   L   Q+LDRE+KD Y++ I+  D G P   S ++ L V + D+ND++P F ++    I V I E A +G ++  + A D D+G+N+K+ F    ++T+  A  HF I+ +TG I V   LDRE      L V+ SD  S P  +   +T+ I D NDN P I+      P N  ++   +  L+T +  I   D D+  +   +C          F   +V       +K      F L T + LD E+   Y++ I+  D+G P L+ S ++ I + D+NDN P F      +  VEN    + + K+ A+D D G NA+L Y +  N    F +++ +G L  +  +D E+  + T T+  KD G+PS  T   V +++ D ND  PS      N  V E++P    V  ++V D D+G    V+++L+   + F+   L   +  N+ FDRE    Y+  V   D G P+ ++++ +TI + D+NDN+P    +   P    S   +  S     G  +A +Y  D+D   NA L Y  I  + +  F +   SGN+ L       D G  ++LVIKV D+G P  F  +  +   V+   +N  Y           A+  +FR           V I+I  + G    ++++FV   V+ ++  R
Sbjct:    8 YLLAVL-IACIV----FESGAQEK-----NYIVREELPENVLIGNLLKDLNL--------------TLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC--------SGIFT---------ENK-CFYEVEVAVLP-DEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVN--SRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAI-LQVTVTDVNDNRPVFKEKD---IEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITN-LAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC----------FTDHDVPFR----LKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKP----VFVIPSNNYSYDLVQTSTSP--GSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPR 840          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 290.426 bits (742), Expect = 2.496e-82
Identity = 257/905 (28.40%), Postives = 416/905 (45.97%), Query Frame = 3
Query:   57 YMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYK---------DSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC-----PENFIIE-ENRGELST-VGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGS-FRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY-----------AIITNFR----------IVLIVIPTLIGISFSVILLFVIKTVQKQKANR 2639
            Y+L +L   CI+    F +   ++      Y + EE    + +GN++ DL L              T  P      +F ++YK         +    +      ++DREKLC        S IF+         +NK CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  S+P AID D+ +N    Y L   ++ F +  I+     K   L   Q+LDRE+KD Y++ I+  D G P   S ++ L V + D+ND++P F ++    I V I E A +G ++  + A D D+G+N+K+ F    ++T+  A  HF I+ +TG I V   LDRE      L V+ SD  S P  +   +T+ I D NDN P I+      P N  ++   +  L+T +  I   D D+  +   +C          F   +V       +K      F L T + LD E+   Y++ I+  D+G P L+ S ++ I + D+NDN P F      +  VEN    + + K+ A+D D G NA+L Y +  N    F +++ +G L  +  +D E+  + T T+  KD G+PS  T   V +++ D ND  PS      N  V E++P    V  ++V D D+G    V+++L+   + F+   L   +  N+ FDRE    Y+  V   D G P+ ++++ +TI + D+NDN+P    +   P    S   +  S     G  +A +Y  D+D   NA L Y  I  + +  F +   SGN+ L       D G  ++LVIKV D+G P  F  +  +   V+   +N  Y           A+  +FR           V I+I  + G    ++++FV   V+ ++  R
Sbjct:   28 YLLAVL-IACIV----FESGAQEK-----NYIVREELPENVLIGNLLKDLNL--------------TLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC--------SGIFT---------ENK-CFYEVEVAVLP-DEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVN--SRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAI-LQVTVTDVNDNRPVFKEKD---IEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITN-LAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC----------FTDHDVPFR----LKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKP----VFVIPSNNYSYDLVQTSTSP--GSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPR 860          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 290.041 bits (741), Expect = 4.492e-82
Identity = 257/905 (28.40%), Postives = 416/905 (45.97%), Query Frame = 3
Query:   57 YMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYK---------DSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC-----PENFIIE-ENRGELST-VGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGS-FRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY-----------AIITNFR----------IVLIVIPTLIGISFSVILLFVIKTVQKQKANR 2639
            Y+L +L   CI+    F +   ++      Y + EE    + +GN++ DL L              T  P      +F ++YK         +    +      ++DREKLC        S IF+         +NK CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  S+P AID D+ +N    Y L   ++ F +  I+     K   L   Q+LDRE+KD Y++ I+  D G P   S ++ L V + D+ND++P F ++    I V I E A +G ++  + A D D+G+N+K+ F    ++T+  A  HF I+ +TG I V   LDRE      L V+ SD  S P  +   +T+ I D NDN P I+      P N  ++   +  L+T +  I   D D+  +   +C          F   +V       +K      F L T + LD E+   Y++ I+  D+G P L+ S ++ I + D+NDN P F      +  VEN    + + K+ A+D D G NA+L Y +  N    F +++ +G L  +  +D E+  + T T+  KD G+PS  T   V +++ D ND  PS      N  V E++P    V  ++V D D+G    V+++L+   + F+   L   +  N+ FDRE    Y+  V   D G P+ ++++ +TI + D+NDN+P    +   P    S   +  S     G  +A +Y  D+D   NA L Y  I  + +  F +   SGN+ L       D G  ++LVIKV D+G P  F  +  +   V+   +N  Y           A+  +FR           V I+I  + G    ++++FV   V+ ++  R
Sbjct:   28 YLLAVL-IACIV----FESGAQEK-----NYIVREELPENVLIGNLLKDLNL--------------TLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC--------SGIFT---------ENK-CFYEVEVAVLP-DEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVN--SRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAI-LQVTVTDVNDNRPVFKEKD---IEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITN-LAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTC----------FTDHDVPFR----LKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKP----VFVIPSNNYSYDLVQTSTSP--GSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFVNETITNGSYIQELVRKSKETAVGEDFRDGEITPQTNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPR 860          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 275.404 bits (703), Expect = 4.169e-77
Identity = 239/846 (28.25%), Postives = 386/846 (45.63%), Query Frame = 3
Query:   30 VNFRYFFFLYMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL---------STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLL--TNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            +N R F+ L  L+     C+         L   I     Y++ EE    + +GNI  DL +  + +       +L +   S+A     ++   S+  +      ++DREKLC             +G   + EN+   CF  + + +L   +   ++ I++IV D NDN P+F      I I E    +  +   IP A+D D   N    Y L N +  F +  ++     K   L   Q LDRE+KD Y++ I+  D G P   S ++ L V + D+ND++P F KES   + V I E A IG ++  + A D DIG+N+++++    ++T S     F +N +TG I V   LDRE      L V+ +D  S P      +T+ + D NDN P I+    +II    G +         + +  I   D D+  +S   C               +  E   ++K      + L T+S+LD E I  +S  I+  D G P L+ + L+ + + D+NDN P F +   E+ V EN      +  + ASD D G N+D++Y +  N    F +++ +G L      D E  ++   T+  +D G+P   + A V VT+ D ND  P          V+E++PK + V  ++  D D G    V++++L     FV    + L  +N+ FDRE    Y+  V   D GQP  +++  +TI I D NDN P    ++ SP    S + +  S     G  +A ++  D D   NA+L Y  +  + K  F + P +GN+ L    S +D+G  RLV+ + D G P+    L L+   V+  + N  Y
Sbjct:    1 MNLRDFYLLAALIA----CL--------RLDSAIAQELIYTIREELPENVPIGNIPKDLNISHI-NAATGSSTSLVYRLVSKAGDS-PLVKVSSSTGEIFTTSTRIDREKLC-------------AGSSNSDENE---CFFELEVVILP-NDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLIN--SRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAI-LQVTVSDVNDNKPVF-KESQ--VEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVT-SATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPAR--ATVTINVTDVNDNPPNIDL--RYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVIC--------------FIEREVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSP----VVISPPSNTSFKLVPLSAIP--GSVVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHTLVLVFLYVNETAGNASY 783          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 256.144 bits (653), Expect = 1.961e-70
Identity = 223/799 (27.91%), Postives = 373/799 (46.68%), Query Frame = 3
Query:  144 TYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMI-IVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQ---SIPIAIDQDIELNAKILYRL---TNHKDKFTIKYIQIANELK--IAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELST----------VGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITN--VDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEP---IGFSIATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP 2456
             Y + EEQ P I +G++  D        L +LE       P+ +   K   IY           +  +DRE L   Q               N+E   K CF+   +S+ +    +  ++  ++ + DINDN P F  P  T+ I     P + N      IP A D+D  +N    Y L      +D F ++  +  +E +  +  +  LDRE++D Y + I+  D G P   S +L L ++I+D ND+ P+F K +       + E + +G ++  + A+D+D G N+++ +S ++       + H  +++STG I V   +DRE   ++   V+  D G+ P++    +T+ I D NDN P IE    F +  ++G ++           V  ++  D+D G ++  +C +    P   F+L  V+   +   KK     + L TT+ LD E++  Y++ I+  D+G+P LS++  + + V+D NDN P F +S  E+   EN      V+++ A+D D G N+ L Y I+ +      F IN  SG +     +D E+ +     +   D+G PS   TA V +T+ D ND  P  +    N SV E+MP+ + V  ++VID D G    + +++ P   +FV +N    +L+++ FDRE    Y+  +   D G P  ++ + +TI + D NDN P          V +    IS+ Y  P    G  +  +   D D   NA+L Y I  S  P+  F +  ++G + L         G  RLV+KV D G P
Sbjct:   70 AYRVPEEQPPNILIGSLASDYGYPDSKHLYKLE----LGHPYLRVDGKTGDIY---------TTETSIDRESLRECQ---------------NLEPGEK-CFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSI-----PENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSAL-LRISILDTNDNAPKFEKMAY---EAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLH--LDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI-RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVP---FQLKQVSDTGSDSKKK-----YFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAP----------VIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSI-ASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 808          

HSP 2 Score: 132.494 bits (332), Expect = 1.025e-30
Identity = 126/476 (26.47%), Postives = 217/476 (45.59%), Query Frame = 3
Query: 1182 INDENDNAPFIECPENFIIEENRGELSTVGFI----KAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD---HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPP-------SLVSYSMN-PSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL---LPWENKFVF-------RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI--HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAI 2528
            I D NDN P    P   +I  +  E + +G +     A D DSG +   S +LI + P  +  L  + +      K+      +L    +LDRE   +Y L I   D G+P  ++S L+ I + D NDN P F +  +E ++ EN     SVL++KA+D+D G+NA++ Y      D       +++++G +    PID E    +  ++  KD+G+   T    V +TI+D ND  P        LV++     +++E +P  T V  + V D D G    V+  +   +P++ K V        +   L T    D E   +Y+I ++  D+G P L+++  L + ++D+NDN P  +  +           + F     I   +  +   D D   N+QL Y I    S +  F ++PDSG +++N+         +   +   D G P L     ++I V+D   ++P + +
Sbjct:  166 IMDINDNTPNFNSP---VITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI-VGP-EAQDLFGLQVAEDQDEKQP-----QLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSL---------MEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFML 622          

HSP 3 Score: 64.6994 bits (156), Expect = 7.619e-10
Identity = 65/243 (26.75%), Postives = 107/243 (44.03%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLP--NFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC 1220
             ++ + V D NDN P F L   NF++M   E  P   +   +   ID D   NA I   +     +F I+         I    + DRE +  Y   ++A+D G P   S  + +T+N++D ND+ P     S N+   +++ Q   G  +  + A D D G N++L +S+          E F I+ + G + +   + R+ Y    L V V+D G P R  +  +   IN+   N   +E 
Sbjct:  604 ASVVITVLDRNDNDPKFMLNGYNFSVM---ENMPR-LSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQ----NGTGTILSSISFDREHQSTYTFRLKAVDGGDP-PRSSYVGVTINVLDENDNAPVIVVPS-NISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSI----ASGNPFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYINETLTNQTLVET 832          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 291.197 bits (744), Expect = 1.118e-82
Identity = 253/897 (28.21%), Postives = 415/897 (46.27%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRL----DKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-----FIECPEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEP---IGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP---------SSNP--DYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQ--KANRLINHNTKQIYTKKEN 2684
            Y++ EE    + +G+++ DL L    DK L+       T   F     +    +I  +    +      ++DREKLC             +G + +       CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  S+P AID DI +N    Y+L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F ++    I V I E A IG ++  + A D DIG N+++ F  +  L  + A   F +N +TG I V   LDRE   S  L V+ +D GS P   ++ + V   D NDN P     +I  P N   ++ EN    + +  I   D DS  +   +C   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + V EN    + + K+ A+D D G NA++ Y +  +    F ++Q +G L  ++ +D E+ ++   T+  +D G P   + A V VT+ D ND  P       N  V E +PK   V  ++V DPD G    V++++L   ++F    ++  +  N+ FDRE  + Y+  V   D G+   +++  +TI + D+NDN+P     I  P         SF +  P    G  +  +   DDDI  NA++ Y  +  + K  F++   SGN+ L   C VSDLG  R+++K  D G P  LF+++                 EL+   +D P         +S+P  DY      +I++ ++   I +   + +  V++  Q    KA++    N++ +    EN
Sbjct:   28 YTVREEMPENVLIGDLLKDLNLSLIPDKSLT-------TPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLC-------------AGIVLDAR-----CFYEVEVAVLP-DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN--SRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVADTNDNHPIFIEKE---IEVSIPENAPIGSSVTQLHATDADIGENARIHFYFS-NLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNV--TDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVP---FRLRPVFSNQ-----------FLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPI---FIDPPS------NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPPHLKASQKNKQNSEWVTPNPEN 861          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 291.197 bits (744), Expect = 3.705e-82
Identity = 255/899 (28.36%), Postives = 416/899 (46.27%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRL----DKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAP-----FIECPEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEP---IGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP---------SSNP--DYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQ--KANRLINHNTKQIYTKKEN 2684
            Y++ EE    + +G+++ DL L    DK L+       T   F     +    +I  +    +      ++DREKLC             +G + +       CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  S+P AID DI +N    Y+L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F ++    I V I E A IG ++  + A D DIG N+++ F  +  L  + A   F +N +TG I V   LDRE   S  L V+ +D GS P       TV++N  D NDN P     +I  P N   ++ EN    + +  I   D DS  +   +C   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + V EN    + + K+ A+D D G NA++ Y +  +    F ++Q +G L  ++ +D E+ ++   T+  +D G P   + A V VT+ D ND  P       N  V E +PK   V  ++V DPD G    V++++L   ++F    ++  +  N+ FDRE  + Y+  V   D G+   +++  +TI + D+NDN+P     I  P         SF +  P    G  +  +   DDDI  NA++ Y  +  + K  F++   SGN+ L   C VSDLG  R+++K  D G P  LF+++                 EL+   +D P         +S+P  DY      +I++ ++   I +   + +  V++  Q    KA++    N++ +    EN
Sbjct:   28 YTVREEMPENVLIGDLLKDLNLSLIPDKSLT-------TPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLC-------------AGIVLDAR-----CFYEVEVAVLP-DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN--SRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVADTNDNHPIFIEKE---IEVSIPENAPIGSSVTQLHATDADIGENARIHFYFS-NLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVP---FRLRPV-----------FSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPI---FIDPPS------NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPPHLKASQKNKQNSEWVTPNPEN 861          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 289.271 bits (739), Expect = 7.163e-81
Identity = 255/899 (28.36%), Postives = 416/899 (46.27%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRL----DKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAP-----FIECPEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEP---IGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP---------SSNP--DYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQ--KANRLINHNTKQIYTKKEN 2684
            Y++ EE    + +G+++ DL L    DK L+       T   F     +    +I  +    +      ++DREKLC             +G + +       CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  S+P AID DI +N    Y+L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F ++    I V I E A IG ++  + A D DIG N+++ F  +  L  + A   F +N +TG I V   LDRE   S  L V+ +D GS P       TV++N  D NDN P     +I  P N   ++ EN    + +  I   D DS  +   +C   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + V EN    + + K+ A+D D G NA++ Y +  +    F ++Q +G L  ++ +D E+ ++   T+  +D G P   + A V VT+ D ND  P       N  V E +PK   V  ++V DPD G    V++++L   ++F    ++  +  N+ FDRE  + Y+  V   D G+   +++  +TI + D+NDN+P     I  P         SF +  P    G  +  +   DDDI  NA++ Y  +  + K  F++   SGN+ L   C VSDLG  R+++K  D G P  LF+++                 EL+   +D P         +S+P  DY      +I++ ++   I +   + +  V++  Q    KA++    N++ +    EN
Sbjct:   28 YTVREEMPENVLIGDLLKDLNLSLIPDKSLT-------TPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLC-------------AGIVLDAR-----CFYEVEVAVLP-DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN--SRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVADTNDNHPIFIEKE---IEVSIPENAPIGSSVTQLHATDADIGENARIHFYFS-NLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVP---FRLRPV-----------FSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPI---FIDPPS------NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPPHLKASQKNKQNSEWVTPNPEN 861          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 288.886 bits (738), Expect = 9.135e-81
Identity = 255/899 (28.36%), Postives = 416/899 (46.27%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRL----DKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAP-----FIECPEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEP---IGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP---------SSNP--DYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQ--KANRLINHNTKQIYTKKEN 2684
            Y++ EE    + +G+++ DL L    DK L+       T   F     +    +I  +    +      ++DREKLC             +G + +       CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  S+P AID DI +N    Y+L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F ++    I V I E A IG ++  + A D DIG N+++ F  +  L  + A   F +N +TG I V   LDRE   S  L V+ +D GS P       TV++N  D NDN P     +I  P N   ++ EN    + +  I   D DS  +   +C   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + V EN    + + K+ A+D D G NA++ Y +  +    F ++Q +G L  ++ +D E+ ++   T+  +D G P   + A V VT+ D ND  P       N  V E +PK   V  ++V DPD G    V++++L   ++F    ++  +  N+ FDRE  + Y+  V   D G+   +++  +TI + D+NDN+P     I  P         SF +  P    G  +  +   DDDI  NA++ Y  +  + K  F++   SGN+ L   C VSDLG  R+++K  D G P  LF+++                 EL+   +D P         +S+P  DY      +I++ ++   I +   + +  V++  Q    KA++    N++ +    EN
Sbjct:   28 YTVREEMPENVLIGDLLKDLNLSLIPDKSLT-------TPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLC-------------AGIVLDAR-----CFYEVEVAVLP-DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN--SRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVADTNDNHPIFIEKE---IEVSIPENAPIGSSVTQLHATDADIGENARIHFYFS-NLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVP---FRLRPV-----------FSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPI---FIDPPS------NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPPHLKASQKNKQNSEWVTPNPEN 861          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 288.886 bits (738), Expect = 1.147e-80
Identity = 255/899 (28.36%), Postives = 416/899 (46.27%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRL----DKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIEC-----PEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEP---IGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP---------SSNP--DYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQ--KANRLINHNTKQIYTKKEN 2684
            Y++ EE    + +G+++ DL L    DK L+       T   F     +    +I  +    +      ++DREKLC             +G + +       CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  S+P AID DI +N    Y+L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F ++    I V I E A IG ++  + A D DIG N+++ F  +  L  + A   F +N +TG I V   LDRE   S  L V+ +D GS P       TV++N  D NDN P I+      P N   ++ EN    + +  I   D DS  +   +C   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + V EN    + + K+ A+D D G NA++ Y +  +    F ++Q +G L  ++ +D E+ ++   T+  +D G P   + A V VT+ D ND  P       N  V E +PK   V  ++V DPD G    V++++L   ++F    ++  +  N+ FDRE  + Y+  V   D G+   +++  +TI + D+NDN+P     I  P         SF +  P    G  +  +   DDDI  NA++ Y  +  + K  F++   SGN+ L   C VSDLG  R+++K  D G P  LF+++                 EL+   +D P         +S+P  DY      +I++ ++   I +   + +  V++  Q    KA++    N++ +    EN
Sbjct:   28 YTVREEMPENVLIGDLLKDLNLSLIPDKSLT-------TPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLC-------------AGIVLDAR-----CFYEVEVAVLP-DEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAIN--SRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVADTNDNHPIFIEKE---IEVSIPENAPIGSSVTQLHATDADIGENARIHFYFS-NLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTP----ARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVP---FRLRPV-----------FSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPI---FIDPPS------NYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQPDSLFNVVNVNFFINESVPNATLIYELVRRSIDAPANQNTETTSASSPTTDYV-----KIMVAIVAGTITVVLVIFITAVVRCRQPPHLKASQKNKQNSEWVTPNPEN 861          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 1.232e-77
Identity = 230/795 (28.93%), Postives = 371/795 (46.67%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYK---------DSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC-----PEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEP---IGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP 2456
            Y++ EE    + +G+++ DL      +L  + + +LT         +F ++YK         +    +      ++DREKLC             +G + +       CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P  ID D  +N    Y L   +  F +  I+     K+  L   + LDRE+KD Y++ I+  D G P   S ++ L V++ D ND++P F +   N I V I E A +G ++  + A D DIG N+K+ F  +  L  + A + F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P I+      P N   ++ EN    + +  I   D D+  +   SC   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +    + V EN    + + K+ A D D G NA++ Y +  +    F ++  +G L  ++ +D E+ ++ + T+  KD G P   T A V VT+ D ND  P       N  V E++P+   V  ++V DPD G    V +++L   + F    +   +  N+ FDRE  + Y+  V   D G+   +++  +TI + D+NDN+P            + +   SF    P    G  + T+   D+D   NA+L Y  +  + K  FI+   SGN+ L   C  +DLG  RLV+K +D G P
Sbjct:   28 YTIREEMPENVLIGDLLKDL------NLSLIPDRSLT------TPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLC-------------AGIVVDAH-----CFYEVEVAVLP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SRYALPATIDPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAI-LQVSVADTNDNRPVFKE---NEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFS-NLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGGLTP-ARAMVL-VNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFTDHEVP---FRLRPV-----------FSNQFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDANDDFTIDPQTGVIQPNISFDREKQESYTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFV---------VPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKGLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.147e-75
Identity = 247/886 (27.88%), Postives = 412/886 (46.50%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC-----PEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPI-GFSIATIYFH----DDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP-SSNPDYAIITNFR--IVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENS 2687
            Y++ EE    + +G+++ DL L  ++  K L   T   F     +    +I  +    +      ++DREKLC                   +  D   CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P A+D D+ +N    Y L   ++ F +  I+     K+  L   + LDREKKD Y++ ++  D G P   S ++ L V++ D ND+ P F +     I V I E A +G ++  + A D DIG N+K+ FS +  L  + A   F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P I+      P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + + EN      + K+ A+D D G NA++ Y +  +    F +++ +G L  ++ +D E+  +   TI  KD G P  T+   V V+I D ND  P       N  V E++P+   V  ++V DPD G    V++++L   + F   +    +  N+ FDRE  + Y+  V   D G+   ++S  +TI + D+NDN+P          V  SN    +SY+  +   +  T+ F     D+D   NA++ Y  +  + +  F +  ++GN+ L   C V+DLG  R+++K  D G P  LFS++                 EL+   ++ P + N + A +++     V I++  + G    V+++F+   V+ ++A  L     K     K+NS
Sbjct:   28 YTIREEMPENVLIGDLLKDLNL-SLIPNKSL--TTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC-----------------AGIPRDEH-CFYEVEVAILP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVFKETE---IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS-NLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP-ARAMVL-VNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP---FRLRPV-----------FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI-------VPPSN----YSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTNDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHL-----KAAQKNKQNS 852          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 4.783e-74
Identity = 245/886 (27.65%), Postives = 409/886 (46.16%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC-----PEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPI-----GFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP-SSNPDYAIITN--FRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENS 2687
            Y++ EE    + +G+++ DL L  ++  K L   T   F     +    +I  +    +      ++DREKLC                   +  D   CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P A+D D+  N    Y L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F +     I V I E A +G ++  + A D DIG N+K+ FS +  L  + A   F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P I+      P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + + EN      + K+ A+D D G NA++ Y +  +    F +++ +G L  ++ +D E+  +   TI  KD G P  T+   V V+I D ND  P       N  V E++P+   V  ++V DPD G    V++++L   + F   +    +  N+ FDRE  + Y+  V   D G+   ++S  +TI + D+NDN+P          V  SN    +SY+  +     G  +  +   D+D   NA++ Y  +  + +  F +  ++GN+ L   C V+DLG  R+++K  D G P  LFS++                 EL+    + P + N + A +++     V I++  + G    V+++F+   V+ ++A  L     K     K+NS
Sbjct:   28 YTIREEMPENVLIGDLLKDLNL-SLIPNKSL--TTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC-----------------AGIPRDEH-CFYEVEVAILP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVFKETE---IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS-NLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP-ARAMVL-VNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP---FRLRPV-----------FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI-------VPPSN----YSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHL-----KAAQKNKQNS 852          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 5.293e-74
Identity = 245/886 (27.65%), Postives = 409/886 (46.16%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC-----PEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPI-----GFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP-SSNPDYAIITN--FRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENS 2687
            Y++ EE    + +G+++ DL L  ++  K L   T   F     +    +I  +    +      ++DREKLC                   +  D   CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P A+D D+  N    Y L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F +     I V I E A +G ++  + A D DIG N+K+ FS +  L  + A   F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P I+      P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V               F L T + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + + EN      + K+ A+D D G NA++ Y +  +    F +++ +G L  ++ +D E+  +   TI  KD G P  T+   V V+I D ND  P       N  V E++P+   V  ++V DPD G    V++++L   + F   +    +  N+ FDRE  + Y+  V   D G+   ++S  +TI + D+NDN+P          V  SN    +SY+  +     G  +  +   D+D   NA++ Y  +  + +  F +  ++GN+ L   C V+DLG  R+++K  D G P  LFS++                 EL+    + P + N + A +++     V I++  + G    V+++F+   V+ ++A  L     K     K+NS
Sbjct:   28 YTIREEMPENVLIGDLLKDLNL-SLIPNKSL--TTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC-----------------AGIPRDEH-CFYEVEVAILP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVFKETE---IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS-NLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP-ARAMVL-VNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP---FRLRPV-----------FSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFI-------VPPSN----YSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSTEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHL-----KAAQKNKQNS 852          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.516e-73
Identity = 238/866 (27.48%), Postives = 403/866 (46.54%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC-----PEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP-RLFSLL-----------------ELIIHVVDGP-SSNPDYAIITN--FRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRL 2642
            Y++ EE    + +GN++ DL L  ++  K L   T   F     +    +I  +    +      ++DREKLC                   +  D   CF  + +++L   E   +V IR ++ DINDN P+F      I I E  A +  +  ++P A+D D+ +N    Y L   ++ F +  I+     K+  L   + LDRE+KD Y++ ++  D G P   S ++ L V++ D ND+ P F +     I V I E A +G ++  + A D DIG N+K+ FS +  L  + A   F +N +TG I +   LDRE   +  L V+ SD G  P + +M L V + D NDN P I+      P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V               F L   + LD E+   Y++ +L  D G P L+ S ++ I V D+NDN P F +S   + + EN      ++K+ A+D D G NA++ Y +  +    F +++ +G L  ++ +D E+  +   TI  KD G P  T+   V V+I D ND  P          V E++P+   V  ++V DPD G    V++++L   + F   +    +  N+ FDRE  + Y+  V   D G+   ++S  +TI + D+NDN+P    +   P    S + +  S     G  +  +   D+D   NA++ Y  +  + +  F +  ++GN+ L   C V+DLG  R+++K  D G P  LFS++                 EL+   ++ P + N + A +++     V I++  + G    V+++F+   V+ ++A  L
Sbjct:   60 YTIREEIPENVLIGNLLKDLNL-SLIPNKSL--TTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC-----------------AGIPRDEH-CFYEVEVAILP-DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAIN--SKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAI-LQVSVTDTNDNHPVFKETE---IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFS-NLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP-ARAMVL-VNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIP---FRLRPV-----------FSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKP----VFIVPPYNYSYELVLPSTNP--GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKILVAAVAGTITVVVVIFITAVVRCRQAPHL 874          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A1L8F7N2 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18038901mg PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 1.140e-81
Identity = 259/900 (28.78%), Postives = 418/900 (46.44%), Query Frame = 3
Query:   57 YMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRL--DKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL---------STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI-HESEKPYFILHPDSGNLKLNSTCSVSDLGS-FRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY-----------AIITNFR----------IVLIVIPTLIGISFSVILLFVIKTVQKQKANR 2639
            Y+L +L   CI+    F +   ++      Y + E+Q   + +GN++ DL L  D  +SL     +T   F     +    +I  D    +      ++DREKLC        S IF+         +NK CF  + +++L   E   +V IR ++ DINDNPP+F      I I E  A +  +  S+P AID D+ +N    Y L   ++ F +  I+     K   L   Q+LDRE+KD Y++ I+  D G P   S ++ L V + D+ND++P F ++    I V I E A +G ++  + A D D+G N+K+ F    ++T+  A  HF I+ +TG I V   LDRE      L V+ SD  S P  +   +T+ I D NDN P I+    +II    G +         + +  I   D D+  +   +C          F   +V       +K      F L T + LD E+   Y++ I+  D+G P L+ S ++ I + D+NDN P F      +  VEN    + + K+ A+D D G NA+L Y +  N    F +++ +G L  +  +D E+  + T T+  KD G+PS  T   V +++ D ND  PS      N  V E++P    V  ++V D D G    V+++L+   + F+   L   +  N+ FDRE    Y+  V   D G P+ ++++ +TI + D+NDN+P    +   P    S + +  S     G  +A ++  D+D   NA L Y I   + +  F +   SGN+ L       D GS ++LVIKV D+G P  F  +  +   V+   +N  Y           A+  +FR           V I+I  + G    ++++FV   V+ ++  R
Sbjct:    8 YLLAVL-IACIV----FESGAQEK-----KYIVREDQQENVLIGNLLKDLNLTLDSAISL-----STPLQFKLVYKTGDVPLIRVDENTGEIFTTSNRIDREKLC--------SGIFT---------ENK-CFYEVEVAVLP-DEVFRLVKIRFLIEDINDNPPLFPSTVINISIPENTAVN--SRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAI-LQVTVTDVNDNRPVFKEKD---IEVNIPEDAAVGMSVTQLHATDADLGLNAKIHFYFGNQITN-LAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDT--RYIINPVNGTVLLSEKAPLNTKIALITVTDKDADLNGKVTC----------FTDHDVPFR----LKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPSLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYTLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADYGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKP----VFVVPSNNYSYELVQTSTSP--GSVVARVHAIDNDTGINADLRYSILGGNPRGLFAIGEKSGNITLKEKLLAGDHGSLYKLVIKVNDSGKPEPFHTIAFVHLFVNDTITNGSYVQELVRKSKETAVGEDFRDGEITPETNDYVKIIIAIIAGTMTVILVIFVTALVRCRQTPR 842          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A3P8YZ51 (Protocadherin 11 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 3.833e-81
Identity = 237/796 (29.77%), Postives = 383/796 (48.12%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIECP-------ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISF--SYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELI 2483
            Y++ EEQ   + +GN+  DL L+    +K    + L F P  + +    ++  +++  +      ++DREKLC        S +F          + K CF  I +++L   E   +V IR ++ DINDN P+FQ     I I E  A  +  Y  +P A D D+ +N    Y L     +F +  I+     K   L   Q+LDRE+KD +++ I+  D G P   S ++ L V I D+ND++P F       + V + E A  G ++  + A D D+G+N+++ FS + +++ S    HF I+ +TG I V   LDRE      L V+ SD GS     S   TVI+N  D NDN P I+            ++ EN    + +  I   D DS  +   +C   +  P   F+L  V  +            F L T + LD E    Y++ I+  D+G P L+ S ++ I + D+NDN P F + + ++ + EN    S ++K+ A+D D G NA++LY +  +    F I++ SG L   + +D ER ++ + T+  +D GS S  +   V + ++D+ND  P+      N  V E++P    V  ++V D D G    +++++L  ++ FV   +   +  N+ FDRE    Y+ +V   D GQP  T+   +TI + D+NDNRP          +  SN +     S   P G  +  ++  D+D   NA+L Y  I  S++  F +   +GN+ L      SD G  RLV+KV+D G P     + LI
Sbjct:   28 YTVREEQPENVRIGNLRRDLDLNLDPDVKL--SSPLQFKPVYK-TGDVPLVRVEASTGEIFTTAHRIDREKLC--------SGVF----------NEKRCFYEIEVAVLP-DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTA-INTRY-PVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDREQKDTFVMKIKVEDGGTPPKSSTAI-LQVTISDVNDNRPVFKDSE---VEVNVPENAPTGTSVTQLHATDADLGSNAQIHFSFSNQVSLS-TKRHFSIDSTTGLITVKQTLDREAAPVHKLIVLASDGGS----TSSRATVIVNVTDINDNVPSIDTRYIINLVNGTVLLSENAPLKTKIALITVTDKDSDLNGKVTCYTDHDIP---FRLKPVFNDQ-----------FLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPIFPQPDIQLSIPENNEPSSELIKISATDADSGHNAEILYSLAPDAPDCFNIDKRSGVLSVAKRLDRERQEKYSFTVLARDNGSTSLQSNITVKLIVQDLNDNSPAFTHPEYNFYVPENLPLSGTVGLITVTDSDAGDNAVITLSILNGKDNFVIDPQTGVIKPNITFDREQQSSYTFMVKATDGGQPPSTSYAKVTINVVDVNDNRPVFV-------IPSSNYSYDLVQSTTSP-GAVVTRVFAIDNDTGMNAELQYSIIGGSQRGLFAIDKTTGNITLQEKIVSSDQGLHRLVVKVKDLGQPESLHAIALI 768          

HSP 2 Score: 162.54 bits (410), Expect = 7.445e-37
Identity = 164/598 (27.42%), Postives = 269/598 (44.98%), Query Frame = 3
Query:  807 PDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTG----AIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLS---NVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKA-------SDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIE---PIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAI 2528
            PD +   + +   I DIND+ P F      +I++ I E   I        A D D+G N    + L + +++ + ++   I    G     + V   LDRE  ++  + + V D G+PP+S++  L V I+D NDN P  +  E  + + EN    ++V  + A D D G+++      I+   +N   LS   + +++STT +         ++    LDRE    + L++L  D GS   S+   + + V+D NDN+P    + + I +V   V LS    LK        +D D  +N  +  +  T+ D  F +     D + +E   P+D+E  ++  I I   D G P   T+A V + IKD ND  P      +  S+ E+    + +  +S  D D+G   E+  +L P +    F    R+  L      DRE  +KYS  V+ RDNG   L ++I + + + D+NDN P  TH              +F   E  P+  ++  I   D D   NA +T  I    K  F++ P +G +K N T       S+  ++K  D G P   S  ++ I+VVD   + P + I
Sbjct:  116 PDEIFRLVKIRFLIEDINDNAPLFQS---TVINISIPENTAINTRYPVPSAFDPDVGINGIQHYELVKSVSE-FGLD--IIETPEGDKWPQLIVQQSLDREQKDTFVMKIKVEDGGTPPKSSTAILQVTISDVNDNRPVFKDSEVEVNVPENAPTGTSVTQLHATDADLGSNAQ-----IHFSFSNQVSLSTKRHFSIDSTTGL---------ITVKQTLDREAAPVHKLIVLASDGGS--TSSRATVIVNVTDINDNVPSID-TRYIINLVNGTVLLSENAPLKTKIALITVTDKDSDLNGKVTCY--TDHDIPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPIFPQPDIQLSIPENNEPSSELIKISATDADSGHNAEILYSLAP-DAPDCFNIDKRSGVLSVAKRLDRERQEKYSFTVLARDNGSTSLQSNITVKLIVQDLNDNSPAFTH-----------PEYNFYVPENLPLSGTVGLITVTDSDAGDNAVITLSILNG-KDNFVIDPQTGVIKPNITFDREQQSSYTFMVKATDGGQPPSTSYAKVTINVVDVNDNRPVFVI 675          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A3P8YZ64 (Protocadherin 11 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 3.964e-81
Identity = 237/796 (29.77%), Postives = 383/796 (48.12%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIECP-------ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISF--SYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELI 2483
            Y++ EEQ   + +GN+  DL L+    +K    + L F P  + +    ++  +++  +      ++DREKLC        S +F          + K CF  I +++L   E   +V IR ++ DINDN P+FQ     I I E  A  +  Y  +P A D D+ +N    Y L     +F +  I+     K   L   Q+LDRE+KD +++ I+  D G P   S ++ L V I D+ND++P F       + V + E A  G ++  + A D D+G+N+++ FS + +++ S    HF I+ +TG I V   LDRE      L V+ SD GS     S   TVI+N  D NDN P I+            ++ EN    + +  I   D DS  +   +C   +  P   F+L  V  +            F L T + LD E    Y++ I+  D+G P L+ S ++ I + D+NDN P F + + ++ + EN    S ++K+ A+D D G NA++LY +  +    F I++ SG L   + +D ER ++ + T+  +D GS S  +   V + ++D+ND  P+      N  V E++P    V  ++V D D G    +++++L  ++ FV   +   +  N+ FDRE    Y+ +V   D GQP  T+   +TI + D+NDNRP          +  SN +     S   P G  +  ++  D+D   NA+L Y  I  S++  F +   +GN+ L      SD G  RLV+KV+D G P     + LI
Sbjct:   28 YTVREEQPENVRIGNLRRDLDLNLDPDVKL--SSPLQFKPVYK-TGDVPLVRVEASTGEIFTTAHRIDREKLC--------SGVF----------NEKRCFYEIEVAVLP-DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTA-INTRY-PVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDREQKDTFVMKIKVEDGGTPPKSSTAI-LQVTISDVNDNRPVFKDSE---VEVNVPENAPTGTSVTQLHATDADLGSNAQIHFSFSNQVSLS-TKRHFSIDSTTGLITVKQTLDREAAPVHKLIVLASDGGS----TSSRATVIVNVTDINDNVPSIDTRYIINLVNGTVLLSENAPLKTKIALITVTDKDSDLNGKVTCYTDHDIP---FRLKPVFNDQ-----------FLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPIFPQPDIQLSIPENNEPSSELIKISATDADSGHNAEILYSLAPDAPDCFNIDKRSGVLSVAKRLDRERQEKYSFTVLARDNGSTSLQSNITVKLIVQDLNDNSPAFTHPEYNFYVPENLPLSGTVGLITVTDSDAGDNAVITLSILNGKDNFVIDPQTGVIKPNITFDREQQSSYTFMVKATDGGQPPSTSYAKVTINVVDVNDNRPVFV-------IPSSNYSYDLVQSTTSP-GAVVTRVFAIDNDTGMNAELQYSIIGGSQRGLFAIDKTTGNITLQEKIVSSDQGLHRLVVKVKDLGQPESLHAIALI 768          

HSP 2 Score: 162.925 bits (411), Expect = 6.344e-37
Identity = 164/598 (27.42%), Postives = 269/598 (44.98%), Query Frame = 3
Query:  807 PDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTG----AIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLS---NVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKA-------SDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIE---PIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAI 2528
            PD +   + +   I DIND+ P F      +I++ I E   I        A D D+G N    + L + +++ + ++   I    G     + V   LDRE  ++  + + V D G+PP+S++  L V I+D NDN P  +  E  + + EN    ++V  + A D D G+++      I+   +N   LS   + +++STT +         ++    LDRE    + L++L  D GS   S+   + + V+D NDN+P    + + I +V   V LS    LK        +D D  +N  +  +  T+ D  F +     D + +E   P+D+E  ++  I I   D G P   T+A V + IKD ND  P      +  S+ E+    + +  +S  D D+G   E+  +L P +    F    R+  L      DRE  +KYS  V+ RDNG   L ++I + + + D+NDN P  TH              +F   E  P+  ++  I   D D   NA +T  I    K  F++ P +G +K N T       S+  ++K  D G P   S  ++ I+VVD   + P + I
Sbjct:  116 PDEIFRLVKIRFLIEDINDNAPLFQS---TVINISIPENTAINTRYPVPSAFDPDVGINGIQHYELVKSVSE-FGLD--IIETPEGDKWPQLIVQQSLDREQKDTFVMKIKVEDGGTPPKSSTAILQVTISDVNDNRPVFKDSEVEVNVPENAPTGTSVTQLHATDADLGSNAQ-----IHFSFSNQVSLSTKRHFSIDSTTGL---------ITVKQTLDREAAPVHKLIVLASDGGS--TSSRATVIVNVTDINDNVPSID-TRYIINLVNGTVLLSENAPLKTKIALITVTDKDSDLNGKVTCY--TDHDIPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPIFPQPDIQLSIPENNEPSSELIKISATDADSGHNAEILYSLAP-DAPDCFNIDKRSGVLSVAKRLDRERQEKYSFTVLARDNGSTSLQSNITVKLIVQDLNDNSPAFTH-----------PEYNFYVPENLPLSGTVGLITVTDSDAGDNAVITLSILNG-KDNFVIDPQTGVIKPNITFDREQQSSYTFMVKATDGGQPPSTSYAKVTINVVDVNDNRPVFVI 675          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A3P8YZ99 (Protocadherin 11 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 5.028e-81
Identity = 237/796 (29.77%), Postives = 383/796 (48.12%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIECP-------ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISF--SYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELI 2483
            Y++ EEQ   + +GN+  DL L+    +K    + L F P  + +    ++  +++  +      ++DREKLC        S +F          + K CF  I +++L   E   +V IR ++ DINDN P+FQ     I I E  A  +  Y  +P A D D+ +N    Y L     +F +  I+     K   L   Q+LDRE+KD +++ I+  D G P   S ++ L V I D+ND++P F       + V + E A  G ++  + A D D+G+N+++ FS + +++ S    HF I+ +TG I V   LDRE      L V+ SD GS     S   TVI+N  D NDN P I+            ++ EN    + +  I   D DS  +   +C   +  P   F+L  V  +            F L T + LD E    Y++ I+  D+G P L+ S ++ I + D+NDN P F + + ++ + EN    S ++K+ A+D D G NA++LY +  +    F I++ SG L   + +D ER ++ + T+  +D GS S  +   V + ++D+ND  P+      N  V E++P    V  ++V D D G    +++++L  ++ FV   +   +  N+ FDRE    Y+ +V   D GQP  T+   +TI + D+NDNRP          +  SN +     S   P G  +  ++  D+D   NA+L Y  I  S++  F +   +GN+ L      SD G  RLV+KV+D G P     + LI
Sbjct:   28 YTVREEQPENVRIGNLRRDLDLNLDPDVKL--SSPLQFKPVYK-TGDVPLVRVEASTGEIFTTAHRIDREKLC--------SGVF----------NEKRCFYEIEVAVLP-DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTA-INTRY-PVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDREQKDTFVMKIKVEDGGTPPKSSTAI-LQVTISDVNDNRPVFKDSE---VEVNVPENAPTGTSVTQLHATDADLGSNAQIHFSFSNQVSLS-TKRHFSIDSTTGLITVKQTLDREAAPVHKLIVLASDGGS----TSSRATVIVNVTDINDNVPSIDTRYIINLVNGTVLLSENAPLKTKIALITVTDKDSDLNGKVTCYTDHDIP---FRLKPVFNDQ-----------FLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPIFPQPDIQLSIPENNEPSSELIKISATDADSGHNAEILYSLAPDAPDCFNIDKRSGVLSVAKRLDRERQEKYSFTVLARDNGSTSLQSNITVKLIVQDLNDNSPAFTHPEYNFYVPENLPLSGTVGLITVTDSDAGDNAVITLSILNGKDNFVIDPQTGVIKPNITFDREQQSSYTFMVKATDGGQPPSTSYAKVTINVVDVNDNRPVFV-------IPSSNYSYDLVQSTTSP-GAVVTRVFAIDNDTGMNAELQYSIIGGSQRGLFAIDKTTGNITLQEKIVSSDQGLHRLVVKVKDLGQPESLHAIALI 768          

HSP 2 Score: 162.925 bits (411), Expect = 6.546e-37
Identity = 164/598 (27.42%), Postives = 269/598 (44.98%), Query Frame = 3
Query:  807 PDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTG----AIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLS---NVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKA-------SDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIE---PIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAI 2528
            PD +   + +   I DIND+ P F      +I++ I E   I        A D D+G N    + L + +++ + ++   I    G     + V   LDRE  ++  + + V D G+PP+S++  L V I+D NDN P  +  E  + + EN    ++V  + A D D G+++      I+   +N   LS   + +++STT +         ++    LDRE    + L++L  D GS   S+   + + V+D NDN+P    + + I +V   V LS    LK        +D D  +N  +  +  T+ D  F +     D + +E   P+D+E  ++  I I   D G P   T+A V + IKD ND  P      +  S+ E+    + +  +S  D D+G   E+  +L P +    F    R+  L      DRE  +KYS  V+ RDNG   L ++I + + + D+NDN P  TH              +F   E  P+  ++  I   D D   NA +T  I    K  F++ P +G +K N T       S+  ++K  D G P   S  ++ I+VVD   + P + I
Sbjct:  116 PDEIFRLVKIRFLIEDINDNAPLFQS---TVINISIPENTAINTRYPVPSAFDPDVGINGIQHYELVKSVSE-FGLD--IIETPEGDKWPQLIVQQSLDREQKDTFVMKIKVEDGGTPPKSSTAILQVTISDVNDNRPVFKDSEVEVNVPENAPTGTSVTQLHATDADLGSNAQ-----IHFSFSNQVSLSTKRHFSIDSTTGL---------ITVKQTLDREAAPVHKLIVLASDGGS--TSSRATVIVNVTDINDNVPSID-TRYIINLVNGTVLLSENAPLKTKIALITVTDKDSDLNGKVTCY--TDHDIPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPIFPQPDIQLSIPENNEPSSELIKISATDADSGHNAEILYSLAP-DAPDCFNIDKRSGVLSVAKRLDRERQEKYSFTVLARDNGSTSLQSNITVKLIVQDLNDNSPAFTH-----------PEYNFYVPENLPLSGTVGLITVTDSDAGDNAVITLSILNG-KDNFVIDPQTGVIKPNITFDREQQSSYTFMVKATDGGQPPSTSYAKVTINVVDVNDNRPVFVI 675          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A3Q3FN09 (Protocadherin 1a OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 1.054e-80
Identity = 257/900 (28.56%), Postives = 419/900 (46.56%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL---------STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFS---IATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRL----------------FSLLE-LIIHVVDGP-----SSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVI----KTVQKQKAN--RLINHNTKQIYTKKENSIN 2693
            Y + EEQ P   +G++  D  L     L +LE       P+ +   K   I+           +  +DRE       TL   +  + G  C +E      F +    L++ Q   +I   R+ V DINDN P F     TI + E          SIP+A D+D E N    Y LT   D  T+  +Q+A++      ++  L  LDRE KD Y + I+A+D G P   S +L L V + D ND+ P+F K S       +SE + +G ++  + A+D+D+G N +++++L++ +     +    I++STG I+V   LDRE   S+  +V+  D G  P+S+   +T+ + D+NDNAP +E     ++  + G           + V  ++  D D G ++  +C +    P   F+L   + +ST   K+     + L TT+ LD E +  Y + I+  D+G+P LS++  + + V+D NDN P F  + FE+   E       VL + ASD D G NA+LLY I+  +++   F I+  +G++    P+D E  ++    +   D+GSP    TA V V + D ND  P  +    + SV E+MP  + V  ++V D D G    V +++ P   KFV +N    +L+++ FDRE    Y+  +   D G+P  ++ + +TI + D NDN P +T        K SN   SF    P+      +  +   D D   NA+L Y I     PY  F + P SG + L    +    G  RLV++V D G P                   SL+E L+ H +  P     + +PD     +   +L    +L G++  V+L+ V+      +Q++  +  +     TK +Y  K+   N
Sbjct:   26 YRVQEEQPPNTLIGSLAADQGLPDSGHLYKLEVGA----PYLRVDGKTGDIF---------TTEIPIDRE-------TLRDCRSLAKGKTCYLE------FEVSVTDLIQNQSPRLIEG-RIEVQDINDNTPQFPSSVLTISVPENTIMGALF--SIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSSAL-LRVVVTDANDNAPKFEKSSYE---AEVSENSPVGHSVLQVKANDSDMGPNGEIEYTLHQAVDPVPKL--LRIDRSTGIIYVKGPLDREEISSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDEDEGENAVVTCVVAGDVP---FQLRPAS-DSTADNKRK----YFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPIFSPTLFEVDFAEENQPGEKVLDVTASDADSGTNAELLYNIVADSSIKGLFEIDPNTGEVRARSPLDREHKERYEFRVTAADKGSPVHKGTATVVVKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDKGENARVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVIT--------KPSNS--SFRRLSPLASPDSHVEVVEAEDQDSGPNAELVYNI-AGGNPYSLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRDIAGDPDSGFAAHRSNILFG--SLAGVAGVVMLILVVVFIRHRIQRETKSGYQAGKKETKDLYAPKQAPKN 869          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 286.189 bits (731), Expect = 3.126e-81
Identity = 238/812 (29.31%), Postives = 380/812 (46.80%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKL--CRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEF--QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI---------IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFS---IATIYFHDDDINQNAQLTYFI-----HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHV 2492
            Y + EEQ P   +G++  D  L     L +LE       P+ +   K   I+           +  +DRE L  CR +                     K CF+   +S+ +    +   ++  R+ V DINDN P F  P  T+ + +E A     + +IP A D+D E N  + Y L+   +   +  +Q+AN+      ++  L  LDRE KD Y + I A+D G P   S +L L V I D ND+ P+F K S       +SE + +G ++  + A+D+D+G N ++++++++       M    I +STG I V   LDRE   S    VI  D G  P+S++  +++ + D+NDNAP +E     +         I E+    + V  ++  D D G ++  +C +    P   F+L      S    KK     + L TT+ LD E I  Y + I+  D+G+P LS++  + + V+D NDN P F    FE++  E       VL + A D D G NA+L+Y II  ++    F I+ +SG++    P+D E  ++    +   D+G PS   TA V + + D ND  P  +  S + SV E+MP  + V  ++V+D D G   +V +++ P    FV +N    +L+++ FDRE    Y+  +   D G+P  ++ + +TI + D NDN P +T        K SN   SF    P+      +  +   D D   NA+L Y I     HE     F + P  G +KL    +    G  RLV+KV D G P   ++  + I+V
Sbjct:   27 YHVREEQPPNTLIGSLAADQGLPDSGHLYKLEVGA----PYLRVDGKTGEIF---------TTEIPIDRETLKDCRIK--------------------GKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSV-QENAHMGATF-AIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSAL-LRVVITDANDNAPQFEKSSYE---AEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKM--LQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP---FQLRPAGDSSVDNKKK-----YFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVT--------KPSNS--SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHE----LFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 775          

HSP 2 Score: 136.732 bits (343), Expect = 3.188e-32
Identity = 130/499 (26.05%), Postives = 219/499 (43.89%), Query Frame = 3
Query: 1182 INDENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLS-NVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD---HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMN--------PSVAEHMPKGTVVQTLSVIDPDTGP--------GGEVSVALLPWENKFVFRN----LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI--HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVIL 2597
            + D NDN P    P     ++EN    +T    +A D D+  +     DL +  P  S   S  +  +    + + IV          LDRE   +Y L I   D G+P   +S L+ ++++D NDN P F +S++E +V EN     SVL++KA+D+D+G N ++ Y I    D       I +++G +    P+D E        +  +D+G    ++T YV + + D ND  P++    +          +++E MP GT V  + V D D G          G+V   L P  +  V       L   T L+++R I D Y + ++  D+G P L+++  L + ++D NDN P     I SP +      + F+ +   G  +  +   D D   NA+L Y I    S +  F + P SG ++  S         +   +   D G P       ++I V+D   ++P + + +    VL  +P L  +    +L
Sbjct:  121 VQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDL-SAGPEASALFSLQMANDRGEKLPQLIVL-------GNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYER-IRD-YRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSP-----IFSPPLF----EVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVL 600          

HSP 3 Score: 133.65 bits (335), Expect = 2.696e-31
Identity = 113/381 (29.66%), Postives = 182/381 (47.77%), Query Frame = 3
Query:  738 LQT---LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKP-TNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHR-SNFEIQVVENKVNLSSVLKL-KASDNDIGINADLLYFIITNVDHT-FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKD 1856
            LQT   LD E+   Y + I A+D G P +LS + +L V + D ND+ P FS     L  V  +E+ + G+ +  + A D D G N++L +S+   + DS     F I+ S+G +   + LDRE  E     V  +D G P    +  + + + D NDN P F+    +F + EN   LS VG +   DMD G ++      ++++P   +F + N     T  I  SI F          DRE  S+Y+  +   D G P  S+   ++I V D+NDN P   + SN   + +       SV+++ +A D D G NA+L+Y I     H  F I+ + G++   + +  +      + +   D+G PS    A VH+ + +
Sbjct:  421 LQTTTPLDYERIRDYRVEIVAVDSGNP-ALSSTNSLRVQVTDTNDNSPIFSPP---LFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSI---IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQ---LSVEPDVGNFVVQN----GTGTILSSISF----------DREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNE 777          

HSP 4 Score: 73.1738 bits (178), Expect = 1.234e-12
Identity = 67/247 (27.13%), Postives = 114/247 (46.15%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVI-VSDCGSPPRSNSMALTVIINDENDNAPFIE 1217
              G   V I+V+  D NDN P F L +++  + E   P   +   +   +D D   NA++   +      F ++         I    + DREK+  Y   ++A+D G+P   S  + +T+N++D ND+ P  +K S N     +S  A     +  + A D D G+N++L +S+          E F+I+ S G I +  EL R+ +  +H  V+ VSD G P R     + + +N+   N   +E
Sbjct:  555 HRGTATVVIKVL--DRNDNDPKFMLSSYSFSVLENMPP--LSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ----NGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNAPVVTKPS-NSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSI----AGGNPHELFYISPSDGEIKLTKELTRK-HGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISNVSLVE 786          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 286.189 bits (731), Expect = 3.319e-80
Identity = 238/812 (29.31%), Postives = 380/812 (46.80%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKL--CRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEF--QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI---------IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFS---IATIYFHDDDINQNAQLTYFI-----HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHV 2492
            Y + EEQ P   +G++  D  L     L +LE       P+ +   K   I+           +  +DRE L  CR +                     K CF+   +S+ +    +   ++  R+ V DINDN P F  P  T+ + +E A     + +IP A D+D E N  + Y L+   +   +  +Q+AN+      ++  L  LDRE KD Y + I A+D G P   S +L L V I D ND+ P+F K S       +SE + +G ++  + A+D+D+G N ++++++++       M    I +STG I V   LDRE   S    VI  D G  P+S++  +++ + D+NDNAP +E     +         I E+    + V  ++  D D G ++  +C +    P   F+L      S    KK     + L TT+ LD E I  Y + I+  D+G+P LS++  + + V+D NDN P F    FE++  E       VL + A D D G NA+L+Y II  ++    F I+ +SG++    P+D E  ++    +   D+G PS   TA V + + D ND  P  +  S + SV E+MP  + V  ++V+D D G   +V +++ P    FV +N    +L+++ FDRE    Y+  +   D G+P  ++ + +TI + D NDN P +T        K SN   SF    P+      +  +   D D   NA+L Y I     HE     F + P  G +KL    +    G  RLV+KV D G P   ++  + I+V
Sbjct:   63 YHVREEQPPNTLIGSLAADQGLPDSGHLYKLEVGA----PYLRVDGKTGEIF---------TTEIPIDRETLKDCRIK--------------------GKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSV-QENAHMGATF-AIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSAL-LRVVITDANDNAPQFEKSSYE---AEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKM--LQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP---FQLRPAGDSSVDNKKK-----YFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVT--------KPSNS--SFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHE----LFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYV 811          

HSP 2 Score: 135.961 bits (341), Expect = 5.786e-32
Identity = 132/499 (26.45%), Postives = 221/499 (44.29%), Query Frame = 3
Query: 1182 INDENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLS-NVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD---HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPS-------LVSYSMN-PSVAEHMPKGTVVQTLSVIDPDTGP--------GGEVSVALLPWENKFVFRN----LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI--HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVIL 2597
            + D NDN P    P     ++EN    +T    +A D D+  +     DL +  P  S   S  +  +    + + IV          LDRE   +Y L I   D G+P   +S L+ ++++D NDN P F +S++E +V EN     SVL++KA+D+D+G N ++ Y I    D       I +++G +    P+D E        +  +D+G    ++T YV + + D ND  P+       L ++S    +++E MP GT V  + V D D G          G+V   L P  +  V       L   T L+++R I D Y + ++  D+G P L+++  L + ++D NDN P     I SP +      + F+ +   G  +  +   D D   NA+L Y I    S +  F + P SG ++  S         +   +   D G P       ++I V+D   ++P + + +    VL  +P L  +    +L
Sbjct:  157 VQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDL-SAGPEASALFSLQMANDRGEKLPQLIVL-------GNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYER-IRD-YRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSP-----IFSPPLF----EVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVL 636          

HSP 3 Score: 134.035 bits (336), Expect = 2.613e-31
Identity = 113/381 (29.66%), Postives = 182/381 (47.77%), Query Frame = 3
Query:  738 LQT---LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKP-TNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHR-SNFEIQVVENKVNLSSVLKL-KASDNDIGINADLLYFIITNVDHT-FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKD 1856
            LQT   LD E+   Y + I A+D G P +LS + +L V + D ND+ P FS     L  V  +E+ + G+ +  + A D D G N++L +S+   + DS     F I+ S+G +   + LDRE  E     V  +D G P    +  + + + D NDN P F+    +F + EN   LS VG +   DMD G ++      ++++P   +F + N     T  I  SI F          DRE  S+Y+  +   D G P  S+   ++I V D+NDN P   + SN   + +       SV+++ +A D D G NA+L+Y I     H  F I+ + G++   + +  +      + +   D+G PS    A VH+ + +
Sbjct:  457 LQTTTPLDYERIRDYRVEIVAVDSGNP-ALSSTNSLRVQVTDTNDNSPIFSPP---LFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSI---IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQ---LSVEPDVGNFVVQN----GTGTILSSISF----------DREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNE 813          

HSP 4 Score: 72.7886 bits (177), Expect = 1.522e-12
Identity = 67/246 (27.24%), Postives = 111/246 (45.12%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIE 1217
              G   V I+V+  D NDN P F L +++  + E   P   +   +   +D D   NA++   +      F ++         I    + DREK+  Y   ++A+D G+P   S  + +T+N++D ND+ P  +K S N     +S  A     +  + A D D G+N++L +S+          E F+I+ S G I +  EL R+      L V VSD G P R     + + +N+   N   +E
Sbjct:  591 HRGTATVVIKVL--DRNDNDPKFMLSSYSFSVLENMPP--LSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQ----NGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNAPVVTKPS-NSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSI----AGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETISNVSLVE 822          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 273.863 bits (699), Expect = 1.375e-76
Identity = 227/804 (28.23%), Postives = 383/804 (47.64%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIEC-----PEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSN 2513
            Y++ EEQ   + +GN+  DL L+   ++K    + L F P  + +    ++  +++  +      ++DRE+LC        S +F          + K CF  I +++L   E   +V IR ++ DINDN P+FQ     I I E  A +  N   +P A D D+ +N    Y L     +F +  I+     K   L   Q LDRE KD +++ I+  D G P   S ++ L V + D+ND++P F       + V + E A +G ++  + A D D+G+N+++ FS + +++ +    HF I+ STG I V   LDRE      L V+ SD  + P       TVI+N  D NDN P I+      P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V  +            F L T + LD E    Y++ I+  D+G P L+ S ++ I + D+NDN P F +   ++ + EN    + ++K+ A+D D G NA ++Y +  +    F I+  SG L   + +D E+ ++ + T+  +D GS    +   V + ++D ND  P+      N  V E++P    V  ++V D D G    V+++++  ++ F+   +   +  N+ FDRE    Y+ +V   D+G  + T+   +TI + D+NDNRP    +   P    S   + F+     G  +  ++  D+D   NA+L Y  I  S +  F +   +GN+ L    + +D G  RLV+KV+D G P     + L+   V+   SN
Sbjct:   68 YTVKEEQPENVRIGNLRTDLDLNLDPNIKL--SSALQFKPVYK-TGDVPLVRVEASTGEIFTTANRIDRERLC--------SGVF----------NEKRCFYEIEVAVLP-DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAIN--NRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAI-LQVTVSDVNDNRPVFKDSE---VEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPA-TKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSR----ATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVP---FRLKPVFNDQ-----------FLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRP----VFVIPSSNYSYDLVPFTTNP--GSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSN 818          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 271.166 bits (692), Expect = 8.797e-76
Identity = 230/819 (28.08%), Postives = 378/819 (46.15%), Query Frame = 3
Query:   81 WCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKL--CRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGM--IIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIE-------CPENFI--IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITN--VDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPI---GFSIATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP 2456
            W ++ +    ++L      + TY + EEQ P   +G++  D  L     L +LE       P+ +   K   IY              +DRE L  CR         +F          +   CF+   +S+ +  +G    ++  R+ + D NDN P F  P   + I E        + SIP+A+D+D   N    Y+L +  D   +  +Q+A+       ++  L  LDRE++D Y + I+ ID G P   S +L L + I D ND+ P+F +         ++E   +GQ++  + A+D+D+G N ++ +S ++   +   + H  I+ +TG I V   +DRE    +   V   D G   +S+   +T+ + D NDNAP I          E+ I  + E+    + V  ++  D D G ++  +C +    P   F+L + +   +T  +K     + L TT+ LD E I  Y + I+  D+G+P LS++  + + V+D NDN P F  S +E+   E       VL + A+D D G NA+LLY IIT+      F IN  +G++  +  +D E  ++    +   D+G PS   TA V V + D ND  P  +    + SV E+MP  + V  ++VID D G    V +++ P   KFV +N    +L+++ FDRE    Y+  +   D G P  ++ + +TI + D NDN P +T        K SN   S+ + +P+      +  +   D D   NA+L Y I     P+  F +    G + L    +    G  RLV+KV D G P
Sbjct:   20 WTVLLLYSCGSSL-----ASITYQLREEQPPNTLVGSLAADQGLPDTGHLYKLE----VGGPYLRVDGKTGDIY---------TTDVPIDRETLKDCR--------NLF----------EGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVG--AHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSAL-LRITITDTNDNVPKFERSHY---EGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLH--IDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVP---FQLRSASASDSTSKRK-----YFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVT--------KPSNS--SYKFLQPLTSPDTRVEKVDAEDIDTGLNAELVYSI-TGGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKP 775          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 273.092 bits (697), Expect = 1.302e-75
Identity = 224/794 (28.21%), Postives = 379/794 (47.73%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIEC-----PEN--FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELI 2483
            Y++ EEQ   + +GN+  DL L+   ++K    + L F P  + +    ++  +++  +      ++DRE+LC        S +F          + K CF  I +++L   E   +V IR ++ DINDN P+FQ     I I E  A +  N   +P A D D+ +N    Y L     +F +  I+     K   L   Q LDRE KD +++ I+  D G P   S ++ L V + D+ND++P F       + V + E A +G ++  + A D D+G+N+++ FS + +++ +    HF I+ STG I V   LDRE      L V+ SD  + P       TVI+N  D NDN P I+      P N   ++ EN    + +  I   D D+  +   +C   +  P   F+L  V  +            F L T + LD E    Y++ I+  D+G P L+ S ++ I + D+NDN P F +   ++ + EN    + ++K+ A+D D G NA ++Y +  +    F I+  SG L   + +D E+ ++ + T+  +D GS    +   V + ++D ND  P+      N  V E++P    V  ++V D D G    V+++++  ++ F+   +   +  N+ FDRE    Y+ +V   D+G  + T+   +TI + D+NDNRP    +   P    S   + F+     G  +  ++  D+D   NA+L Y  I  S +  F +   +GN+ L    + +D G  RLV+KV+D G P     + L+
Sbjct:   68 YTVKEEQPENVRIGNLRTDLDLNLDPNIKL--SSALQFKPVYK-TGDVPLVRVEASTGEIFTTANRIDRERLC--------SGVF----------NEKRCFYEIEVAVLP-DEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAIN--NRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAI-LQVTVSDVNDNRPVFKDSE---VEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPA-TKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSR----ATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVP---FRLKPVFNDQ-----------FLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRP----VFVIPSSNYSYDLVPFTTNP--GSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALV 808          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.506 bits (615), Expect = 6.687e-67
Identity = 235/839 (28.01%), Postives = 374/839 (44.58%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKD----SANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKD------KFTI---------------KYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWN--ELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC--------PENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVS--DQNDNIPFFHR--------SNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-----TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPS------VAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLP-----WENKF------VFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTI-SFSYQEPIGFSIA-TIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNG 2450
            Y ++EE    + +G +I DLR   +L         + FFP +   S   +        +  S +L +  ++DRE LC  +    +S  F                 + +++  +    + ++ ++++V DIND+ P F+ P+  + I E +A        +P AID D   N+   YR++           F++                   + +   +   + LDRE    Y +++   D G P  LSGS+ LT+ ++D ND+ P F         V I+E +K+G ++  + A D D G N  + +S + KLT         ++ +TG + V N  +LDRE      L V+  D G   RS S+ +TV +ND+NDNAP  E         P+  + I EN    + V  I   D D G+S      L        F  +   L S   ++      F L TT +LD E    Y++ +L  D G+P+LS  KL+++++S  D NDN P F          + +E+ + EN    + VL L A+D D G N  + + +       +V   F +N  +G L    P+D E+  +  +++   D GSP     A V VT+ D ND  P+ V  S + +      V E    GT V T+S  D D G    V++ L+      W          V R L +L     DRE   +Y + V   D+G+P L+ S  ++IT+SD NDN P +T    SP    + + + +FS   P G  +  ++  +D D   N +  Y  I  + K  F+L+ DSG L L  T S  D G  RLV++V+D G
Sbjct:   31 YEVDEE----VLVGYVIGDLRQSNLL--------CVCFFPPAPHVSPLPLHTPSLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMH------------TVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVG--RRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNP-KLSGSVLLTIVVVDANDNAPVFVDPPTR--PVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRL-------EFP-TGAELASPNKVQ------FLLKTTRLLDYEEAQQYNVSVLAADRGTPKLS--KLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVL-----DREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVIT----SPNTNDTWKHVRTFS---PAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 143.665 bits (361), Expect = 3.463e-35
Identity = 153/629 (24.32%), Postives = 268/629 (42.61%), Query Frame = 3
Query:  828 LNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKST-------------------GAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFF--------HRSNFEIQVVENKVNLSSVLKLKASDNDIGINA--DLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNP------------SVAEHMPKGTVVQTLSVIDPDTGPGGEVSVA---LLPWENKFVFRNLNLLTN-----LEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQT---ISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPD---SGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITN 2537
            L++ + + DIND  P F    LN   V ISE   +G+ +    A D D G NS   + ++    D   +  F + +S                      + +  +LDRE   S  L +   D G+P  S S+ LT+++ D NDNAP F++ P   + I E+    ++V  ++A D D+G +   +            KL+++  ++  ++  +      +     LDRE +  + LV++  D G    S S  +++ ++D NDN P F        +  +  +++VEN  + + V+ +  SD D+G +   D+     T  +     N+    L     +D+E  +Q  +++   D+G+P  +    + +++ D+ND  P      MNP            S+ E+ P GTVV  L   D D+GP G ++     L   E+     +LN+ T         DRE   +Y + V   D G P+     ++ +T+ D NDN P          V +SN T     F  +E   +G  + T+   D D   NA++   +     P +I        G ++        D   + L ++  D+G P L +   + I V D   +N +  +IT+
Sbjct:  128 LDVQLLVRDINDHAPAFRAPHLN---VSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSF-------HTKLTSLATQAALHVDGTTGL-VTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASP-NKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVF----MNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTF--------VGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSD---TNDNAPVITS 729          

HSP 3 Score: 53.1434 bits (126), Expect = 2.943e-7
Identity = 62/282 (21.99%), Postives = 114/282 (40.43%), Query Frame = 3
Query:  318 SQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIF-QLPNFTIMIKE---EQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIA-TIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVI-VSDCGS 1145
            + +L L   +DREK  R++ ++           C+  +  +    ++                RV V D NDN P F  + N T  + +   E+  S   Y       D D   NA++   L        I          +  L  LDRE + +Y + + A+D G+P +LS S  +++ + D ND+ P  +  + N     +   +  G  +  ++ A+D D G+N +  +    ++        F +N  +GA+ +   +   + E +H  V+ V D G 
Sbjct:  563 TGQLTLATPLDREKRMRYELSVEA---------CDGGSPQRKARAIV----------------RVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRP-ALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLY----EIIGGNPKGIFLLNADSGALSLARTVS-SLDEGLHRLVVRVRDRGG 813          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 227.254 bits (578), Expect = 8.362e-62
Identity = 221/798 (27.69%), Postives = 363/798 (45.49%), Query Frame = 3
Query:  144 TYSMNEEQDPPIYLGNIIHDLRL-DKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMI--IVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHK----DKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEH----FFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIE-----CPEN---FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIAT-IYFHDDDINQNAQLTYFIHESEKPYFILHPDS--GNLKLNSTCSVSDLGSFRLVIKVQDNG 2450
            +Y + EE     ++GN   DLRL D  L L      T          +   ++  +    +     +K+DRE LC  Q                  +    C + + + +L  Q G    ++ +R+ V DINDN P F  P  T+ + E  AP+   +   P A D D E N    Y L          F +   + AN  K+  L   ++LDRE++  Y + + A+D G P   SGS  L +N+ D ND+ P F +  +N   V I E + +G  +  + A D D G+N+++ + L      + + +     F +++++G + V   L+RE      + ++ +D G  P   +  +TV + D NDN+P IE      P N   +I E +   L  V  I   D D GA+   +C + N  P   F+L  +T  +           + L T   LD E  + Y + I   D G+  LS +  ++I + D NDN P F    +++ V EN V    ++ + A+D D+  NA+++YF+  +    F ++  +G +   E +D E+    + TI  KDQG P     A V V + D+ND  P       +  V E++PK + V  ++V D D G  G V +++L  +N+ +F     +  + +N+ FDRE    Y + V   D G+P  ++++ + I + DINDN P +        +  SN T  F     +  +I T +   D+D   NA+L Y I     P+ + H D   GN+ L    + +  G  RLV++V D G
Sbjct:   40 SYRVAEELREGAFIGNPSVDLRLADYNLEL------TYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQ------------------DPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPE-NAPAGKRFPIQP-ANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPH-SGSAVLRINVTDTNDNSPVFDQAEVN---VEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLP-VALITVSDPDIGANGAVTCYIYN--PEVPFQLKKLTYPNQ----------YLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVL-------MPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHI-VGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 110.538 bits (275), Expect = 8.392e-25
Identity = 130/480 (27.08%), Postives = 213/480 (44.38%), Query Frame = 3
Query: 1182 INDENDNAPFIECPENFI-IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPT--NSFKLS---NVTLESTTY--IKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNV---------DHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSL--------VSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL----LPWE-NKFVFRNLNLLTNLE-FDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAI 2528
            + D NDNAP    P   + + EN           A D DS A+     +L+   P   ++F+LS       E   Y  ++KS            LDRE    Y + +   D GSP  S S ++ I V+D NDN P F ++   +++ EN    + V++L ASD D G NA+++Y + T+             F ++Q SG +     ++ E      I I   D+G      TA V VT+ D+ND  P++        V+  +  S A H+     V  ++V DPD G  G V+  +    +P++  K  + N  LL   E  D E  ++Y + +   D G   L+ ++ +TI + D NDN P  T     P  K+S           IG  + T+   D D+++NA++ YF+       F + P++G + L          ++   I  +D G P L     +I++V+D   + P +++
Sbjct:  143 VEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKS------------LDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHV--NLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFT----EPTYKVS-----VPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSL 599          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 2.201e-53
Identity = 191/686 (27.84%), Postives = 289/686 (42.13%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISV-FISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVF-----TFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR--NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISF-SYQEPIGFS--IATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLK---------LNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVV 2495
            T+ V+V D NDN P F        + E+ AP   +   +  A D D  LNA I YRL      F++      +  +I    +LDRE ++ Y++ + A+D G    LS S  L V + D+ND  PRF    LN   V +    A  G  +  + A D D G N  L+FSL+       A   F ++   G IH    L +   + + L V VSD G+PPRS    +TV   D  +   F   P +F   E++   +T+  + A                     +S +   V+    +      VF     + E+S    LD E    Y LV+   D+G P  S    + + V D NDN P F  S F  +V EN     +++ L A D D GIN  + Y II  N+ + F +N  SG++  +  +D E      +T+   D+GSP+   T  V +++ D ND  P       +  V E    G  V  +S +D D GP   ++ +LL     F        +  +   +RE    Y++ V   D   P  T S  +TI + D+NDN PR              QT  +  + EP      +A +   D D   N Q+ +F+  S+   F +  DSG +               S ++L  +  V+   D G P L S   + I++V
Sbjct:   11 TVTVLVEDENDNLPRFGAAELRAAVPED-APIGSDVALV-NATDADAGLNAIISYRLRGGDGHFSVN----PSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF----LNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLS-----GSASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAA--------------------RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPEN-TPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRF------------GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMR-SQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIV 642          

HSP 2 Score: 159.844 bits (403), Expect = 8.766e-40
Identity = 156/639 (24.41%), Postives = 281/639 (43.97%), Query Frame = 3
Query:  495 IVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLT---NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISE--QAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHK---------QITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF-----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE 2339
            + T+ V   D  + P     P  +   +E+Q P      +I +   +       + Y L    N  D F +     + E+ +   + LD E +  Y +++EA D G P   S  L L V+++DIND+ P FS       S F ++  +    +TI  + A D D G N ++ +S+     D      F +N ++G I   + LDRE   S  L V  +D GSP +  ++ + + + DENDN+P F +     I   +  E + VGF    +   D D G ++  +  L++  P+  F +   T               E++ +  L+RE+ S Y++ +   D   P  + S  ++I+V D NDN P F ++ + I+  E     + V ++ ASD D G N  + +F+ +  ++ F + + SG+++ + P+ +             + +  +   D+G P  ++ A V + I   N   P  +    +  VA  +  GT +  +S +DPD    G+++ +++       F       L+L  +L  D      +S+ V  RD G+P L++     I++++ N   PR  H    P ++     +S     P G S+A +   D D   N  + Y I   +
Sbjct:  216 VTTVTVRFRDAGEFPRFAPGPR-SFSFREDQPPG----TTITVVAARSSRRAGPVSYHLASGGNLGDVFAVD--PQSGEVSV--HRALDHEYQHHYELVVEARDSGFP-PFSAYLKLEVDVLDINDNAPEFSS------SRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSI----IDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQ-----IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD--PSLPFSIHPST--------------GEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGD--AGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAH----PPLE-----LSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGD 798          

HSP 3 Score: 142.895 bits (359), Expect = 1.434e-34
Identity = 161/660 (24.39%), Postives = 285/660 (43.18%), Query Frame = 3
Query:  624 AIDQDIELNAKILYRLT--NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENF-IIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVT-LESTTYI--KKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGS-PSFTT-TAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNL-----EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQN-AQLTYFIHESE---KPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVV---DGPSSNPDYAIITNF 2540
            A+D D ++N +I Y +   N   +F +        L +    +L  +    + + +EA D G+P  LS      +++ + N   PRF+   L L    + E    G ++A + A D D G N  + +S+     D   +  F I++++G + +  ELD E  +  +L V  +D G   ++    +++ + D NDN P +   + + +I EN    +TV  + A D DS              P+N+  + ++   E+  ++  +K+ V    L+T   LD E   TY L +   +       ++  + + ++  N+  P F +  +   V E+    + V  + A+D D GI+  + Y +   +    F +N+ +G++     +D ER    T+ +  K+ GS   F      V+V I D ND PP   S   +  V+E    GT V  +S  D D+ PG      L+   N     ++N  T L       DRE    Y++ V+  D G+P  T + ++ + + D+NDN P L              +   +  +P G ++  +   D D+  N    T+ +  S+   + YF L   SG LK            F L + + D G+P L S + L + V+   D PS   D  +  N+
Sbjct:  675 AVDPDRDVNGQIAYSVVGGNASRRFDV---DAGGFLHL--RASLAGDAGSIFSVTVEARDRGRP-PLSSRATAIISVTEENQYAPRFAHPPLELS---LPENHPAGSSLARVTATDTDAGVNGAIVYSIASG--DGSGL--FDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADS--------------PSNAVTMYSLDDGEADLFVLNQKTGV----LTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLL-----------TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNY 1290          

HSP 4 Score: 135.961 bits (341), Expect = 1.906e-32
Identity = 139/570 (24.39%), Postives = 245/570 (42.98%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-KIAPLQTLDREKK------DKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRL--TNSILLTITISDIND 2168
            + ++V+D+NDN P F    + I   E   PS+       + A D D   N ++ + + +  + F +   + + E+  + PL+  D          +KY  ++ A+D G+P  LS    +T+NI+  N + PRF +E     S  ++   + G  I  + A D D   N ++ +S+        A   F ++ + G +H+   L  +      + V   D G PP S+     + + +EN  AP F   P    + EN    S++  + A D D+G +      + +   +  F +S  + +        ++   EL      D E    Y+L +   D G    +    +SI V+D NDN P  + S++   + EN  + ++VL + A D D   NA  +Y +       F++NQ +G L     +D+E  +   +T+   +       +TA VHV I  +N+  P  V    N  V+E  P G  V ++   D D G  G V   L        F        ++ + + DRE     ++ VI ++ G  R    + +L+ + I+D ND
Sbjct:  525 VTIVVDDVNDNAPRFGQTAYYIEFPE---PSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVG--RDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRP-PLSSDATVTINIVVPNANAPRFLRERY---STPVAATVRAGTRILDMSAVDPDRDVNGQIAYSV----VGGNASRRFDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGD--------VLLVGEL------DYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND 1066          

HSP 5 Score: 134.42 bits (337), Expect = 6.116e-32
Identity = 131/468 (27.99%), Postives = 208/468 (44.44%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHK-DKFTIKYIQIANELKIAPLQT---LDREKKDKYLIIIEAIDCGKPDSLS-GSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRS---NSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSI-VFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD---HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVP 1871
            + + V D+NDNPP+    ++  +I E  APS      +  A+D D   NA  +Y L + + D F +         K   L T   LD E K  Y + + A +   PD+    +  + V I  +N+  PRF +   N +   +SE A +G  + ++FA D D G +  + + L     +S + + F +N+ TG I V ++LDRE   S  L VI  + GS  R    + + + V I D ND   F     +  + E     + V  + A D DS              P      S +          SI   T  +   S LDRE++  Y+L ++  D G P  + + ++ + + D NDN PF   S+   +V EN+    +VL L+A D D+  N     F +   D     +    +SG L    PID E+  +  + +   D GSP  T+T  +H+++ D ND P
Sbjct:  846 VSISVTDVNDNPPMLNASDYYPVIPE-NAPSGTTVLVM-DAVDADSPSNAVTMYSLDDGEADLFVLNQ-------KTGVLTTQGFLDYETKQTYELTVRAFN--YPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFV---VSESAPVGAPVGSVFATDRDAGIDGTVFYML---FGESRS-KGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSI-RGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDS--------------PPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSS--AKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          

HSP 6 Score: 133.265 bits (334), Expect = 1.250e-31
Identity = 135/554 (24.37%), Postives = 227/554 (40.97%), Query Frame = 3
Query:  801 GKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCG-SPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQD 2444
            G+P  L+G+  +TV + D ND+ PRF    L      + E A IG  +A + A D D G N+ + + L  +  D     HF +N STG I     LDRE  ES  L V   D G +P  S+S  L V + D ND+ P F+  P       +    + V  + A D D+G +     DL        F LS       +   +  V     +     D       +L +   D G+P  S    +++   D  +  P F          E++   +++  + A  +              N+   F ++  SG++     +D E      + +  +D G P F+    + V + D+ND  P   S      V E+ P  T+V  L+ +D D+G  G+V  +++      VFR    +  + +    DRE    Y + V   D G P    ++ + I+++D NDN PR T +           +        +GF +  +   D D   NA +T+ + +   P F +HP +G + ++   +  D   + + ++  D
Sbjct:    2 GEP-RLTGTGTVTVLVEDENDNLPRFGAAELRAA---VPEDAPIGSDVALVNATDADAGLNAIISYRL--RGGDG----HFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNG----DL-------RFSLSGSASAGFSVDPRRGVIHAARALQGPRD-----DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIV-VLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIF----------SAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP-FSIHPSTGEITVSRRLNREDRSGYAVKVRASD 516          

HSP 7 Score: 128.257 bits (321), Expect = 5.139e-30
Identity = 142/569 (24.96%), Postives = 243/569 (42.71%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRL--SNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPG-GEVSVALL----PWENKFVFRNLNLL-TNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDN 2171
             T  + V + N   P F  P   + + E   P+  +   +  A D D  +N  I+Y + +          + + ++ +  +  LD E +  Y + + A D G       S  +++++ D+ND+ P  +      +   I E A  G T+  + A D D  +N+   +SL++   D      F +N+ TG +     LD E  ++  L V   +       ++  + V I   N+  P F++   NF++ E+    + VG + A D D+G        L     +  F ++                T E+  +S LDRE  ++ +L ++  + GS R    +  L+++ ++D ND  P F  + +  +V E     + V+ + A D D         F+I   N    F IN  +G +    P+D E      +T+   D G P  T T  V V ++D+ND  P L++ S    V E+ P G  V  L   DPD  P  G  +  LL     W   F   +  LL T    DRE   ++ + V + D G P LT+++ L +++ D NDN
Sbjct:  739 ATAIISVTEENQYAPRFAHPPLELSLPENH-PAGSSLARV-TATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLL--VGELDYETEKLYNLSVCAADGGWQAKTECS-GVSISVTDVNDNPPMLNASDYYPV---IPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEAD-----LFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNE--------------HTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAK--VTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 8 Score: 125.176 bits (313), Expect = 4.228e-29
Identity = 170/706 (24.08%), Postives = 273/706 (38.67%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDK-FTI----KYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-------FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPW-ENKFVFRNLNLLTNLEFDREIN----------DKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPI------GFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGS-FRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
             T+ V V D+ND+ P F L    +      AP+     ++  A D D   N  + + L+      F++      I  A  L+           +D   + +   D G P   S    +TV   D  +  PRF+       S    E    G TI  + A  +          +    L D +A     ++  +G + V   LD E      L V   D G PP S  + L V + D NDNAP       + + PEN           T+  + A D DSG +      +I+    N F+++                + E+ + S LDREN+++Y L +   D GSP    +  + I V+D+NDN P F +  F   V E+      VL++   D D G NA  + F + +    F I+ ++G++     ++ E      + +   D   P++T +  V + + D+ND  P     +      E      +V  +S  D D G  G+V   +    EN  V R+   + ++   R  +          +KYS +V   D G+P L++   +TI I   N N PR                +   Y  P+      G  I  +   D D + N Q+ Y +              G L L ++ +  D GS F + ++ +D G P L S    II V +     P +A
Sbjct:  114 ATLVVAVTDVNDHTPRF-LNAPYVAYAPSSAPAGTAVFAV-TARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQ---------GPRDDLTLTVRVSDGGAP-PRSAVTTVTVRFRDAGEF-PRFAP---GPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFA-----VDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPR-------TIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNP--------------NSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNA-AITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRF---------------LRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLA-GDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFA 756          

HSP 9 Score: 116.701 bits (291), Expect = 1.682e-26
Identity = 117/475 (24.63%), Postives = 201/475 (42.32%), Query Frame = 3
Query: 1140 GSPPRSNSMALTVIINDENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNG-SPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVP---PSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWEN-KFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE-KPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAII 2531
            G P  + +  +TV++ DENDN P     E    + E+    S V  + A D D+G ++  S  L       S   S                T ++ TT+ LDRE   +Y L +   D G +P LS+S  + + V+D ND+ P F  + +      +    ++V  + A D D G N DL + +  +    F ++   G ++    +   R   +T+T+   D G+P  +    V V  +D  + P   P   S+S      E  P GT +  ++         G VS  L    N   VF    ++  +  +   D E    Y ++V  RD+G P  +  + L + + DINDN P  +          S++  +   +     +I  +   D D   N Q+ Y I +      F ++P+SG ++  ST    ++ S+ L +K  D G+P     ++++I V D   ++P +  I
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPS----------------TGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPR-DDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFR----EDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFS----------SSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI 443          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 2.458e-53
Identity = 191/686 (27.84%), Postives = 289/686 (42.13%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISV-FISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVF-----TFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR--NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISF-SYQEPIGFS--IATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLK---------LNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVV 2495
            T+ V+V D NDN P F        + E+ AP   +   +  A D D  LNA I YRL      F++      +  +I    +LDRE ++ Y++ + A+D G    LS S  L V + D+ND  PRF    LN   V +    A  G  +  + A D D G N  L+FSL+       A   F ++   G IH    L +   + + L V VSD G+PPRS    +TV   D  +   F   P +F   E++   +T+  + A                     +S +   V+    +      VF     + E+S    LD E    Y LV+   D+G P  S    + + V D NDN P F  S F  +V EN     +++ L A D D GIN  + Y II  N+ + F +N  SG++  +  +D E      +T+   D+GSP+   T  V +++ D ND  P       +  V E    G  V  +S +D D GP   ++ +LL     F        +  +   +RE    Y++ V   D   P  T S  +TI + D+NDN PR              QT  +  + EP      +A +   D D   N Q+ +F+  S+   F +  DSG +               S ++L  +  V+   D G P L S   + I++V
Sbjct:   11 TVTVLVEDENDNLPRFGAAELRAAVPED-APIGSDVALV-NATDADAGLNAIISYRLRGGDGHFSVN----PSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF----LNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLS-----GSASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTITVVAA--------------------RSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPEN-TPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRF------------GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMR-SQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIV 642          

HSP 2 Score: 159.844 bits (403), Expect = 8.971e-40
Identity = 156/639 (24.41%), Postives = 281/639 (43.97%), Query Frame = 3
Query:  495 IVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLT---NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISE--QAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGF----IKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHK---------QITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF-----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE 2339
            + T+ V   D  + P     P  +   +E+Q P      +I +   +       + Y L    N  D F +     + E+ +   + LD E +  Y +++EA D G P   S  L L V+++DIND+ P FS       S F ++  +    +TI  + A D D G N ++ +S+     D      F +N ++G I   + LDRE   S  L V  +D GSP +  ++ + + + DENDN+P F +     I   +  E + VGF    +   D D G ++  +  L++  P+  F +   T               E++ +  L+RE+ S Y++ +   D   P  + S  ++I+V D NDN P F ++ + I+  E     + V ++ ASD D G N  + +F+ +  ++ F + + SG+++ + P+ +             + +  +   D+G P  ++ A V + I   N   P  +    +  VA  +  GT +  +S +DPD    G+++ +++       F       L+L  +L  D      +S+ V  RD G+P L++     I++++ N   PR  H    P ++     +S     P G S+A +   D D   N  + Y I   +
Sbjct:  216 VTTVTVRFRDAGEFPRFAPGPR-SFSFREDQPPG----TTITVVAARSSRRAGPVSYHLASGGNLGDVFAVD--PQSGEVSV--HRALDHEYQHHYELVVEARDSGFP-PFSAYLKLEVDVLDINDNAPEFSS------SRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSI----IDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQ-----IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLD--PSLPFSIHPST--------------GEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN-FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGD--AGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAH----PPLE-----LSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGD 798          

HSP 3 Score: 142.895 bits (359), Expect = 1.531e-34
Identity = 161/660 (24.39%), Postives = 285/660 (43.18%), Query Frame = 3
Query:  624 AIDQDIELNAKILYRLT--NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENF-IIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVT-LESTTYI--KKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGS-PSFTT-TAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNL-----EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQN-AQLTYFIHESE---KPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVV---DGPSSNPDYAIITNF 2540
            A+D D ++N +I Y +   N   +F +        L +    +L  +    + + +EA D G+P  LS      +++ + N   PRF+   L L    + E    G ++A + A D D G N  + +S+     D   +  F I++++G + +  ELD E  +  +L V  +D G   ++    +++ + D NDN P +   + + +I EN    +TV  + A D DS              P+N+  + ++   E+  ++  +K+ V    L+T   LD E   TY L +   +       ++  + + ++  N+  P F +  +   V E+    + V  + A+D D GI+  + Y +   +    F +N+ +G++     +D ER    T+ +  K+ GS   F      V+V I D ND PP   S   +  V+E    GT V  +S  D D+ PG      L+   N     ++N  T L       DRE    Y++ V+  D G+P  T + ++ + + D+NDN P L              +   +  +P G ++  +   D D+  N    T+ +  S+   + YF L   SG LK            F L + + D G+P L S + L + V+   D PS   D  +  N+
Sbjct:  675 AVDPDRDVNGQIAYSVVGGNASRRFDV---DAGGFLHL--RASLAGDAGSIFSVTVEARDRGRP-PLSSRATAIISVTEENQYAPRFAHPPLELS---LPENHPAGSSLARVTATDTDAGVNGAIVYSIASG--DGSGL--FDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADS--------------PSNAVTMYSLDDGEADLFVLNQKTGV----LTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLL-----------TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNY 1290          

HSP 4 Score: 135.961 bits (341), Expect = 2.124e-32
Identity = 139/570 (24.39%), Postives = 245/570 (42.98%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-KIAPLQTLDREKK------DKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRL--TNSILLTITISDIND 2168
            + ++V+D+NDN P F    + I   E   PS+       + A D D   N ++ + + +  + F +   + + E+  + PL+  D          +KY  ++ A+D G+P  LS    +T+NI+  N + PRF +E     S  ++   + G  I  + A D D   N ++ +S+        A   F ++ + G +H+   L  +      + V   D G PP S+     + + +EN  AP F   P    + EN    S++  + A D D+G +      + +   +  F +S  + +        ++   EL      D E    Y+L +   D G    +    +SI V+D NDN P  + S++   + EN  + ++VL + A D D   NA  +Y +       F++NQ +G L     +D+E  +   +T+   +       +TA VHV I  +N+  P  V    N  V+E  P G  V ++   D D G  G V   L        F        ++ + + DRE     ++ VI ++ G  R    + +L+ + I+D ND
Sbjct:  525 VTIVVDDVNDNAPRFGQTAYYIEFPE---PSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVG--RDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRP-PLSSDATVTINIVVPNANAPRFLRERY---STPVAATVRAGTRILDMSAVDPDRDVNGQIAYSV----VGGNASRRFDVD-AGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGD--------VLLVGEL------DYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND 1066          

HSP 5 Score: 134.035 bits (336), Expect = 6.645e-32
Identity = 131/468 (27.99%), Postives = 208/468 (44.44%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHK-DKFTIKYIQIANELKIAPLQT---LDREKKDKYLIIIEAIDCGKPDSLS-GSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRS---NSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSI-VFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD---HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVP 1871
            + + V D+NDNPP+    ++  +I E  APS      +  A+D D   NA  +Y L + + D F +         K   L T   LD E K  Y + + A +   PD+    +  + V I  +N+  PRF +   N +   +SE A +G  + ++FA D D G +  + + L     +S + + F +N+ TG I V ++LDRE   S  L VI  + GS  R    + + + V I D ND   F     +  + E     + V  + A D DS              P      S +          SI   T  +   S LDRE++  Y+L ++  D G P  + + ++ + + D NDN PF   S+   +V EN+    +VL L+A D D+  N     F +   D     +    +SG L    PID E+  +  + +   D GSP  T+T  +H+++ D ND P
Sbjct:  846 VSISVTDVNDNPPMLNASDYYPVIPE-NAPSGTTVLVM-DAVDADSPSNAVTMYSLDDGEADLFVLNQ-------KTGVLTTQGFLDYETKQTYELTVRAFN--YPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFV---VSESAPVGAPVGSVFATDRDAGIDGTVFYML---FGESRS-KGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSI-RGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDS--------------PPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSS--AKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNP 1278          

HSP 6 Score: 133.265 bits (334), Expect = 1.358e-31
Identity = 135/554 (24.37%), Postives = 227/554 (40.97%), Query Frame = 3
Query:  801 GKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCG-SPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQD 2444
            G+P  L+G+  +TV + D ND+ PRF    L      + E A IG  +A + A D D G N+ + + L  +  D     HF +N STG I     LDRE  ES  L V   D G +P  S+S  L V + D ND+ P F+  P       +    + V  + A D D+G +     DL        F LS       +   +  V     +     D       +L +   D G+P  S    +++   D  +  P F          E++   +++  + A  +              N+   F ++  SG++     +D E      + +  +D G P F+    + V + D+ND  P   S      V E+ P  T+V  L+ +D D+G  G+V  +++      VFR    +  + +    DRE    Y + V   D G P    ++ + I+++D NDN PR T +           +        +GF +  +   D D   NA +T+ + +   P F +HP +G + ++   +  D   + + ++  D
Sbjct:    2 GEP-RLTGTGTVTVLVEDENDNLPRFGAAELRAA---VPEDAPIGSDVALVNATDADAGLNAIISYRL--RGGDG----HFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNG----DL-------RFSLSGSASAGFSVDPRRGVIHAARALQGPRD-----DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIV-VLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIF----------SAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP-FSIHPSTGEITVSRRLNREDRSGYAVKVRASD 516          

HSP 7 Score: 127.872 bits (320), Expect = 5.926e-30
Identity = 142/569 (24.96%), Postives = 243/569 (42.71%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRL--SNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPG-GEVSVALL----PWENKFVFRNLNLL-TNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDN 2171
             T  + V + N   P F  P   + + E   P+  +   +  A D D  +N  I+Y + +          + + ++ +  +  LD E +  Y + + A D G       S  +++++ D+ND+ P  +      +   I E A  G T+  + A D D  +N+   +SL++   D      F +N+ TG +     LD E  ++  L V   +       ++  + V I   N+  P F++   NF++ E+    + VG + A D D+G        L     +  F ++                T E+  +S LDRE  ++ +L ++  + GS R    +  L+++ ++D ND  P F  + +  +V E     + V+ + A D D         F+I   N    F IN  +G +    P+D E      +T+   D G P  T T  V V ++D+ND  P L++ S    V E+ P G  V  L   DPD  P  G  +  LL     W   F   +  LL T    DRE   ++ + V + D G P LT+++ L +++ D NDN
Sbjct:  739 ATAIISVTEENQYAPRFAHPPLELSLPENH-PAGSSLARV-TATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLL--VGELDYETEKLYNLSVCAADGGWQAKTECS-GVSISVTDVNDNPPMLNASDYYPV---IPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEAD-----LFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNE--------------HTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAK--VTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 8 Score: 125.176 bits (313), Expect = 4.292e-29
Identity = 170/706 (24.08%), Postives = 273/706 (38.67%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDK-FTI----KYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-------FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPW-ENKFVFRNLNLLTNLEFDREIN----------DKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPI------GFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGS-FRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
             T+ V V D+ND+ P F L    +      AP+     ++  A D D   N  + + L+      F++      I  A  L+           +D   + +   D G P   S    +TV   D  +  PRF+       S    E    G TI  + A  +          +    L D +A     ++  +G + V   LD E      L V   D G PP S  + L V + D NDNAP       + + PEN           T+  + A D DSG +      +I+    N F+++                + E+ + S LDREN+++Y L +   D GSP    +  + I V+D+NDN P F +  F   V E+      VL++   D D G NA  + F + +    F I+ ++G++     ++ E      + +   D   P++T +  V + + D+ND  P     +      E      +V  +S  D D G  G+V   +    EN  V R+   + ++   R  +          +KYS +V   D G+P L++   +TI I   N N PR                +   Y  P+      G  I  +   D D + N Q+ Y +              G L L ++ +  D GS F + ++ +D G P L S    II V +     P +A
Sbjct:  114 ATLVVAVTDVNDHTPRF-LNAPYVAYAPSSAPAGTAVFAV-TARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQ---------GPRDDLTLTVRVSDGGAP-PRSAVTTVTVRFRDAGEF-PRFAP---GPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFA-----VDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPR-------TIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNP--------------NSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDADEGPNA-AITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRF---------------LRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLA-GDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFA 756          

HSP 9 Score: 116.701 bits (291), Expect = 1.722e-26
Identity = 117/475 (24.63%), Postives = 201/475 (42.32%), Query Frame = 3
Query: 1140 GSPPRSNSMALTVIINDENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNG-SPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVP---PSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWEN-KFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE-KPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAII 2531
            G P  + +  +TV++ DENDN P     E    + E+    S V  + A D D+G ++  S  L       S   S                T ++ TT+ LDRE   +Y L +   D G +P LS+S  + + V+D ND+ P F  + +      +    ++V  + A D D G N DL + +  +    F ++   G ++    +   R   +T+T+   D G+P  +    V V  +D  + P   P   S+S      E  P GT +  ++         G VS  L    N   VF    ++  +  +   D E    Y ++V  RD+G P  +  + L + + DINDN P  +          S++  +   +     +I  +   D D   N Q+ Y I +      F ++P+SG ++  ST    ++ S+ L +K  D G+P     ++++I V D   ++P +  I
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFSVNPS----------------TGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPR-DDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFR----EDQPPGTTITVVAARSSRRA--GPVSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFS----------SSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQI 443          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.978 bits (502), Expect = 9.825e-52
Identity = 170/632 (26.90%), Postives = 283/632 (44.78%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYR-LTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQT----IATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIE--ENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGS---PRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHT----------FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLE----FDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISF--SYQEPIGFSIATIYFHDDDINQNAQLTY 2321
            + + V D+NDNPP+F +P   + ++E     +  +     A D D   NA + Y  L+  +  F +     A    +   + LDRE++  YL+ + A D     + +    L+V + D ND+ PRFS+ + +       + A  G+T    I T+ A D D G   ++ ++L       +A   F ++  TGA++V   LDRE      L    +D G    + +  L V + D NDNAP ++  ++   E  E+    +++  I A D D G ++     + +  P   F + N                 +LS    LDRE  S Y+LV+   D       RLS++  +S++++D NDN P F      +   ++ V  + V  ++A D D G N+ + Y + T+ +            F +N  +G++  +  +D E  +   +T+   D+G P  T+TA + VT+ D ND  P         ++AE  P GT V  LS  DPD G  GE+   +   +    FR   +L  L      DRE    Y + V  RD G P  +++  + +T+SD+ND          SP  ++S  T+    + Q P    I  +   DDD+  + Q+TY
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLS--ATDADQGQNALVTYSVLSGSEGAFVVD----AASGVLRASRRLDREERASYLLTVRASDG----THATDARLSVAVRDANDNSPRFSRHAYSFD--VAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQN-DSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGN---------------DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVG-AVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDC---------SPAFQLSPYTVHARENTQGPPVL-ILQVVARDDDLGSSGQVTY 2092          

HSP 2 Score: 194.897 bits (494), Expect = 8.310e-51
Identity = 171/688 (24.85%), Postives = 313/688 (45.49%), Query Frame = 3
Query:  345 VDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMII-VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRL--TNHKDKFTI-----KYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVF-ISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREI------YESVHLFVIVSDCGSP-PRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL---LPWENKFVF--RNLNLLTNLEFDREINDK-YSILVILRDNGQPRLTNSILL---TITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI 2327
            V  ++   F    S  +IF++  I   E           L ++    G+    ++ V+V+D+N++ P+F   ++ + I E++ P +  + S+  A D+D   N ++ Y +   N  +KF I      Y++            LDRE +++Y + + A+D G  + LS S+ + V ++D+ND++P F+  S     VF   E+ ++G  +  + A D D G+N  + +S  +         +F ++  TG I      DRE         S    V+ +D G P P  +   + V + D NDN P F +      + E+   L+ +  + A D+D G +      +        F     T++++         T +++    LDRE  ++Y+LV+   D+G+  L+ S  +++ V D+NDN P F  S   +  +E+      ++ L ASD D G + D+ Y I+    H TF I++++G ++    +DFE  +   + +  +D G P  ++   + V ++D ND PP+ +   +  S+ E++P GT V T++  DPD    GE+  ++    P    F     +  + T  E DRE+    + + V   D   P  T    L   T+ ++D NDN PR      +P   + +       +   G  + T+   D D  +NA + Y +
Sbjct:  696 VSGDQRGSFSIEWSGGRIFTANAIDREEQ------AFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDE-PVNSRFFSV-RATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRY----------ELDRETREEYSLTVSAMDTGV-EPLSSSVTVNVTVLDVNDNKPLFNSSSY----VFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQV------NFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKF-----TVDAS---------TGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFV----TPTAILVD-----GLRAAAGSVVGTLQASDPDEAENAAVRYAV 1331          

HSP 3 Score: 187.578 bits (475), Expect = 2.053e-48
Identity = 160/555 (28.83%), Postives = 260/555 (46.85%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSI---PIAIDQDIELNAKILYRLTNHKDK----FTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGS-PPR--SNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHT--FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPS--LVSYSMNPSVAEHMPKGTVVQTLSVI--DPDTGPGGEVSVALLPWENKFVFR-----NLNLLTNLEFDREINDKYSILVILRD 2105
            + V V D NDN P F    ++  + E+ AP     +++    +A D D     ++ Y L   +D            +   L +   + LDRE +  Y++   A D G    L+ +  L VN++D ND+ P    +SL   +  + E A  G ++  I A D+D G N++L+FS++     S   E  F   + G + V   LDRE     +L V VSD    PP   S+++ +++I+ D NDNAP    P + +  E+    + V  ++A D DSG +S     L     T+  +              + V T E+     LDRE   +Y+L +L  D G P L+++  +++ V D NDN P F R  +E  + E++   + VL+L A D D G N +L Y I +  D T  F ++   G L    P+D ER     + +  +D G P+ + TA V VT+ D+ND  P+  L  Y+++   A    +G  V  L V+  D D G  G+V+ A     +   F      +++LL +L  DRE   ++ +++   D
Sbjct: 1603 LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVT--RPLDRESRACYVLRARATDGG---GLAATARLYVNVLDANDNAPSVQNDSL---AAEVPEDAPPGTSLLRISATDDDEGVNAELEFSIS-----SGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALA----TDGEEGGGGAGAGPGPFALNTV-TGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASG-DPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVH---ARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSL--DREAQPQHVLIITATD 2133          

HSP 4 Score: 167.162 bits (422), Expect = 4.020e-42
Identity = 172/698 (24.64%), Postives = 288/698 (41.26%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPN-FTIMIKEEQAPSDWNYQSIPIAIDQDIELNA--KILYRLTNHKDKFTI---KYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP---FIECP---ENFIIEENRGELSTVGFIKAFDMDS-GASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSP--RLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD-HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL---LPWENKFVFRNLNLLTN-----LEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            +RV+V D+NDN P F  P    +  KE+ A        +  A+D+D+  N      Y++ +  ++  +   + +     L +A    LDRE    Y + ++A D G P    G L + V + D ND+ P F K +       ++E + +G  +  +            L    + K               TG +     LD E      L +  +D G+PP S      + + D NDN P   F+  P    +  ++E+    +    +   D DS  A+   S  ++       F L    +     +K            S LDRE I  Y+L IL  DNG P  R + + L+ + V+D ND+ P F  S +   + E     S V  + A D D G+NA L Y I++  D   F +++++G +     +D E    + + I  +DQG+   T    + VT+ D+ND PP         +  E+   G  V ++S  D D G  G V       +P + + +FR L+ LT         DRE  ++Y ++V  +D G P L ++  +T+ + D+NDN P    +             S    EP G ++ T+   D D   N  + Y +   +   F ++  +G +    +    +   ++L +   D G  R  S   + I V D   + P +A
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVL--LDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRY-GRLQVNVTVQDANDNPPAFEKPAYR---ASVAEDSPVGAALRDLLHR-----GRGPLAVPFDPK---------------TGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLK----------VASQLDRERIPMYNLTILASDNGKPVARSATASLV-VYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFR-LDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPV---------QYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFA 659          

HSP 5 Score: 162.54 bits (410), Expect = 1.303e-40
Identity = 169/692 (24.42%), Postives = 295/692 (42.63%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRL-----TNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFIS--EQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL-LPWENKFVFRNLNLLTNLE-FDREI------NDKYSILVILRDNGQPR-LTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHES-EKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            Q      ++ V + D+ND PP+F    +     E   P  +       A D D+  N  + Y         +++ F +  +      K+  L++LDRE+ ++Y ++++A D G P  L  +  +TV + D+ND+ P F       +  F S  E    G  + T+ A D D G N  +++ L      +     F +N  TGA+     LDRE      L V   D G     +   +T+ + D  D  P F     +F++ EN    + VG + A  +D  A  N +  +++     SF +               +F     T + +DRE  + Y L ++ +  G   ++    +S+LV D N++ P F R+++E+ + E++   S    ++A+D D G N ++ Y I   N    F I    G LY    +D E  ++ ++T+   D G    +++  V+VT+ D+ND  P   S S      E    G++V  +   D D G  G V+ +   P  N  +      + +L  FDRE          +S  V+  D G+P+ L +   + + + D+NDN P+    +    V  S   ++          +  +   D D   N  L Y I+E  E   F +   +G + L  +    +  S+ LV+   D+GT  L +   + + V+D
Sbjct:  424 QPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSV--SAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLT----GKVTTLKSLDREELEEYPLVVQAQDRGSP-PLGSTAKVTVVVGDLNDNHPVFYP-----VQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLT-----AGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNA--NVTYLIVSGDQRGSFSIE---------WSGGRIF-----TANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFP-DGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLT---------QLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLD 1069          

HSP 6 Score: 157.147 bits (396), Expect = 5.968e-39
Identity = 170/684 (24.85%), Postives = 287/684 (41.96%), Query Frame = 3
Query:  522 DINDNPPIFQ---LPNFTIMIKEEQAPSDWNYQSIPIAIDQDI-----ELNAKILYRLTNHKDKFTIKYIQIAN--ELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTN---SFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGP--------GGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHE---SEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            D+NDN P  +   LP        +++ +     ++    D D      EL+  I+    N +  F +    +     LK+A    LDRE+   Y + I A D GKP + S + +L V + D+ND  PRF+  +        SE A  G  +  + A D D G N+KL++S+         +  F +++STG +    ++DRE+  SV L +   D G+ P++   +LTV + D ND  P F +        EN      V  + A D D G +     +     P      F+L ++T + TT   KS            LDRE +  Y LV+   D GSP L ++  ++++V D NDN P F+   +   ++EN+   ++V  + A+D D G N  + Y +       F +N  +G +     +D E      + +   D G     + A V +T+ D  D PP+      +  V E++  GT+V ++S    D           G +     + W    +F      T    DRE    Y + V+    G   +     +++ + D+N++ P             ++  +S +  EP+     ++   D D  +N ++ Y I E    EK  F + PD G L +           + L +   D G   L S + + + V+D
Sbjct:  217 DVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVG--GNERGHFVLHAPGVPGLRVLKVA--SQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAAL---SEGAPAGSYVKDVTAMDADSGLNAKLRYSI----VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTL--KS------------LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIF------TANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDR---------ASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK--FGIFPD-GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLD 854          

HSP 7 Score: 144.05 bits (362), Expect = 5.246e-35
Identity = 168/683 (24.60%), Postives = 290/683 (42.46%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLT-NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNN-SKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLY-FIITNVDHTFMINQTSGDLYQIEPIDFER------HKQITITIGCKDQGSPS-FTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR------NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI-HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            + V+V D+NDN P+F    +   I E +        +   A D D   N  + Y+LT     +F +  +  A   ++    +LDRE++  Y + + A+D G   + S ++ +T+ + D  D+ P F+++  + + VF  E    G  + ++ A   D+  N + L  S +++ +       F I  S G I   N +DRE      L V+ +  G    +   +++V+++D N++AP F        I E+    S    ++A D DSG +     +   I   N  +   +  +   Y++      +EL      DRE    YSL +   D G   LS+S  +++ V D NDN P F+ S++     E +   S V  ++A+D D G N  + Y F    V+  F ++  +G +  +   D E           + ++   D G P      A V V ++D+ND PP         SV+E     T +  ++  D D G  G +  A+        F        + LL +L  DRE    Y+++V   D+G   L  S  + + + D NDN PR T  + S     S +         +G  + T+   D+D   +  + Y I   +    F +   +G++ L           +RL +  +D G P   S   L++HV D
Sbjct:  540 VTVVVGDLNDNHPVFYPVQYFASILENE--PGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRV----SLDREERAVYQLQVTALDGGHLRARSPAI-VTITVADAQDTPPTFARDDYSFV-VF--ENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGS-------FSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYE---IGEGNGGEKFGIFPDGQLYVR------YEL------DRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN--FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSL--DREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTR---------VGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRD 1174          

HSP 8 Score: 141.354 bits (355), Expect = 4.506e-34
Identity = 147/543 (27.07%), Postives = 229/543 (42.17%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREK------KDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENF-IIEENR-GELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNV--DHTFMINQTSGDLYQIEPIDFERHKQI-TITIGCKDQGSPSFTTTAY---VHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNL-----EFDRE 2066
            VT+ V V D+NDN P+F   ++     EEQ     +      A D D   N  + Y     +  F +     +   +IA L+  DRE          +   + A D G+P  L     + V + D+ND+ P+F+K   ++    +SE A     +  + A D D G N  L++++NE          F ++ STG I +   LDRE   S  L V  +D G+ P + S  + V + DENDN P F E   +   +E  R GEL     + A D D+G S +    ++      +F +   T   + ++ +             LD E    Y L +   D G P  S++ ++ + V D NDN P F   +    ++EN    + V+ + A D D  +N +L Y I         F I+  SG++     ID E    +  +T+   D+  P  T  +    V V + D ND  P  V+ +           G+VV TL   DPD      V  A+   +   +FR L+  T +     E DRE
Sbjct:  846 VTVNVTVLDVNDNKPLFNSSSYVFHFCEEQ--EVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELD----SETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAK---SVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGG----KFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLIT--LTASDEDTGPSGDVRYAIVAGNTHATFAIDRST--GSVFLARR------------LDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFR-LDRRTGIIETSTELDRE 1358          

HSP 9 Score: 135.191 bits (339), Expect = 3.396e-32
Identity = 170/684 (24.85%), Postives = 272/684 (39.77%), Query Frame = 3
Query:  498 VTIRVI-VNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNH---KDKFTIKYIQIANELKIAPLQTLDREKKDK-YLIIIEAIDCGKP--DSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSP--PRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTY------IKKSIVFTFELSTTSILDRENISTYSLVILCHDNGS-----PRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAE-HMPKG----TVVQTLSVIDPDTGPGGEVSVALLPWEN------KFVFRNLNLLTNL--EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQD 2444
             TI V+ V D NDNPP F LP        E  P      ++  A D D ++N ++ Y +         FTI         +I     +DRE     + + + A D   P     S   N+TV + D ND+ PRF   +  L+      +A  G  + T+ A D D   N+ +++++    T   A   F +++ TG I    ELDRE         +V+       PR+     T+I N    N P    P+++         S +  ++   +   +S       ++ +P        + L  T        +      +F+L+   +     I   SL+    DNG+     P +S+   + I V D NDN P F     E++V EN      +  L A+D D G NA + Y +++  +  F+++  SG L     +D E      +T+   D    +  T A + V ++D ND  P    ++ +  VAE   P G     V+ T+   D D+GP GEV+ AL P E+       F    +    N+    DRE    Y +     D G   L  +  L + + D NDN P            + N +++    E  P G S+  I   DDD   NA+L + I   +        + G L +           + LV++V D
Sbjct: 1165 ATILVVHVRDFNDNPPAF-LPGDVFASIMENIPIGTRVITV-TARDPDADVNGELHYSIARQFPPGAHFTID----PESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGL---RAAAGSVVGTLQASDPDEAENAAVRYAV----TGGDAAILFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQDY--------ESPINLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMF----IVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAP-----------SVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSD 1807          

HSP 10 Score: 90.1225 bits (222), Expect = 2.035e-18
Identity = 76/288 (26.39%), Postives = 126/288 (43.75%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI---AIDQDIELNAKILYRLTNHKDKFTIKYIQ---------IANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEEN-RGELSTVGFIKAFDMDSGASSNCS 1319
            V + +I+ D+NDN P F  P   +      AP D    ++     A+D D   N+ + Y L    ++                +  E+++  ++ LDRE +  Y + + A+D G+P  L+ +  L V + D ND+ PRF +         I+E    G  +  + A D D G N +L++     +        F ++   G + V   LDRE   S  L V   D G P RS++ ++ V ++D ND +P F   P      EN +G    +  + A D D G+S   +
Sbjct: 1820 VRVSLILTDVNDNAPAFTSPRSAL------APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRL--VRELDREARQSYALTVLAVDKGRP-PLTSTATLAVTVGDANDNAPRFPRREYE---AAIAEDEPPGTEVLRLSAWDPDEGANGELRY----DIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVT 2091          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 230.72 bits (587), Expect = 7.516e-62
Identity = 204/686 (29.74%), Postives = 323/686 (47.08%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQT-LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSL---NEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVI---INDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNL-----EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            + + + DINDN PIFQ P +   + E  +P     Q    A D D   N  + Y L+++ D F+I          +  L+T LD EKK +Y++ + A D G P S S    + V + D+ND+ P+F+K   +L +  + E    G  +  + A D D G N K+ +S+   NE +  ++AM+ F     TG I     LDRE   S  L  I +D GS  R   MA T +   I DENDN P    P  F I E+    + VG + A D D G +   +  +I+    NSF+L            +S +    LS  S LDRE I +Y+LV+   D GSP+ S +  I + V D NDN P F +S F  ++ E+    S+VL++K  D D G N  +   +       F I+ T G +    P+D+E      +T+  +D GSPS + TA V +TI ++ND  PS VS +   S+ E +   T V  L+  D D  P   ++  ++       F+ ++  + L       DRE    Y+++V   + G    +     TI + D+NDN P     + +PG    +   S     PIG ++A +   D D  +NA++TY +   +   F ++P +G +         D  S+ L +   D+G P   ++  + + + D   ++P ++
Sbjct:  569 VTIALQDINDNSPIFQGP-YVFRVSESSSPGHQIGQVA--ATDADDSSNGDVRYALSDNTDVFSIN-----TSTGLITLKTQLDYEKKTQYMVTVTAKDGGTP-SRSSLTVVKVMVDDVNDNPPQFAK---SLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENM--AFAMDRF-----TGEITTRVPLDRETIASYSL-TINADDGSLVRF--MAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLD----------PRSGI----LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDST-GFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP---LTFDIVEGNAGSSFK-IDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAP-----VFNPG----SYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFS 1204          

HSP 2 Score: 212.616 bits (540), Expect = 4.149e-56
Identity = 187/687 (27.22%), Postives = 315/687 (45.85%), Query Frame = 3
Query:  465 SLLEFQEGMIIVTIRVIVNDINDNPPIFQLPN-FTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKP-DSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLE----FDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            SL+ F   M   T+ + + D NDN P F  P+ F I    E +P+      +  A D+DI  N  + Y + +     + +    +  L +    TLDRE    Y ++++A D G P  S++ S++  V+++D+ND+ PRF K   +L S  I E A +  T+  +   D D G+N  +  SL+ + +D++ ++      STG +     LD E   +  L V   D GSP +S +  + + I + NDN P F+   +   I E+    + V  + A D D    +  + D++     +SFK+     +S+  I          S    LDRE  + Y+LV+   + GS   S     +I V D NDN P F+  ++   + EN     +V K+ A+D D G NA + Y +       F +N  +G +    P+D E     ++ +   D G PS +  A + +TI D+ND  P         +V E+   G+ +  +   DPD G  G V+ +++   +   FR  +    +      DRE    Y++ +  +D+G P   ++  + IT++D NDN P          +  SN+T S+   E   IG  +A +   D D   NAQ+ Y I   +   F ++  +G L +    +   + ++ L I+  D G+P + S  EL + V D
Sbjct:  766 SLVRF---MAATTVNISIADENDNQPTFTGPSRFNI---SEDSPTGTRVGQL-TATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSV--RSTLDRETIPSYTLVVKASDAGSPQQSITASIH--VSVLDVNDNAPRFEK---SLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTID------STGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKID----QSSGLI----------SVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP----------IFASNET-SYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVND 1404          

HSP 3 Score: 203.371 bits (516), Expect = 3.439e-53
Identity = 193/677 (28.51%), Postives = 313/677 (46.23%), Query Frame = 3
Query:  495 IVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSI--PIAIDQDIELNAKILYRL--TNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI--IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLE-FDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE-KPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            +  I + +ND+NDN P F    +T+ + E  A    N  +I   +A D D   N ++ Y +   NH + F I     +   +I  +  +DRE    Y + I A D G P  +S +  + + + D ND+ P F+    N  S  I E   IG  +A + A D D G+N+++ +S+    T ++A     IN   G + V  E++RE   +  L +  SD GSP  ++   LTV++ND NDN P     +++I  + EN  + ++V  + A D D GA++     +I+      FK++     ST+ +         + TT+ LD E  S Y L +   D+     +N   ++I V + ND  P F + N+   V EN    +SV+K+ ASD D      L Y I+   D   F I+Q SG +   + +D E      I +   D G+P  +   +V + I D ND  P   S S + S+ E+    +    L+  D D G    ++  L   +   +  +  ++T  +  DRE    Y + +  RD+G P   +SI + +T+ DIND+RP    LI S  ++ S         +P    +  I   D D   NA+LT+ +  +E K  F L   +G++             + L I V D G P L S+ ++II V+D
Sbjct: 1186 VAAITLTINDLNDNSPQFSQSKYTLTVTENTA----NGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRID----STTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAF-VAITVADENDNSPIFAS---NETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFA-----INAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNS-QSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKIN-----STSGV---------IMTTTPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP----LINSSSLRGS-----VRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVID 1816          

HSP 4 Score: 202.986 bits (515), Expect = 4.754e-53
Identity = 189/649 (29.12%), Postives = 295/649 (45.45%), Query Frame = 3
Query:  492 IIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAI---DQDIELNAKILYRLTNH-KDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI--IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWE-NKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLT--HLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSV 2402
            I  +I V V D+NDN P F+   F+  I+E     D +  S  + +   D+D   N  I   L+    D FTI        L   P   LD E    Y + + A D G P S S +  + + II++ND+ P F   +       I E   I   +  + A D+D    + L F + E      A   F I++S+G I V   LDRE   +  L V  ++ GS   S     T+ + D NDNAP    P ++   + EN     TV  + A D D G ++  + +L ++  T+ F+++                T  ++T   LDRE+ ++YSL +   D+G P  S    I++ ++D NDN P F +S + + V EN  N S++L++ ASD D G N  + Y II+ N  + F I+ T+G +  +  +D E      +TI  KD G P + +TA+V +T+ D ND  P   S   +  + E +  G+ V  ++  D D G   +V  +++  + + F    +N  L    E +RE    Y++ +   D G P +T+   LT+ ++D+NDN P       IGS     +  T           S+ T+   D D+  NA L Y I        I   D    K+NST  V
Sbjct:  876 ITASIHVSVLDVNDNAPRFEKSLFSGEIRE-----DASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFV--LSKTP---LDYETTAAYQLTVTARDGGSP-SKSATAQVKITIINVNDNVPSFVSPAQ---VTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVE----GNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFN-PGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL-SVGDTSKFEVNPA--------------TGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQST-----------SVLTVAADDSDVGANAVLRYSI--------ISGNDEKRFKINSTSGV 1468          

HSP 5 Score: 202.216 bits (513), Expect = 8.395e-53
Identity = 185/681 (27.17%), Postives = 301/681 (44.20%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI--IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            + G   V I ++  D+NDN P+F    +T  + E+ A        + + A D+D   NA + Y  T+           +   + ++  ++LD E++  Y + +   D G P  L+ + +L +N+ DIND+ P FS  +       + E    G  ++   A D D   N  L F + +   D      F I+ STG I +    D E      L V   D G P + ++  +T+ I D ND++P    P N+   I E+    STV  + A D+DSG        LI+     +F +                 +  +  +S LDRE   +YSL +   D GS   S+S  ++I + D NDN P F    +  +V E+      + ++ A+D D   N D+ Y +  N D  F IN ++G +     +D+E+  Q  +T+  KD G+PS ++   V V + D+ND PP         +V E++  G  V  ++  D D+G  G++S ++L       F        + T +  DRE    YS+ +   D    R   +  + I+I+D NDN+P  T   G     IS  +       P G  +  +   D DI  N  +TY  I  ++   F L P SG L + ST     + S+ LV+K  D G+P+      + + V+D
Sbjct:  251 RSGQATVEIEIL--DVNDNRPVFSSAQYTASVDEDVA---IGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVS--RSLDFEQRSSYALGLSVTDRGSP-PLTDTSHLLINVNDINDNPPVFSPSAYQ---SRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGV----FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF-SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNID--------------ANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQ-GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD-VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFT---GPSRFNISEDS-------PTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLD 886          

HSP 6 Score: 199.134 bits (505), Expect = 6.837e-52
Identity = 187/685 (27.30%), Postives = 311/685 (45.40%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPW--ENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI---HESEKPYFILHPDSGNLKLNSTCSVSD---LGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            +++ + ++NDN P F  P     I E+ A    N   + + A D D      + + +       + K  Q +  + +A  + LDRE    Y +++ A + G     S   N T+ ++D+ND+ P F+  S    +  + E   IGQT+A + A D D G N+K+ + L+   T       F +N +TG +     LDRE   S  L V   D G P +S   A+T+ IND NDN+P F +      + EN    S +  + A D D+GA+   +  +I+    N+F++ + T                ++   ++DRE +++Y+L I   D+G P   ++  ++I V+D+NDN P F  +     + E     S V  + A+D D G NA + Y I+      F IN  +G L   + I+ E     T+TI   D+GSP  T+   + V + D+ND PP   S S   SV E+  + T V T++  D D G    +  +++    E +F   + +  ++T    D E   +Y + V   D+     TN   +TI + ++ND  P  T           N T S     P   S+  +   D D      L+Y I    +S+K  F +   SG   + ST  V D   +  + + ++V D G P L +L  + I ++D   ++P +
Sbjct:  983 VKITIINVNDNVPSFVSPAQVTSIPEDVA---INTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVA--KRLDRETTANYTLVVRATETGS-QGESVYNNATIRVLDVNDNAPVFNPGSY---AKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDT-----SKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTT--------------GRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQ---------QNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDK--FSIDQRSG---IISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKF 1617          

HSP 7 Score: 194.512 bits (493), Expect = 2.317e-50
Identity = 183/674 (27.15%), Postives = 302/674 (44.81%), Query Frame = 3
Query:  516 VNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDK--FTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSI-----LDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNST-CSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            VNDINDNPP+F    +   +KE   P+         A D+D   N  +++ +    D   FTI      +   I+  ++ D E K +Y + ++A D G P     +  +T+ I D+ND  P FS  +    S  I E   IG T+ T+ A D D G   +L++    +L        F I+ ++G+I V +ELDRE   S  L V   D GS  RS+S  +T+ + D NDN+P  + P  F + E+      +G + A D D   SSN             + LS+ T           VF+   ST  I     LD E  + Y + +   D G+P  S+  ++ ++V D NDN P F +S +   V EN     +V  + A+D D G N  + Y I++ N +  F +++ +G++    P+D E     ++TI   D     F     V+++I D ND  P+    S   +++E  P GT V  L+  D D GP G V+ A++       F    R+  L      DRE    Y+++V   D G P+ + +  + +++ D+NDN PR    + S  ++             +  ++  +   D D   N  +T  +       F +  DS    L+ T        +++L +  +D G+P   +  ++ I +++
Sbjct:  366 VNDINDNPPVFSPSAYQSRVKE-NTPAGTQVS----ATDRDSSTNGALVFGIIKGNDDGVFTID----GSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYD-TAQVTIFIEDVNDHSPVFSPSNY---SKQIPESTVIGSTVVTVTATDLDSGPRGRLEY----RLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADD--SSNGDV---------RYALSDNT----------DVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRF-NISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIR---------EDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTI--DSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIIN 989          

HSP 8 Score: 194.126 bits (492), Expect = 2.421e-50
Identity = 199/750 (26.53%), Postives = 325/750 (43.33%), Query Frame = 3
Query:  294 MIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            M   DS+        +K DRE   R++ T+                       L   +     +G  +V I V   D NDN P F L ++   I+E    +     +I  A D+D   NA I Y L + ++KF +     +   +I  +  LD E KD Y + I A D GK  +    + L + + D+ND+ P F   +L++    + E   +G  +  + A D D+G N++L +SL    T       +F   S G I      DRE   S  + +   D GSP RS    + + I D NDN P F        ++E+    + +  + A D D+G +++      +    ++F L  VT           V T   S    LD E  S+Y+L +   D GSP L+++  + I V+D NDN P F  S ++ +V E   N  +  ++ A+D D   N  L++ II  N D  F I+ ++G +   +  D+E   +  +T+  +D+G P    TA V + I+D+ND  P     + +  + E    G+ V T++  D D+GP G +   L+    K  F     + ++  + E DRE    YS+ V  RD G    ++S  +TI + DINDN P    +   P V         S     G  I  +   D D + N  + Y + ++    F ++  +G + L +         + + +  +D GTP   SL  + + V D   + P +A
Sbjct:   11 MFTIDSSTGSITTTGRKFDRESESRYRLTV-----------------------LAQDAANRCHKGRTVVVIDV--KDENDNAPEFPLNSYVFNIRENTPAAQV---AIVTATDRDSGTNAAITYSLFSGENKFMMN----SKTGEIRTVTPLDHETKDSYTMRISAFD-GKHTTF---VPL-ITVDDVNDNAPFF---ALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDT------SYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTG----------VVTVSRS----LDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKE---NTPAGTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP----IFQGPYV------FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD-VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFA 686          

HSP 9 Score: 194.126 bits (492), Expect = 2.463e-50
Identity = 181/690 (26.23%), Postives = 302/690 (43.77%), Query Frame = 3
Query:  510 VIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNP---SVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNL-----EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI-HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRI 2546
            + V+D+NDN P F L  +   + E+ A      Q    A+D D+ +NA++ Y L +        Y  + ++  I      DRE K  Y + + A D G P S SG   + + I+D+ND++P FS       +  + E   IG  + T+ A D D GNN+ L++S     T+      F ++  TG + V   LD E   S  L + V+D GSPP +++  L + +ND NDN P F        ++EN    + V    A D DS  +      +I       F     T++ +T I         +S     D EN + Y L +   D G P   ++  ++I + D ND+ P F  SN+  Q+ E+ V  S+V+ + A+D D G    L Y +I+ NV   F I+  SG +     +D E     ++ +  +D GS S +++  V + ++D+ND  P        P    V+E    G  +  ++  D D    G+V  AL   +N  VF ++N  T L     + D E   +Y + V  +D G P  ++  ++ + + D+NDN P+    +          T +       G ++  +   D D   N +++Y I   +E   F +   +G +          + S+ L I   D    R  +   + I + D   + P +   + F I
Sbjct:  156 ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQ--LTAVDLDVGINARLSYSLVSGD----TSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSP-SRSGQATVEIEILDVNDNRPVFSSAQY---TASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTN----HAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGVF-----TIDGSTGI---------ISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF----QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYAL--SDNTDVF-SINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSL---------YTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNI 798          

HSP 10 Score: 192.586 bits (488), Expect = 8.554e-50
Identity = 189/689 (27.43%), Postives = 305/689 (44.27%), Query Frame = 3
Query:  495 IVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI----AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIK--DMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWE-NKFVFRNLNLL--TNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            +  ++V+V+D+NDNPP F    +T  + E  A        + +    A D D   N KI Y + +  +       +   E  I     LDRE    Y + I A D G       +  + ++I D ND+QP F+  S       ISE +  G  +  + A D DIG N  + ++    +        F ++  +G + V + LDRE   S  L V  SD GSP +S + ++ V + D NDNAP F +   +  I E+    STV  +K  D D G++   +  L      +     N T++ST ++         LS T  LD E  + Y L +   D GSP  S +  + I + + NDN+P F        + E+    + V+KL A+D+D      L + I+  N   +F I+Q+SG +   + +D E     T+ +   + GS     + Y + TI+  D+ND  P     S   S+ E++P G  V  ++  D D G   +V+  L   + +KF       L  T    DRE    YS+ V   D+G+P  +    +T+TI+D+NDN P+ +          S  T++ +     G +I  +   D D   N ++TY  I  +    F +   +G + +        L S+ L I  +D+G P   S   + I V D   ++P +A
Sbjct:  668 LTVVKVMVDDVNDNPPQFAKSLYTCTVGENLA------AGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGE--ITTRVPLDRETIASYSLTINA-DDGSLVRFMAATTVNISIADENDNQPTFTGPS----RFNISEDSPTGTRVGQLTATDRDIGPNGAVTYA----IISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSL------SGEGSDNFTIDSTGFV---------LSKTP-LDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQG--ESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQ---------SKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFA 1309          

HSP 11 Score: 184.111 bits (466), Expect = 4.179e-47
Identity = 174/607 (28.67%), Postives = 286/607 (47.12%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLT-NHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSL----NEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDD 2294
            + + V D NDN PIF     +  I E    S  +  ++  A D+D   NA++ Y +       F I  +     +K    + ++RE    Y + I A D G P  ++    LTV + D+ND+ P F+ +S  + SV   E +    ++ T+ A D+D+G N+ L++S+    +EK         F IN ++G I     LD E      L V  +D     ++N   +T+ + + ND  P F +      + EN    ++V  + A D DS  S   S  ++  K ++ F +           ++S +    +ST  +LDRE +S Y++ +   D G+P LSN   ++I + D+NDN P F  S++   ++EN    S   KL A+D D G NA + Y +  N    FMI  +SG +   +P+D E      + I  +D G+P   ++  + VT+ D+ND  P + S S+  SV E+ PK T V  +   D DTG   E++ +LL  E+K VF       ++ T +  DRE    Y++ + + D G P L++   + I + D +DN PR          + +   ++ S   P G SI  +   D D
Sbjct: 1294 VAITVADENDNSPIFASNETSYGIDE--GVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVK----KEINRETVPTYTLTIRASDRGSP-MMTSDKELTVVVNDVNDNPPVFNSQSY-IGSV--RENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEK--------RFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGS--LSYSIVGGKDSDKFSID----------QRSGI----ISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN--DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF---------QPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 224.172 bits (570), Expect = 7.906e-60
Identity = 195/677 (28.80%), Postives = 310/677 (45.79%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRL--TNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVF-ISEQAKIGQTIATIFAHDNDIGNNSKLQFSL--NEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHT-FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEV--SVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEP-IGFSIATIYFHDD-DINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            + + V D+NDN P+F    FT+ I E     D        A D D   NAK+ Y     +H +KF I     A+  +I    T DRE KD Y I + A D G P S S +  + V + D ND+ P+F      L  VF I+E A +G +I T+ A D DIG N++L +S+   EK T       F +N  TG I V   LDRE   +  + V  +D G+PP S SM +TVI++D ND+ P F+       I+EN    + +  ++A D DSG ++      +     NSF ++++              T  L T   LDRE    ++L +L +D G PR  +   +++++ D NDN P F  S +  +V E  V  S+++ + A D DIG +  + Y I    +   F+IN+ +G +     +D E   + T+ +   D GSP+ ++ A V V + D ND  P     ++   V E    GT V  +S +D D G   +V  S  ++       F+  + L N          Y++ V  R+   P       + I + D ND+ P          V I +  + F+ Q+   G SI  +   D  D   NA + Y  I  +    F + P++G + + S+       ++ + ++  D G P++     + + V +
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENV--DDGTTVITVTATDPDAGDNAKVSYATYGGSHGNKFAID----ASSGRIYTTGTFDRETKDDYSINVTASDHGNP-SKSSTCVVLVTVADNNDNSPKFPA----LHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPEKAT-------FSMNPVTGEITVGQRLDRE-GANYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNSFTINSI--------------TGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVE-SNIVTVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYSTGMITLNRAIAFKPFSALPNPNI-------YNLTVRARNIYPPHYKADAAIQIEVLDTNDHAP----------VFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTE 626          

HSP 2 Score: 165.622 bits (418), Expect = 2.066e-41
Identity = 184/727 (25.31%), Postives = 318/727 (43.74%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI--AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL-STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQI-TITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDP-DTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHN 2654
            + V V D NDN P F   ++   I E+ A       SI    A D DI  NA++ Y + +  +K T     +  E+ +   Q LDRE  + Y I + A D G P  LS S+ +TV + D ND +P F     ++ +VFI E A  G  I T+ A D D G N++++++         +   F IN  TG +     LDRE      L V+  D G P + +   +TV++ D NDN P     E +  E + G + S +  + A D D G+  + +  +   +    F ++    E+T  I            T+ LDRE  S Y+L +   D GSP LS+   + + V DQND+ P F  +   ++V E+  + ++V+K+ A D D+G NAD+ Y        T MI  T       +P     +  I  +T+  ++   P +   A + + + D ND  P  +         +    G  +  +  +D  D GP   V    +       FR       +L       ++N  Y I V   D GQP+++++  + + +++ N + P  +  +        N+ I+      +G ++ T+   D D  +N +++Y  I  + + YF +   +G+L ++         ++ L +   D G     S   + I + D   +NP ++ I  +R  L    T      SV++  V  T + ++  + + ++
Sbjct:  106 VLVTVADNNDNSPKFPALHYVFDIAEDAAVG----ASIGTVSASDADIGENARLTYSIVS-PEKATFSMNPVTGEITVG--QRLDREGAN-YSIRVTATDLGTP-PLSASMEITVIVDDYNDHRPVFLS---HIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAF----VTGNSNNSFTINSITGRLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSE-YAAEVSEGVVESNIVTVVAEDRDIGSDGSVTYCITQGREGGLFVIN----ENTGTI----------GITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTY-------STGMI--TLNRAIAFKPFSALPNPNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQ---TSENEDIA------VGSALLTVTATDRDFGRNGEISYDIIAGNSQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPI-EYRCELAENTT----PRSVVVCSVRATDRDERGQQSVRYS 778          

HSP 3 Score: 164.466 bits (415), Expect = 4.256e-41
Identity = 171/702 (24.36%), Postives = 319/702 (45.44%), Query Frame = 3
Query:  459 SLSLLEFQEGM----IIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNE-KLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNS-MALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFD-MDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEH-MPKGTVVQTLSVIDPDTGPGGEVSVALL--PWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNG-QPRLTNS--ILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESE-KPYFILHPDSGNLKLNSTCSVSDLG--SFRLVIK--VQDNGTPRLFSLLELIIHVVD 2498
            +L +L +  G+     +  + V++ D+NDN P+F +  +   + E    S  N  ++ +A D+DI  +  + Y +T  ++     ++   N   I     LDRE K KY + ++A D G P +LS   ++ VN++D ND  P F+  +L   +V + E    G T+  + A D D+G+N+ + +S     L  + A + F    +   I+      R IY              PP   +  A+ + + D ND+AP FI+        ++ G   ++G ++A D  D G ++    + I+   T  F+++  T E              L  +S+ D  N  TY + +   D G P++S++  + + V+++N + P F ++ ++    E+    S++L + A+D D G N ++ Y II  N    F I  T+G LY  +P+D+E  +  ++ +   D G    T+ A V +T++D+ND  P          +AE+  P+  VV ++   D D      V  ++L    ++KFV   R   +   +EFD E+     +++  +D G  P+ T      + I I+ +N+  P     +          T + +   PIG S+  +   D D   +  + Y +  S+ +  F L  ++G L ++        G  + R++ K   Q++ TP   +   +++ V D
Sbjct:  295 TLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVES--NIVTV-VAEDRDIGSDGSVTYCITQGREGGL--FVINENTGTIGITAKLDRETKSKYTLRVQATDGGSP-ALSSEADVIVNVLDQNDHAPVFTPATL---TVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYSTGMITLNRAIAFKPFSALPNPN-IYNLTVRARNIY--------------PPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEV-------------LIASSLRDDVN-KTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNSQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKFVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSV---------FTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTD 949          

HSP 4 Score: 157.918 bits (398), Expect = 4.630e-39
Identity = 181/684 (26.46%), Postives = 301/684 (44.01%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQ-DIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIE--ENRGELSTV-GFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNG-SPRLSNSKLIS--ILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKD--QGS--PSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGG-EVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQN-AQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLEL-IIHVVD 2498
              I++ V D ND+ P+F + +  ++   + A S  +   +  A+D+ D   NA + Y   +       +      E+ IA   +L  +    Y I + A D G+P  +S +  + V + + N   P FSK    +     +E   +G  + T+ A D D G N ++ +     +    + E+F I  + G+++V   LD E  E+  L V  +D G  P+++   + + + D NDN P    P  +  E  EN    S V   ++A D D     +    ++     + F    V  E T  I+ ++ F FE++ +S L          +I   D G SP+ +     S  IL++  N+ +P F +S F   V EN     SVL++ A+D D G +  +LY ++ ++    F ++  +G L     +D ER   +T+ +  K+  Q S  PS    A + VT+ D ND PP  +    +  V E    G VV  ++ +D D+        ++     N FV   +   + T  E DRE   +Y + V   DNG P +T +  L +T+ DINDN P LT L   P +         +  +P G  + T+   D D+N N     Y I  S+   F L+  SG +    +       ++ + IKV D    R  S +   +IHV D
Sbjct:  512 AAIQIEVLDTNDHAPVF-IKSVYLLFAVQDAGSGVSIGRVE-AVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIA--SSLRDDVNKTYYIRVRASDMGQP-KMSDTAGVYVEVTERNLHPPVFSKA---VYQTSENEDIAVGSALLTVTATDRDFGRNGEISY----DIIAGNSQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFS-PIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKF----VIDERTGEIRATVEFDFEVTMSSFL----------MIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIRSIRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPL---PCIG------RVTENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDYGSFRLNVSSGVVSTVKSLDREKQDAYNISIKVTD---ARGLSAVNFCMIHVED 1155          

HSP 5 Score: 110.538 bits (275), Expect = 2.179e-24
Identity = 143/600 (23.83%), Postives = 240/600 (40.00%), Query Frame = 3
Query:  435 NKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRL--TNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGK-PDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNS---MALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILC----HDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNL-----EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLT 2186
            NK  ++ +  S +   +      + V V + N +PP+F    +     E+ A           A D+D   N +I Y +   N ++ F I        L ++  + LD E ++ Y + + A D GK P +   ++ +T+   D+ND+ P FS   +                + ++ A D D     + Q S+   +      + F I++ TG I    E D E+  S  L +   D G  P+  +    ++ ++I   N+  P F++      + EN     +V  + A D D G        L+       F L +               T  LS +  LD E     +L ++      ++ +P       I + V+D ND  P F +S +   V E       V  + A D+D  I +        N  + F+++  +G +     +D E   +  +T+   D G+P  T  A + VT+ D+ND PP L        V E+ P+GT V TL+  DPD  P        +   +   FR LN+ + +       DRE  D Y+I + + D       N     I + D NDNRP+ T
Sbjct:  597 NKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVT--ATDRDFGRNGEISYDIIAGNSQEYFGIGLTN--GSLYVS--KPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLR--DVNDNNPVFSP--IEYRCELAENTTPRSVVVCSVRATDRD----ERGQQSVRYSILGGSGKDKFVIDERTGEIRATVEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDS--------------NTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIRSIRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVTENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDYGSFR-LNVSSGVVSTVKSLDREKQDAYNISIKVTDARGLSAVN--FCMIHVEDQNDNRPKAT 1164          

HSP 6 Score: 105.916 bits (263), Expect = 4.838e-23
Identity = 133/535 (24.86%), Postives = 230/535 (42.99%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRL--TNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNII--DINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIV----SDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALL--PWENKFVFRNLNL-LTNLEFDRE 2066
             T+R+ + D+NDN P+F    +   + E   P      S+  A D+D      + Y +   + KDKF I   +   E++ A ++  D E      ++I A D G     +     +V+I+   +N+  P F +   ++ +  ++E A IG ++  + A D D G +  + +     L  S   + F ++ +TG + V  +LD E    V L VI      +  +P       + V + D ND   F++   +  + E       V  + A D DS        D+ +I+    + +S     +   +     F   + T + LDRE I+ Y L +   DNG+P ++ +  + + + D NDN P         +V ENK   + V+ L A D D+  N     + I+  D+ +F +N +SG +  ++ +D E+     I+I   D    S      +HV  +D ND  P   S  +     E    G VV  +   DPD      ++ ALL  P  N F F   N  L++L + ++
Sbjct:  723 ATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVR-ATDRDERGQQSVRYSILGGSGKDKFVID--ERTGEIR-ATVE-FDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQ---SVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLY----HLLGSDNQQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDANDPPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDS--------DIRSIR----YGISAGNTGNAFVMDAVTGF---VRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVTENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDYGSFRLNVSSGVVSTVKSLDREKQDAYNISIKVTDARGLSAVNFCMIHV--EDQNDNRPKATSRDVYVHTFEGKFLGGVVADVRPDDPDIDD--LMTCALLNPPQNNIFSFPRGNCELSSLAYSQD 1226          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 211.846 bits (538), Expect = 9.410e-56
Identity = 197/710 (27.75%), Postives = 319/710 (44.93%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIV--FTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENK---FVFRNLNLLTNLE-FDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIP--TLIGISFSVILLF 2603
            + + V D NDN P F   +++  I E     D     + + A D+DI  NA+I Y +  H D   I  I     + +  ++ LD E K  YLI+++A D G    LS S  + + ++D+ND+ P          S  ++E A IG  +A +   D D G N ++  +L     D Y    F +      I V   LDRE ++   L  +  D G PPR+   +  + + D ND AP F        + EN    + V  + A D D G++S     + N            T ES +Y+    +   +  ++T + LDRE I    L +L HD GSP LS++  + + ++D NDN P+F++S++   + EN  + S V++L A D DIG N+ +LY I+T  +  F ++   G +     +D E     T  +   D G  S   T  VHV++ D+ND  P     S +    E+   G  +  L  ID D+ P   ++  ++   N    F      L+T  +  DRE  D Y + V   D G     N  ++ IT+ D+ND  P  +    +  ++  +Q +S          I  ++    D   NA++ Y I +      +L   +G L L S      + S  L ++ +D GTP LF    + I V+D   ++P +    N   +L+ +P  T IG +F  + +F
Sbjct:  158 LSITVEDTNDNKPEFSNVSYSGTIPENI---DVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVR-LDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGG--DGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIAN------------TTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILT-PNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNAT--VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDS-PKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSV---------IGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF----NSSSILVRLPEDTPIGHTFYTVSVF 832          

HSP 2 Score: 185.267 bits (469), Expect = 1.797e-47
Identity = 200/691 (28.94%), Postives = 309/691 (44.72%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDI-GNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVI-INDENDNAP-------FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNS-KLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHT-FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFT------TTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALL-PWENKFVFRNLNLLTNL-----EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTH--LIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHES-EKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            ++VIV+D+NDN P FQ  ++   +KE +  +   Y     A D D   N  + YR     D    ++I      KI   Q LDRE K  Y+  I A D G    +  +  +TV + D+ND  P+FSK   N  SV ++E   +G ++ T+ A D+D  G NS + + +          + F +N+ TG + + + LDRE+     L V+ SD G      ++    I + D NDN P       F   PE   I       S V  + A D D G +      ++N     +FK++    E+T  I          ST   LD E  + Y L +   D G  +   S +L++I V D NDN P F ++     + EN    ++V  +KA D+D G+N+ + Y I +      F IN  +G +    PID E   + ++ +   DQ   +FT       TA + + I+D+ND  P  VS ++   V E  P    V +++ +DPDTG GG V   ++ P   KF   +L+L T +       D E   +Y++ +   D G P LT+  L  + + D+NDN P  T    IG           + S  +P G S+  +  +D D   NA+LTY I    E   F +   SG +  NS        ++ L +       P   S   + I+V+D
Sbjct: 1002 VKVIVDDVNDNNPHFQQASYAFFVKENEPVA--TYLGAVSASDSDEGSNGHVTYRF----DTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKT-QVTVIVRDVNDCSPKFSK---NKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI------VAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIG------SVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKIN----ETTGVI----------STLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQ---AFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLT-YVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKF---SLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIG-----------TVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMD 1638          

HSP 3 Score: 184.496 bits (467), Expect = 3.265e-47
Identity = 179/647 (27.67%), Postives = 292/647 (45.13%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-----AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQT-LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELD-REIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPD-TGPGGEVSVALLPWENKFVFRNLNLLTNL--EFDREINDKYSILVILRDNGQPRLTNSI-LLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSV 2402
            + + V D+ND PPIF    +   I+E         Q++ +     AI +D   NA+++Y ++    K     I + N      LQ+ +D EK     + ++A D G P  L G  N+T+ +IDIND+ P+F+  S   I V + E   IG T  T+   D D G   ++ FSL   L++   +  F ++ +TGA+ +   +D      S  L V   D GSPPRS++  L + + D ND +P F        + E     S +  + A D+DSG +   S    +   T+ F L N       +IK            S LDRE+I  Y+L ++  D+G+PR S+S  + ++V D NDN P F ++++   V EN+   + +  + ASD+D G N  + Y   T V   F++++ +G +   + +D E       +I   D GS        V V ++D+ND  P       + +V E +P G+ + TL   D D  GP  +++  ++     F    +  +  L    DRE+  ++ + V+  D G  +   +I  + I + D+NDN P              N+T   +  E  PIG  +A +   D D   N ++ Y I              G  K+N T  V
Sbjct:  689 VNITVLDVNDEPPIFSKAEYNFTIQEHS-------QALSVIGHVHAISRDKGTNAEVVYSIS----KGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTP-PLFGYANVTIAVIDINDNSPQFNSSS---ILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSL---LSNPGTL--FNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRN---GGKIFIK------------SKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ-FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFI-----------NETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT--------DGTFKINETTGV 1280          

HSP 4 Score: 181.415 bits (459), Expect = 2.717e-46
Identity = 178/613 (29.04%), Postives = 278/613 (45.35%), Query Frame = 3
Query:  399 FSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQ--------IANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVI-INDENDNAPFIECP----ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD-----HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALL-PWENKFVFRNLNLLTNLE-FDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRP 2177
            +++G I      ++      +L+++EF       T+ V V D+NDN P F       ++  E   +D +++   IA+D D   N+   Y + +       K I          A+ +  A    +DRE+ D Y++ I A D G P +  G L L++ + D ND++P FS  S    S  I E   +G +I  + A D DIG N+++Q+S+ E  +D  A+  F I+ +TG I     LD E   S  + V   D GS  + +S A+  I + D NDN P I        ++ + EN    + V  +   D DSG +   +  L       S K   +  ES   + +S            LDRE    + L  +C D G P  +  K   I V D ND  P F R  +E +V EN    + V  + A D D G N++L+Y I    +     H F I+ +SG +     +D E+  Q+ +T+   D+GSP  +    V V + D ND  P     S N S+ E+ P G+ V  L   DPD G    +  ++L P    F+     L+TN    D E+   Y+  V   D G  R  N+  + ++++D+NDN+P
Sbjct:    9 YNAGVITTKTVLDREKVSAYNLTIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFE---NDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNP-ANHGFLRLSITVEDTNDNKPEFSNVSY---SGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI-ETHSDPQAI--FGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQS------------LDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG-RSCNAT-VHVSLTDLNDNQP 597          

HSP 5 Score: 180.259 bits (456), Expect = 6.968e-46
Identity = 191/750 (25.47%), Postives = 334/750 (44.53%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIP--IAIDQDIELNA--KILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-------FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKL-SNVTLESTTYIKKSIVFTFELSTTSILDRENIS-TYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDD-INQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELI-IHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQKAN---RLINHNTKQIYTKKENS 2687
             T+ V + D+NDN P+F   ++++   E         QSI    AID+D    A  + +    N  + F++    +    K+     LDRE +D YL+ ++A+D G  DS++ ++ + + ++D+ND  P FSK   N     I E ++    I  + A   D G N+++ +S+++  TD+  +    IN STG +++ +E+D E   S++L V   D G+PP      +T+ + D NDN+P        +  PE+  I        T   +  FD DSG     S  L++  P   F L SN               T  LS T ++D  N + +Y+L +   D GSP  S++ ++ + V D ND  P F   ++   V+E     S+++++ A+D D G N  + Y   + VD +    +  G ++    +D E  ++  + +   D G+P  +++A V V + D+ND  P     S    V E+ P  T +  +S  D D G  G V+        +F+   +   + T+   DRE    Y   ++  D G     +   +T+ + D+ND  P+ +          +  +++ +   P+G S+ T+   DDD    N+ +TY I    K  F L+  +G L L S           L +   D G  +    +  I I+V+D   + P +   T F+ V    P  + I   V  +  + + Q        +++N NT   +   E +
Sbjct:  583 ATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIG----QSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKL-----LDRETQDNYLLTVKAVDGGGQDSVNKAI-VNITVLDVNDEPPIFSKAEYNFT---IQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVL----IN-STGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGH------TFYTVSVFDADSGVLGRVSFSLLS-NPGTLFNLDSN---------------TGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSK---------NKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKA-FSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTV----PEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETT 1278          

HSP 6 Score: 172.555 bits (436), Expect = 1.707e-43
Identity = 184/690 (26.67%), Postives = 312/690 (45.22%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFT-IKYIQI-ANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIE--ENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFE----LSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTN-LEFDREIN-----DKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            + R+ V D+ND  P F    +   + E    +     +I  A+DQD   N++++Y + N  +  + + +  I  +   I     LDRE+  + ++ +   D G P  LS + ++ VN+ D ND+ P F++ S N  S+F  E +  G  +  + A D DIG NS + +S+   LT +     FF++   G +     LD E+  S    V  +D G   RS +  + V + D NDN P  + P ++ +E  EN     ++  +KA D DS                  F ++   +E     +   VF+ +    ++   +LDRE    Y L +   D G     N  +++I V D ND  P F ++ +   + E+   LS +  + A   D G NA+++Y I   N D+  +IN T G LY    +D E+   + +T+  KD+G+P     A V + + D+ND  P   S S+   + E  P G    T+SV D D+G  G VS +LL   N     NL+  T  L   + I+       Y++ V  +D G P  +++ +L + + D+ND  P   +          + T       P   +I  +   D D  +N +++Y F  + +   F L  + G + + S     D+  + L +   D+GTPR  S  ++ + V D   +NP +
Sbjct:  374 SFRINVGDVNDCAPKFDRHTYETRVWENATVN--TLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSP-PLSDNCSVIVNLTDSNDNDPYFNQSSYNA-SLF--ENSPSGSPVVQLLAQDPDIGENSLILYSI---LTPNTP---FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFD-PSSYSVEYFENTRIGQSICQLKAIDRDSP----------------KFAITRFIIEQGNADE---VFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINST-GTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLL--SNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNW---------SYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLR-NGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHF 1016          

HSP 7 Score: 158.303 bits (399), Expect = 4.241e-39
Identity = 177/694 (25.50%), Postives = 309/694 (44.52%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI-AIDQDIELNAKILYRLTN-HKDKFTIKYIQIANELKIAPLQ---TLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDT--GPGGEVSVALLPWENK---FVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQT---ISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPY-FILHPDSGNLKLNSTCSV--SDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
             T+++I+ D+NDN P F   N T ++++E     +N+Q   I A+D D      + YR+ +    KF++       +LK   L+   +LD E   +Y + I A D G P   S  L   V ++D+ND+ P F+++   L    +SE    G ++  + A+D D G+N++L +S+   +     M+ F I+K +G I   + LDRE  ++  L V  +    P R +S ++ + + D NDN P FI       + EN      +  +   D+D G ++     +++     +F +   T               ELSTT+ LDRE  ++Y L +   D   P  +    I+I + DQNDN P F +S +   + E     +S+L L ASD D G N +++Y +  +    + I+  +G +Y     +    ++       KDQG         V + I+D N+  P          +  +     +V  ++  D DT     G+V+  L   +N    FV  +   ++ T+  F      ++++ +I  D+G P L    ++ I I +I D+ PR             NQT   +S      +G  I T+       + +AQ+TY I    K   F + P +G + + S  ++      +FRL +     G   L   + L I+V+D   ++P +
Sbjct: 1422 ATLKIIIQDLNDNAPKFVSRNLTYVMEDEP----FNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSL-------DLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQL-FNVVVVDVNDNPPEFTRD---LFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGV----EMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRST--------------GELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFL-----------NQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAF 2067          

HSP 8 Score: 157.147 bits (396), Expect = 1.125e-38
Identity = 169/701 (24.11%), Postives = 298/701 (42.51%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIF--QLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSL---NEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDS--------GASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKS--IVFTFELSTTSILDRENI------STYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF---RNLNLL-TNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFR--LVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            +++++ +I D+PP F  Q P           P +    S    +      +A++ Y + +               + +A    LD E    + + + A   G   SL+G + L +N+ID ND+ P F   ++ L  +     A   + +  + A D D G N K+ +S+   NE          F I+ +TG I     LDRE   S  L +  +D G PP+S +  + V++ D NDN P  +      I E+    + V  + A D D          ++S     ++ +  T+    SN  ++ +  I  S  I +  +  T  I  R  I      S   + +   D G P       + I+++ +    P F   ++  +V EN +  +SVL ++ +DN  G+    + + I N ++ F I Q SG +   +P+D+E  ++  + +   D  +PS      V++ + D+ND  P           +E +P GT+V  +S  D D+G  G V  A+   ++K  F   R   ++ T    D E    + + V   D G P +   + +TI + D+NDN P +  + G   V++           P+   +  I   D D   NA+L++  I  + +  F++   SG L  N T    +   ++  L IK  D G P L S + +I++V D    +P +
Sbjct: 1948 VQIVIGNIQDDPPRFLNQTP------ARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWV-SLNGYMILDINVIDRNDNSPAFHPSNM-LAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV-------FTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNY-FRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDN-PPVFRVPGPNDVQVLENL-------PLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF 2620          

HSP 9 Score: 140.584 bits (353), Expect = 1.182e-33
Identity = 142/506 (28.06%), Postives = 233/506 (46.05%), Query Frame = 3
Query: 1062 GAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIE-CPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKL-SNVTLESTTYIKKSIVFTFELSTTSI-LDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD--HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSP-SFTTTAYVHVTIKDMNDVPPSL-VSYSMNPS--VAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFV--FRNLN----LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKP-----YFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNP 2516
            G I     LDRE   + +L ++  +  +PP+S    + V + D NDN+P F+       ++ EN  +      + A D D G++S  S  +++    N FKL S    +   Y          ++ +SI +DRE + +Y L I   D G+P       +SI V D NDN P F   ++   + EN    +S+L++ ASD DIG NA++ Y I T+ D    F I+ T+G +     +D+E  +   I +  +D+GS    +++A V + + D+ND  P + VSY++  S  V E+   GT V  +SV D D+G  GEV+V L   +  F   F  LN    +      DRE +D + +  +  D G P  T      I + D+ND  P+         V   N T++          +A +   D D   N++L Y I  + +      +F + P SG +   +      +    L + V D G+P L     +I+++ D   ++P
Sbjct:   12 GVITTKTVLDREKVSAYNLTIV--EFSTPPKS--YTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQK--LIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYAD------LVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRV-WENATVN--------TLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDP 496          

HSP 10 Score: 130.954 bits (328), Expect = 1.119e-30
Identity = 166/683 (24.30%), Postives = 285/683 (41.73%), Query Frame = 3
Query:  486 GMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRL--TNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHD----------------------------NDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYES-VHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENF-IIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH-TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSL-VSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREIND--KYSILVILRDNGQPRLTNSILLTITISDINDNRP---RLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILH-PDSGNLKLNSTCSV 2402
            G +I+ I VI  D NDN P F   N    + E+       +     A D D   N K+ Y +   N    FTI       E+  A L  LDRE    + ++I   D G P   S +  + V + D+ND+ P F      L  V I E  + G  + ++ A D                             D G+N+++++S    +T+S  ++ + I+  TG I     +D  I +S + + V   D G PP+   + + +II  E    P  E P  F  + EN    ++V  ++  D  +G          NI+ +N F++           ++S V    +S    LD E    + LV+   D+ +P       + I VSD ND  P F +S +  Q  E     + V+ + A+D D G N  + + I +  D  +F I++ +G +     +D E  K   +++   D+GSP   T   V + + D+ND PP   V    +  V E++P  + +  ++  D D+G    +S  ++    + +F     +  L TN+ FD E     +YS+ +   D G P L+++I + + ++D ++  P   R+ +    PG               IG  +  +   D D     ++          +F+ + P S  LK+N+T  +
Sbjct: 2049 GYMILDINVI--DRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTID--STTGEITTAKL--LDRETTASFDLVIRGTDSGIPPK-STNCQVKVVVTDLNDNPPLFDP----LSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSF--PITNSDQID-YKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRIS--YNIENSNYFRIG----------QRSGV----ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPG------------NAKIGDFVGQVTATDRDSGDQGRV----------FFVFYNPTSNALKMNATTGI 2675          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 211.075 bits (536), Expect = 1.316e-55
Identity = 173/634 (27.29%), Postives = 295/634 (46.53%), Query Frame = 3
Query:  624 AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELK-IAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR-NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNP 2516
            A D D   N  I Y ++  ++  +  Y  I      I   + LDRE  D++   ++A D G+P SL G ++LT+N++D+ND+ P F +   N+ +  I E   IG  +  + A D D G+N ++++ +     D+ A   F I + +GA+ V  +LDRE   +  L V   D G+PPRS ++ + + + D ND  P F +   +  I E+      V  ++A D D G++     ++++    N F ++ +  E     K              LD E I  ++L++   D G P L N   + I + D NDN P F  S+F+  + EN        +++A D D G N ++ +  + N D  F IN+ +G +   E +D E+  + T  I  +D+G P    TA + +T+ D+ND PP       + S+AE+   GT V  +  IDPD+GP   V   +    +   FR N   L  L      N K+ + V         L+++ L+ + ++D N + P       S  VK             +G S+ T+   D D   NA+++Y I  +  P F +   +G +K   +     + ++R  +   D+G P+L +   + IH+ D   ++P
Sbjct:   44 ASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEP-SLEGYMDLTINVLDVNDNGPIFER---NIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSA---FSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQK--------------LDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQN-DLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKH-VYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVK---------EDASLGTSVLTVLATDRDTGSNAKISYSI-ATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDP 644          

HSP 2 Score: 177.178 bits (448), Expect = 5.961e-45
Identity = 177/673 (26.30%), Postives = 293/673 (43.54%), Query Frame = 3
Query:  483 EGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNH---KDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSI-----LDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDH--TFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN--LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY-FIHESE-KPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTP 2456
            EG + +TI V+  D+NDN PIF+   +   I E+++  D  +     A D D   N ++ Y + N       F+I  +  A    +  ++ LDREK   Y + ++A D G P   S ++ + + ++D+ND  P+FSK+   + S  I E   + Q + T+ A D D G+N ++ F    ++     M  F IN+  G + V  +LD E+    +L V   D G P   N   + + + D NDNAP F+      +I EN         ++A+D D G +                    +T    ++++  + F+   +T  I     LDRE +  ++  I   D G P    +  I+I + D NDN P F +  +   + EN    +SVL++KA D D G   +++Y I+++  H   F IN   G +     +++        ++   D      ++TA V+V + D N   P     S +  V E    GT V T+   D DTG   ++S ++     +F        + T    DRE  D Y   V   D+G P+L     + I I+D+NDN P          +K S +        P G  +  +   D DI +NAQ+ Y F    + +  F +    G ++         +  + L +   D GTP
Sbjct:  109 EGYMDLTINVL--DVNDNGPIFERNIYAADIPEDKSIGD--FVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGA----VTVMKKLDREKVPTYTLQVQAQDQGNPPR-SATVTVKITLLDVNDCTPQFSKK---VYSATIREDVPVNQLVTTVRATDCDQGSNGEVFF----EIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTN------------------GEITF---SFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSG-PTNVVYSIVSSSGHDRCFRIN-PQGLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVF--------LKPSYEAKVREDIRP-GGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTP 730          

HSP 3 Score: 169.474 bits (428), Expect = 1.709e-42
Identity = 169/638 (26.49%), Postives = 290/638 (45.45%), Query Frame = 3
Query:  501 TIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD--HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN-----LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHES-EKPYFILHPDSGNLKLN 2387
            T+ + + D+NDN P F   +F  MI E  A     Y+    A D+D   N +I +    +   F+I      N   I+  + LDREK  K+   I+A D G P    G+  +T+ ++DIND+ P+FS+E  +     I+E ++ G ++  + A D D G  + +       +  S   +  F     G I +   L+   Y + H++V          S++  + V + D N +AP F     +  ++E+    ++V  + A D D+G+++  S  +  + P  S        E+T  IK          T   LDRE + TY   +   D+G P+L     + I ++D NDN P F + ++E +V E+      V+++ ASD DIG NA ++Y   +N D   TF I+ T G +  ++P+D E   +  +T+   DQG+P    +  V V ++D+ D PP         +V E  P  + V T+     D  P   +  +++   +  VF ++N     + T ++ D E   +Y + V  R    P  T + ++ + + DINDN P L     +  V+         Y+ P          +D D++   +LT+ + E   K +  L+  SG L +N
Sbjct:  324 TVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQ--AYDKDHGTNGEITFSFMQNDLPFSIN----ENTGGISIKEELDREKVPKFTFGIKARDKGVPFK-EGTAQITITLLDINDNPPKFSQEEYH---TSIAENSRWGTSVLQVKAIDPDSGPTNVVY-----SIVSSSGHDRCFRINPQGLITLSCTLN---YNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVD------ETTGVIK----------TAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVF-DINPNTGAIQTLMKLDYETQSEYRLTV--RATLSPFFTETTVM-VYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPA---------YDPDVSD--KLTFKVMEGNAKEWVTLNATSGELSVN 912          

HSP 4 Score: 153.68 bits (387), Expect = 1.135e-37
Identity = 120/435 (27.59%), Postives = 201/435 (46.21%), Query Frame = 3
Query:  912 ISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFI---IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNS-FKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFM-INQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTH 2189
            +SE A++G  +AT+ A D D G+N  +++S++    +  +  +F I++ TG I     LDRE  +     V   D G P     M LT+ + D NDN P  E   N     I E++     V  ++A D DSG++      ++N    NS F +  V+  + T +KK             LDRE + TY+L +   D G+P  S +  + I + D ND  P F +  +   + E+      V  ++A+D D G N ++ + I++  D  F  IN+ +G++   + +D+E      + +  +D+G P       V + + D+ND  P  VS      + E+   G     +   D D G  GE++ + +  +N   F        +    E DRE   K++  +  RD G P    +  +TIT+ DINDN P+ + 
Sbjct:   29 VSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPS-QNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFE--RNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVS-GAVTVMKK-------------LDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFM--QNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQ 444          

HSP 5 Score: 131.724 bits (330), Expect = 7.290e-31
Identity = 113/441 (25.62%), Postives = 200/441 (45.35%), Query Frame = 3
Query: 1194 NDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHT-FMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR----NLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            N+   F    E+  + E+    + V  + A D DSG++      +I    + S  L + T  S   I      T  ++T   LDRE +  +   +   D G P L     ++I V D NDN P F R+ +   + E+K     VL ++ASD D G N ++ Y I+ ++ D++ F I + SG +  ++ +D E+    T+ +  +DQG+P  + T  V +T+ D+ND  P       + ++ E +P   +V T+   D D G  GEV   ++   +   F     N  +    + D E+   +++LV  +D GQP L N   + I + D+NDN P+         V    QT+       +G     +  +D D   N ++T+   +++ P F ++ ++G + +        +  F   IK +D G P      ++ I ++D
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNG-----MIRYSMSPSQNLMSATYFSIDQI------TGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQF--------VSSHFQTM-IPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP-FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLD 434          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 208.379 bits (529), Expect = 8.994e-55
Identity = 208/710 (29.30%), Postives = 320/710 (45.07%), Query Frame = 3
Query:  405 SGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIA----NELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC----PEN---FIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVD-HTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKF--VFRNLN-----LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSV-SDLGS--------FRLVIKVQDNG 2450
            +G I      ++     ISL L         ++++V V+DINDN P F    +T+ I+E    +  N   I  A D D   N  + Y + +  +  T      A    + L +   + LDRE  D Y + I A D G P +L G   + + I+D ND  P F++ S  L S  I+E  K G +I  + A D D G+N  ++++++     S ++  F ++ STG I     LD E+  S    VI SD G P +++   +T+ + D NDN+P ++     P N    I  EN    + + +I   D DS  +S     + N      FK+            + + F F +     LDRE +  Y+L +   D G P  S    + I V+D NDN P F  + +   + E   N S VL+L A+D D G N  + Y I    D   F ++  SG +   +P+D E+   +TITI  +D GS   T +  V VTI D ND  P  +  S   +++E    G  V  +S  D D+G  G ++  +   + +   +F  LN     L T  + DRE    YS  V+ +D+G P+L +S+ + +TISDINDN P    +             S    EP G  +  +   D D   NA ++Y I        I   ++GN  ++S+  V S L S        F L+I  +D G
Sbjct:   48 TGVISTTARIDRETTTQISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTN--PINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTP-ALMGYCLINITILDENDHAPVFTQNSY-LGS--IAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSI--FDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKV------------EFLGFYF-IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFE-LNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPV---------EYFASIMENEPPG-KLLQVTATDADEGTNAVISYDI--------IGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGG 717          

HSP 2 Score: 173.326 bits (438), Expect = 7.575e-44
Identity = 172/665 (25.86%), Postives = 290/665 (43.61%), Query Frame = 3
Query:  531 DNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIY---ESVHLFVIVSDC---GSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLT---------NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKL------NSTCSVSDLGSFRLVIKVQDNGTP 2456
            ++PP F L ++   +   Q P  + +  + +A+DQD   N ++ Y +    ++       I    K+   ++L +  K  Y +I+ A D G P S S S+ +T+ I D ND +  F     N     ++E +  G  + T+ AH  D      + +SL        +  HF ++  +G I     LDRE        +++++ ++     +  + +   + V + D NDNAP F        + E     S V  IKA D D G ++     L++    + F           +I  S   T EL  +  LDRE  S+Y+LV+   D  +  L ++  I I V D ND  P F  S++ + + E+ +  S V+ L ASD DIG N  + Y I   N+   F +   +G L   + +DFE  +   +TI  +D G    ++T  V V + D+ND  P   +  +  +V E++  G  V   +  D DTG    ++ ++        F ++N  T         +LE      D + ++V+  D G P+L+    +T+ ++D NDN P       SP    +  ++          ++ TI   D D N N ++TY I      YF LHP +G L++      N T        ++L I+  D G P
Sbjct:  941 NHPPKFTLSSYVTHVLASQ-PLSYQFFYV-VAVDQDSGKNGQLFYSIPQGNEE---GLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVP-SFSASVPVTIYIQDSNDHRSLFVN---NTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLIS------SESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKF-----------FINSS---TGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTF-SVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFV----SPPAAAAGSSL----------NVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTI-------YQLTIQASDGGQP 1554          

HSP 3 Score: 166.392 bits (420), Expect = 1.124e-41
Identity = 176/634 (27.76%), Postives = 286/634 (45.11%), Query Frame = 3
Query:  318 SQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI----AIDQDIELNAKILYRLTNHK--DKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSL-NEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENI----STYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLN----LLTNLEFDRE-INDKYSILVILRDNGQPRL-TNSILLTITISDIN 2165
            S ++  + ++DRE+L +  +T S   I  +     M ND  I          +  + ++IVT    V D+NDN P+F    + I + E   P        P+    A+D D   NAK  Y L +    DKF I       EL ++  +TLDRE    Y ++++A D    + L  +  + + + D ND +P F +      +V I+E A IG  +  + A D DIG N  +++S+ N  L    AM  F +  +TG + V   LD E  +   L +   D G  P S+++ +TV + D NDNAP F   P    + EN      VG   A D D+G +++ +  + +  P+ +F +++ T E              ++T + +D E +     ++ LV++  D GSP+LS  K I++ V+D+NDN P F           + +N   V+ + A D D   N  + Y II+  +  F ++ ++G L  I  I  +      +TI   D G PS  T   V V  +      P+  S     SV E+   GT V T+    P +   G +   L    +K  F  +     + T    DRE +   ++++V   D   P   T+S  +TIT+ D+N
Sbjct: 1102 SGQITTRVRLDREELIK--NTGSNVYIMQAEA---MYNDTTI----------KRDKAIVIVT----VTDLNDNAPVFSRAVYAITVSELSLPGS------PVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFIN--SSTGELHLS--KTLDRETTSSYNLVVKATDASNAN-LYSTAKIEITVGDSNDQRPVFPESDY---TVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLA---AM--FDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCE--------------ITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSP--PAAAAGSSLN---VMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIP-DNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 4 Score: 144.436 bits (363), Expect = 7.899e-35
Identity = 168/668 (25.15%), Postives = 281/668 (42.07%), Query Frame = 3
Query:  498 VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFT--IKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNV-DHTFMINQTSGDLYQIEPIDFER----HKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTN-LEFDREINDK---YSILVILRDNGQP-RLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI-HESEKPYFILHPDSGNLKLNSTCSVSDLG-SFRLVIKVQDNGTP 2456
            V + + + D ND+  +F    F   + E  +P       +  A+D        I+Y L + +  F   ++  QI   +++   + +     + Y++  EA+          ++ + V + D+ND+ P FS+    + ++ +SE +  G  +  I A D D G+N+K  +S    L     M+ FFIN STG +H+   LDRE   S +L V  +D  +    ++  + + + D ND  P F E      I E+    S V  + A D D G +      LI       + +SN  L +   ++ +   T  L     LD E    Y L I   D+G   LS++  +++ V D NDN P F      + V EN      V +  ASD D G NA + + + +     TF +N  + ++  I  ID E          + +   DQGSP  +T   + V + D ND  P  VS    P+ A        V T++  DPD    G+V+ +++   N +   NL+  T  L+   +I D    Y + +   D GQP R T +++       I           G P    ++   S +  +  G S+ T+       + N  + Y++  +S K  F +   +G +K         +G SF LV+   D   P
Sbjct: 1034 VPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDH--SRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAI-VIVTVTDLNDNAPVFSRA---VYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYS----LVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNG-----LIK------YSISNGNLAAMFDVESA---TGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVS---PPAAAAGSSLN--VMTITAEDPDRNSNGKVTYSIISGNNGYF--NLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIG----------GGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGP 1660          

HSP 5 Score: 143.28 bits (360), Expect = 1.676e-34
Identity = 167/695 (24.03%), Postives = 295/695 (42.45%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPI----AIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESL---NLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSL-NEKLTDSYAME--HFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITN---VDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF---RNLNLLTNL-EFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKP-YFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 2525
            I + + D ND+ P+F   ++   I E   P       + I    A D+D   N  I Y +     +    +   ++   I   Q LD E K+ Y   + A D G P S +    +T+N++D ND+ P+     L   N      SE + I   IA I   D D   NS+ +  + N      + +E   F+       I +   LDRE+    +L + V+D G P RS    + + + D NDN+P F        I E     S V  + A D D G +   S    +I   N      V  +S             ++T   LDRE +S+ ++ I   D+GS   + S  +++ + D NDN P F +S+++  + E     ++VL++ A+D D G N  + Y I ++   V+  F +N  +G L+    +D E     + T+  KD G P   ++  V +TI D+ND  P         S+ E+ P G ++Q ++  D D G    +S  ++   N   F    +  +++ L   D E+ + +S+++  +D G      + ++ +T+ +  DN P   +           +  +F+  E  P G  +  +Y    D  +N  ++Y I   +    F++    G +K+N      +   + L +  +      L +   + I V+D   + P ++
Sbjct:  192 INITILDENDHAPVFTQNSYLGSIAENTKPG------VSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVP-SKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYF------IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSY---SITGGNDLGWFQVDFQSGL-----------VTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLLQ-VTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLY-----------EMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFS 845          

HSP 6 Score: 139.813 bits (351), Expect = 2.050e-33
Identity = 161/723 (22.27%), Postives = 311/723 (43.02%), Query Frame = 3
Query:  420 NMENDNKICFMLISLSLLEFQEGMII-VTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENI------STYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII--TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPI--GFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSV------SDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            +M+ + K  ++L  ++ +   + +    T+ + V D NDN P F   +  + I          Y +   A+D D   N  + Y+LT++ +   +     +  +K+A  + L    + +Y + + A D G P   S    +T++I    +  P+F+  S  +  V  S+   +      + A D D G N +L +S+ +        E  F     G +++   L + +  S  L V  +D G P  S S+ +T+ I D ND+   F+     F + EN    + VG + A  +D   + +    LI+ +  + F +   + + TT ++              LDRE +      + Y +      N +    +  ++ + V+D NDN P F R+ + I V E  +  S V ++KA D D G NA   Y ++  T +D  F IN ++G+L+  + +D E      + +   D  + +  +TA + +T+ D ND  P         ++ E    G++V  L+  D D G  G +  ++       +F        L+     D E    Y + +  +D+G   L++++ +T+ + D+NDN P               Q ++ + +E +  GF +      D D   NA + + ++ S+ P      +S   ++ +  ++      +   SF+LV+   D G+P+L +   + + V D   ++P +
Sbjct:  801 DMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAA--AVDLDAGKNGLVRYQLTSNAEGL-LWINSTSGVIKLA--RKLTDGDETQYTVQVLASDSGSPPQHS---TMTIHITLSINHPPKFTLSSY-VTHVLASQ--PLSYQFFYVVAVDQDSGKNGQLFYSIPQG-----NEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSE--SHFAVDVRSGQITTRVR--------------LDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDK-FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLF-----------PTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMY-SQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF 1478          

HSP 7 Score: 127.487 bits (319), Expect = 1.343e-29
Identity = 148/580 (25.52%), Postives = 254/580 (43.79%), Query Frame = 3
Query:  828 LNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSL-NEKLTDSYAMEHFFI-NKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNC--SCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFF-------HRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIE---PIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVAL-----LPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEK---PYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            +++ V + DIND++PRF      L    I E   +  T     A D D GNN  + +++ +   T ++++        ST  +     LDRE  +   L +  +D G+P       + + I DEND+AP F +      I EN     ++  + A D DSG++ +   + D   I+  + F L     +S+T +         + T   LD E  ++Y+  ++  D G P  ++   ++I V D NDN P         H  +  I+  EN +  +++  +  +D D   N+      ITN D            Y I+   P+D E      +T+   D+G PS +T  +V + + D+ND  P+  S +   +++E    G+ V  L+  DPD G  G VS ++     L W  +  F++  + T    DRE     +I +  +D+G    T S  +T+TI D NDN+PR            S+   + S    IG ++  +   D D   N ++TY I  S+      F L+  +G L   S         +   +  +D+G P+L S +++ + + D
Sbjct:   79 ISVQVQVDDINDNEPRFPTLYYTL---RIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDL-----DSSTGV---------IRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRS-ENSLINTNIAYILVTDKDSNTNSQT-ELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWF-QVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMK---------SSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISD 629          

HSP 8 Score: 124.405 bits (311), Expect = 1.092e-28
Identity = 163/643 (25.35%), Postives = 266/643 (41.37%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQT-LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFIS--EQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENK----FVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNL 2378
            + G   VT+ +I  D NDN P F   ++   I E  +      Q    A D D   N +I Y +++  D       ++  +  +   ++ LDRE K  Y   + A D G P  +S S+ + + I DIND+ P F       +  F S  E    G+ +  + A D D G N+ + + +     +     +F I+ STG I     LD E+ E   L +   D G+   + +  + V + ++ DN P F+    NF + EN  + + VG + A   D   S   S  +++  PTN F      ++ST  I K             +DRE  + Y L ++        LS    ++I V D+NDN P F  S+  + +    +    V    A D D G N  + Y + +N +    IN TSG +     +      Q T+ +   D GSP   +T  +H+T+  +N  PP     S    V    P       +  +D D+G  G++  + +P  N+     +F    L       + +   Y ++V   D G P  + S+ +TI I D ND+R               N T  F+  E    G  + T+  H  D ++   + Y +  SE  +F +   SG +
Sbjct:  510 KTGSTTVTVTII--DGNDNKPRFMKSSYKGTISEGASIGATVLQVS--ATDVDSGDNGRITYEISS-SDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMS-SVKVELTISDINDNAPVFYP-----VEYFASIMENEPPGKLLQ-VTATDADEGTNAVISYDIIGGNNNG----NFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGS--ISYAIVSGDPTNLF-----LVDSTGGIIK---------INGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS-INH-PPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYS-IPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFV-----------NNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSES-HFAVDVRSGQI 1105          

HSP 9 Score: 103.219 bits (256), Expect = 3.369e-22
Identity = 118/519 (22.74%), Postives = 212/519 (40.85%), Query Frame = 3
Query: 1035 EHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNV---DHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKG------TVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEF------------DREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFI-HESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDY 2522
            + F  N +TG I     +DRE    + L +   +    P +  +++ V ++D NDN P F        I E+    +T     A D D+G +      + +   T +F L      + +        T  + T   LDRE    Y L I   D G+P L    LI+I + D+ND+ P F ++++   + EN     S+L++ A+D D G N D+ Y I  +    +  F ++ ++G +   + +DFE     T  +   D G PS    A V + + D ND  P L    + P   +   +       T +  + V D D+    +  + +   +++  F+       +EF            DRE+   Y++ + + D G P  +    + I ++D+NDN P  T    +  +    Q  S+  Q         +   D D   N  ++Y I   ++  +F +   SG +          + S  + I  QD+G+        + + ++DG  + P +
Sbjct:   40 KQFGFNSNTGVISTTARIDRETTTQISLQLRTLN----PSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGS--------TLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFK-------VEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQ---------LNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRF 530          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 282.722 bits (722), Expect = 5.873e-80
Identity = 232/805 (28.82%), Postives = 382/805 (47.45%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL---------STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITN--VDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFS---IATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHV 2492
            Y + EEQ P   +G++  D  L     L +LE       P+ +   K   I+           +  +DRE       TL   +    G  C +E +  +  +L + S         ++  R+ V DINDN P F L   TI + E          SIP+A D+D E N    Y LT   D  T+  +Q+A++      ++  L  LDRE KD Y + I+A+D G P   S +L L V + D ND+ P+F   S       +SE + +G ++  + A D+D+G N ++++SL++ +     +    I+++TG I+V   LDRE   S+  +V+  D G  P+S+   +T+ + D+NDNAP +E     ++  + G           + V  ++  D D G ++  +C +    P   F+L   + +ST+  K+     + L TT+ LD E +  Y + I+  D+G+P LS++  + + V+D NDN P F  + FE+   E      ++L + A+D D G NA+L Y I+ +  +   F I+  +G++    P+D E  ++    +   D+GSP    TA V + + D ND  P  +    + SV E+MP  + V  ++V+D D G    V +++ P   KFV +N    +L+++ FDRE    Y+  +   D G+P  ++ + +TI + D NDN P +T        K SN   SF    P+      +  +   D D   NA L + I     PY  F + P SG + L    +    G  RLV++V D G P   +   + I+V
Sbjct:   26 YRVQEEQPPNTLIGSLAADHGLPDSGHLYKLEVGA----PYLRVDGKTGDIF---------TTEIPIDRE-------TLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPR-------LIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALF--SIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQAL-LRVVVTDANDNSPKFEHPSYE---AEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKL--LRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP---FQLRPAS-DSTSDNKRK----YFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVT--------KPSNS--SFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSI-AGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 2 Score: 134.035 bits (336), Expect = 2.131e-31
Identity = 117/382 (30.63%), Postives = 186/382 (48.69%), Query Frame = 3
Query:  738 LQT---LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNS-FKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHR---SNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKD 1856
            LQT   LD E+  +Y + I A+D G P +LS + +L V + D+ND+ P FS     +  V  +E+ + G+TI  + A D D G N++L +++   + DSY    F I+ +TG +     LDRE  E     V  +D GSP    +  + + + D NDN P F+    +F + EN   LS VG +   DMD G +++     ++++P    F + N     T  I  SI F          DRE  S+Y+  +   D G P  S+   ++I V D+NDN P   +   S+F  Q+       S V  ++A D D G NADL++ I   N    F I+ +SG++   + +  +      + +   D+G P    TA VH+ + +
Sbjct:  422 LQTTTPLDYERVKEYRVEIVAVDSGNP-ALSSTNSLKVQVTDVNDNSPVFSP---TIFEVDFAEENQPGETILDVTATDADSGTNAELFYNI---VGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVH---LSVEPDGGKFVVQN----GTGTILSSISF----------DREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFR-QLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNE 778          

HSP 3 Score: 76.2554 bits (186), Expect = 1.302e-13
Identity = 68/247 (27.53%), Postives = 111/247 (44.94%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC 1220
             +G   V I+V+  D NDN P F L  ++  + E   P   +   +   +D D   NA +   +     KF ++         I    + DREK+  Y   ++A+D G+P   S  + +T+N++D ND+ P  +K S N     +S  A     +  + A D D G N+ L FS+          + F I+ S+G I +  E+ R+      L V VSD G PPR  +  + + +N+   N   +E 
Sbjct:  556 HKGTATVVIKVL--DCNDNDPKFMLSGYSFSVLENMPP--LSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQ----NGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNDPVVTKPS-NSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSI----AGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEA 788          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 283.108 bits (723), Expect = 6.721e-80
Identity = 241/848 (28.42%), Postives = 398/848 (46.93%), Query Frame = 3
Query:   30 VNFRYFFFLYMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKL--CRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVI-----VNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECP-------ENFI--IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTIS-FSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHV 2492
            V+FR       + +L + C++ +          +  N  Y ++EEQ P   +G++  DL L     L +LE  +    P+ +  SK   IY           +  +DRE L  CR                 N+  D+K CF+   +S+ +  +G I +  R+I     V DINDN P F  P  T+ I E          SIP+A+D+D   N    Y L+   D   +  +Q+A ++     ++  +  LDREKKD Y + I  +D GKP   S +L L + + D ND+ P+F K   N     + E +  G ++  + A+D D G N  + +SL++            I++STG I+V   +DRE    +  +V+  D G   +S+   +T+ I D+NDNAP IE         +NF+  I E+    + V  ++  D D G ++  +C +    P   F+L   +  +    +K     + L TT++LD E I  Y + I+  D+G+P LS++  + + V+D NDN P F  +  E+   E+      V+ + A+D D G+NA+L+Y II ++    F IN  +G++     +D E  ++    +   D+G PS T TA V + ++D ND  P  +    + SV E+MP    V  ++V D D G   +V++ + P   KF+ +N    +L+++ FDRE    Y+  +   D G P  ++ + +TI + D NDN P +T        K +N + +      P    +  +   D D   NA+L Y I     P+  F +  +SG +KL    +    G  RLV++V D G P   +    ++HV
Sbjct:    4 VSFRVMLSGEDMAVLRWGCLVLLTIVLMVPCGAVPSNNIYKLSEEQPPNTLIGSLAADLGLPDSGHLYKLEVGS----PYLRVDSKTGEIY---------TTEIPIDRETLSDCR-----------------NLFEDDK-CFLEFEVSITDMVKG-IGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENT--HTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSAL-LRITVTDQNDNAPKFEK---NQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQ--ASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVP---FQLRPASESANDRKRK-----YFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVT--------KPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTI-TGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTT--ALVHV 792          

HSP 2 Score: 144.05 bits (362), Expect = 1.702e-34
Identity = 141/578 (24.39%), Postives = 249/578 (43.08%), Query Frame = 3
Query:  840 VNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNE-----KLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFH--------RSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGD-------LYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR-NLN---LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            + ++DIND+ P+FS     ++++ I E    G   +   A D D G+N   +++L+      +L      E   +++    + V   LDRE  +S  L + V D G PPR++S  L + + D+NDNAP  E  +    + EN     +V  ++A D D+GA+ +            S   ++ T++    I +S    +      ++DRE  +     ++  D G    S+   ++I + DQNDN P             NF   + E+    + V  ++ SD D G NA +   +  +V         S +       L     +D+ER K   I I   D G+P+ ++T  + V + D+ND  PS     +  + AE    G  V  +   D D+G   E+  +++      +F  N N   +    + DRE  ++Y   V   D G P  T + ++ I + D NDN P+           +S  + S +   P    +  +   D D  +N+Q+T F+ E +   FI+   +G +  + +       ++   +K  D G P   S + + I+V+D
Sbjct:  139 IEVLDINDNTPQFSSP---ILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAED--VDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDY---------SLHQASDTVQRLLRIDRSTGIIY---VKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFM---------LSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFV-EPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLD 689          

HSP 3 Score: 122.094 bits (305), Expect = 1.035e-27
Identity = 149/599 (24.87%), Postives = 253/599 (42.24%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTL-DREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLI-----SVFISEQAKIGQTIATIFAHDNDIGNNS--------KLQFSL---NEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-----FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCK--DQGSPSFTTTAYVHVTIKDMND-----VPPSLVSYS-MNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYS----ILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIG 2198
            +R+ V D NDN P F+   +   + E   P     Q    A D D   N  I Y L    D    + ++I     I  ++ L DRE+ +     + A D G P+S S    +T++I D ND+ P      + L+        ISE   IG  +A +   D D G N+         + F L   +E   D      +F+  +T        LD E  +   + ++  D G+P  S++ +L V + D NDN P      +E   NF  +   G+   V  + A D DSG ++     +I     + F++++               T E+   + LDRE++  Y   +   D G P  + + ++ I V D+NDN P F  S +   V EN   L+ V  +  SD D G N+ +  F+  + +  F+I   +G +  +  I F+R K+ T T   K  D G P  ++   V + + D ND       P+  SY+ + PS     P  T V+ +   D D G   E+   +       +F+  +    ++  +    K+     ++V + D G+P    + L+ + +++  +N   +  L+G
Sbjct:  249 LRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVR--ANDADTGANGDIDYSLHQASDTVQ-RLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRG-PNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDR--KRKYFLQTTT-------LLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEV--NFAEDNQPGD--KVIDVVATDADSGVNAELVYSIIESSAASLFEINS--------------NTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPD-NGKFIIQNGTGTI--LSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPS----SPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEGLVG 809          

HSP 4 Score: 70.8626 bits (172), Expect = 6.967e-12
Identity = 72/318 (22.64%), Postives = 138/318 (43.40%), Query Frame = 3
Query:  267 WSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVI-VSDCGSPPRSNSMALTVIINDENDNAPFIE 1217
            +S   S    +++ ++N+ ++ ++ ++DRE + R++  ++ +                          +  + G  IV I V   D NDN P F L  ++  + E   P   N   +    D D   N+++   +     KF I+         I    + DREK+  Y   ++A+D G P   S  + +T+N++D ND+ P  +K + N     +   +     +  + A D D G N++L +++    T       F I+ ++G I +      + ++ +H  V+ VSD G PPR  +  + V +N+  +N   IE
Sbjct:  526 YSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAAD-----------------------KGVPSKTGTAIVVINV--EDRNDNDPKFMLSGYSFSVNENMPP--LNPVGVVTVSDADKGENSQVTLFVEPDNGKFIIQ----NGTGTILSSISFDREKESTYTFRLKAVDAGDP-PRSSYVGVTINVLDENDNAPYVTKPA-NSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTI----TGGNPHGLFQISHNSGEIKLAQGFTGK-HKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIE 805          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 282.337 bits (721), Expect = 6.241e-79
Identity = 241/848 (28.42%), Postives = 398/848 (46.93%), Query Frame = 3
Query:   30 VNFRYFFFLYMLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKL--CRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVI-----VNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECP-------ENFI--IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTIS-FSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHV 2492
            V+FR       + +L + C++ +          +  N  Y ++EEQ P   +G++  DL L     L +LE  +    P+ +  SK   IY           +  +DRE L  CR                 N+  D+K CF+   +S+ +  +G I +  R+I     V DINDN P F  P  T+ I E          SIP+A+D+D   N    Y L+   D   +  +Q+A ++     ++  +  LDREKKD Y + I  +D GKP   S +L L + + D ND+ P+F K   N     + E +  G ++  + A+D D G N  + +SL++            I++STG I+V   +DRE    +  +V+  D G   +S+   +T+ I D+NDNAP IE         +NF+  I E+    + V  ++  D D G ++  +C +    P   F+L   +  +    +K     + L TT++LD E I  Y + I+  D+G+P LS++  + + V+D NDN P F  +  E+   E+      V+ + A+D D G+NA+L+Y II ++    F IN  +G++     +D E  ++    +   D+G PS T TA V + ++D ND  P  +    + SV E+MP    V  ++V D D G   +V++ + P   KF+ +N    +L+++ FDRE    Y+  +   D G P  ++ + +TI + D NDN P +T        K +N + +      P    +  +   D D   NA+L Y I     P+  F +  +SG +KL    +    G  RLV++V D G P   +    ++HV
Sbjct:    4 VSFRVMLSGEDMAVLRWGCLVLLTIVLMVPCGAVPSNNIYKLSEEQPPNTLIGSLAADLGLPDSGHLYKLEVGS----PYLRVDSKTGEIY---------TTEIPIDRETLSDCR-----------------NLFEDDK-CFLEFEVSITDMVKG-IGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENT--HTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSAL-LRITVTDQNDNAPKFEK---NQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQ--ASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVP---FQLRPASESANDRKRK-----YFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVT--------KPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTI-TGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTT--ALVHV 792          

HSP 2 Score: 142.895 bits (359), Expect = 4.908e-34
Identity = 141/579 (24.35%), Postives = 249/579 (43.01%), Query Frame = 3
Query:  840 VNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFF------INKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFH--------RSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGD-------LYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFR-NLN---LLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVD 2498
            + ++DIND+ P+FS     ++++ I E    G   +   A D D G+N   +++L+       A + F       +++    + V   LDRE  +S  L + V D G PPR++S  L + + D+NDNAP  E  +    + EN     +V  ++A D D+GA+ +            S   ++ T++    I +S    +      ++DRE  +     ++  D G    S+   ++I + DQNDN P             NF   + E+    + V  ++ SD D G NA +   +  +V         S +       L     +D+ER K   I I   D G+P+ ++T  + V + D+ND  PS     +  + AE    G  V  +   D D+G   E+  +++      +F  N N   +    + DRE  ++Y   V   D G P  T + ++ I + D NDN P+           +S  + S +   P    +  +   D D  +N+Q+T F+ E +   FI+   +G +  + +       ++   +K  D G P   S + + I+V+D
Sbjct:  139 IEVLDINDNTPQFSSP---ILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALS---AGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDY---------SLHQASDTVQRLLRIDRSTGIIY---VKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFM---------LSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFV-EPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLD 689          

HSP 3 Score: 121.324 bits (303), Expect = 1.973e-27
Identity = 149/599 (24.87%), Postives = 253/599 (42.24%), Query Frame = 3
Query:  504 IRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTL-DREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLI-----SVFISEQAKIGQTIATIFAHDNDIGNNS--------KLQFSL---NEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-----FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCK--DQGSPSFTTTAYVHVTIKDMND-----VPPSLVSYS-MNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYS----ILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIG 2198
            +R+ V D NDN P F+   +   + E   P     Q    A D D   N  I Y L    D    + ++I     I  ++ L DRE+ +     + A D G P+S S    +T++I D ND+ P      + L+        ISE   IG  +A +   D D G N+         + F L   +E   D      +F+  +T        LD E  +   + ++  D G+P  S++ +L V + D NDN P      +E   NF  +   G+   V  + A D DSG ++     +I     + F++++               T E+   + LDRE++  Y   +   D G P  + + ++ I V D+NDN P F  S +   V EN   L+ V  +  SD D G N+ +  F+  + +  F+I   +G +  +  I F+R K+ T T   K  D G P  ++   V + + D ND       P+  SY+ + PS     P  T V+ +   D D G   E+   +       +F+  +    ++  +    K+     ++V + D G+P    + L+ + +++  +N   +  L+G
Sbjct:  249 LRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVR--ANDADTGANGDIDYSLHQASDTVQ-RLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRG-PNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDR--KRKYFLQTTT-------LLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEV--NFAEDNQPGD--KVIDVVATDADSGVNAELVYSIIESSAASLFEINS--------------NTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPD-NGKFIIQNGTGTI--LSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPS----SPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEGLVG 809          

HSP 4 Score: 70.0922 bits (170), Expect = 1.082e-11
Identity = 65/245 (26.53%), Postives = 110/245 (44.90%), Query Frame = 3
Query:  486 GMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVI-VSDCGSPPRSNSMALTVIINDENDNAPFIE 1217
            G  IV I V   D NDN P F L  ++  + E   P   N   +    D D   N+++   +     KF I+         I    + DREK+  Y   ++A+D G P   S  + +T+N++D ND+ P  +K + N     +   +     +  + A D D G N++L +++    T       F I+ ++G I +      + ++ +H  V+ VSD G PPR  +  + V +N+  +N   IE
Sbjct:  576 GTAIVVINV--EDRNDNDPKFMLSGYSFSVNENMPP--LNPVGVVTVSDADKGENSQVTLFVEPDNGKFIIQ----NGTGTILSSISFDREKESTYTFRLKAVDAGDP-PRSSYVGVTINVLDENDNAPYVTKPA-NSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTI----TGGNPHGLFQISHNSGEIKLAQGFTGK-HKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIE 805          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 281.567 bits (719), Expect = 1.696e-78
Identity = 232/805 (28.82%), Postives = 382/805 (47.45%), Query Frame = 3
Query:  147 YSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANEL-----KIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL---------STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITN--VDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRN--LNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFS---IATIYFHDDDINQNAQLTYFIHESEKPY--FILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHV 2492
            Y + EEQ P   +G++  D  L     L +LE       P+ +   K   I+           +  +DRE       TL   +    G  C +E +  +  +L + S         ++  R+ V DINDN P F L   TI + E          SIP+A D+D E N    Y LT   D  T+  +Q+A++      ++  L  LDRE KD Y + I+A+D G P   S +L L V + D ND+ P+F   S       +SE + +G ++  + A D+D+G N ++++SL++ +     +    I+++TG I+V   LDRE   S+  +V+  D G  P+S+   +T+ + D+NDNAP +E     ++  + G           + V  ++  D D G ++  +C +    P   F+L   + +ST+  K+     + L TT+ LD E +  Y + I+  D+G+P LS++  + + V+D NDN P F  + FE+   E      ++L + A+D D G NA+L Y I+ +  +   F I+  +G++    P+D E  ++    +   D+GSP    TA V + + D ND  P  +    + SV E+MP  + V  ++V+D D G    V +++ P   KFV +N    +L+++ FDRE    Y+  +   D G+P  ++ + +TI + D NDN P +T        K SN   SF    P+      +  +   D D   NA L + I     PY  F + P SG + L    +    G  RLV++V D G P   +   + I+V
Sbjct:  103 YRVQEEQPPNTLIGSLAADHGLPDSGHLYKLEVGA----PYLRVDGKTGDIF---------TTEIPIDRE-------TLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPR-------LIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALF--SIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQAL-LRVVVTDANDNSPKFEHPSYE---AEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKL--LRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVP---FQLRPAS-DSTSDNKRK----YFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVT--------KPSNS--SFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSI-AGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 853          

HSP 2 Score: 133.65 bits (335), Expect = 3.634e-31
Identity = 117/382 (30.63%), Postives = 186/382 (48.69%), Query Frame = 3
Query:  738 LQT---LDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAP-FIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNS-FKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHR---SNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIIT-NVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKD 1856
            LQT   LD E+  +Y + I A+D G P +LS + +L V + D+ND+ P FS     +  V  +E+ + G+TI  + A D D G N++L +++   + DSY    F I+ +TG +     LDRE  E     V  +D GSP    +  + + + D NDN P F+    +F + EN   LS VG +   DMD G +++     ++++P    F + N     T  I  SI F          DRE  S+Y+  +   D G P  S+   ++I V D+NDN P   +   S+F  Q+       S V  ++A D D G NADL++ I   N    F I+ +SG++   + +  +      + +   D+G P    TA VH+ + +
Sbjct:  499 LQTTTPLDYERVKEYRVEIVAVDSGNP-ALSSTNSLKVQVTDVNDNSPVFSP---TIFEVDFAEENQPGETILDVTATDADSGTNAELFYNI---VGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVH---LSVEPDGGKFVVQN----GTGTILSSISF----------DREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKPSNSSFR-QLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNE 855          

HSP 3 Score: 76.2554 bits (186), Expect = 1.432e-13
Identity = 68/247 (27.53%), Postives = 111/247 (44.94%), Query Frame = 3
Query:  480 QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIEC 1220
             +G   V I+V+  D NDN P F L  ++  + E   P   +   +   +D D   NA +   +     KF ++         I    + DREK+  Y   ++A+D G+P   S  + +T+N++D ND+ P  +K S N     +S  A     +  + A D D G N+ L FS+          + F I+ S+G I +  E+ R+      L V VSD G PPR  +  + + +N+   N   +E 
Sbjct:  633 HKGTATVVIKVL--DCNDNDPKFMLSGYSFSVLENMPP--LSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQ----NGTGTILSSISFDREKESSYTFRLKAVDGGEP-PRSSYVGVTINVLDENDNDPVVTKPS-NSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSI----AGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEA 865          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 273.478 bits (698), Expect = 1.721e-76
Identity = 214/736 (29.08%), Postives = 348/736 (47.28%), Query Frame = 3
Query:  342 KVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPL---QTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIIN--DENDNAPFIECP-------ENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVF--RNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTY--------FIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELI 2483
            ++DREKLC        S +F+           K C+  I +++L   E   +V IR ++ D+NDN P+FQ     I I E  A  +  Y  +P A D D+ +N    Y L     +F +  I+     K   L   Q LDREK+D +++ I+  D G P   S ++ L V I D+ND++P F    L    V + E A  G ++A + A D D G+N+++ F+ + +++ S    HF IN STG I V   LDRE+     L V+ SD GS P       TVI+N  D NDN P I+            ++ EN    + +  I   D D+      +C   +  P   F+L  V  +            F L T + LD E    Y++ I+  D G+P L+ S ++ I + D+NDN P F +   ++ + EN    + ++K+ A+D D G NA+++Y +  +    F I++ SG L   + +D E+ ++ +  +  +D GS    +   V + ++D+ND  P+      N  V E++P    V  ++V D D G    +++++L  ++ F+   +   +  N+ FDRE    Y+ +V   D GQP  ++   +TI + D+NDNRP    +   P    S   +  +     G  +  ++  D+D   NA+L Y            S +  F +   SGN+ L      +DLG  RLV+KV+D G P     + L+
Sbjct:   90 RIDREKLC--------SGVFTE----------KRCYYEIEVAVLP-DEIFRLVKIRFLIEDVNDNAPLFQSTVINISIPENTA-INTRY-PVPSAFDPDVGINGIQNYELVKSVTEFGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAI-LQVTISDVNDNRPIFQDSEL---EVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSS-TKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGSTPSR----ATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVP---FRLKPVFNDQ-----------FLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRP----VFVIPSSNYSYDLVRTTTTP--GAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQPESLQAITLV 775          

HSP 2 Score: 160.614 bits (405), Expect = 1.025e-39
Identity = 165/609 (27.09%), Postives = 267/609 (43.84%), Query Frame = 3
Query:  756 EKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTG----AIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPE-NFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGI---NADLLYFIITNVDH--TFMINQTSGDLYQIE---PIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLP--WENKFVFRNLNLLT-NLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE--PIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAI 2528
            EK+  Y I +  +    PD +   + +   I D+ND+ P F      +I++ I E   I        A D D+G N    + L + +T+ + ++   I    G     + V   LDRE  ++  + + V D G+PP+S++  L V I+D NDN P  +  E    + EN    ++V  + A D D G+++              F  SN    ST         T  ++    LDRE    + L++L  D GS    +   + + V+D NDN+P    + + I +V   V LS    L      I +   +ADL   +    DH   F +     D + +E   P+D+E  ++  I I   D+G+P   T+A V + IKD ND  P      +  S+ E+    T +  +S  D D+G   E+   L P   +   + R   +L+     DRE  +++S +VI RDNG   L +++ + + + D+NDN P  TH              +F   E  P+  ++  I   D D   NA +T  I    K  FI+ P +G +K N T       S+  ++K  D G P   S  ++ I+VVD   + P + I
Sbjct:  103 EKRCYYEIEVAVL----PDEIFRLVKIRFLIEDVNDNAPLFQS---TVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKSVTE-FGLD--IIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIH-----------FAFSNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGGS--TPSRATVIVNVTDVNDNVPAID-TRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAFTH-----------PEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNG-KDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVI 675          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000023518.1 (SMESG000023518.1)

HSP 1 Score: 1915.97 bits (4962), Expect = 0.000e+0
Identity = 976/982 (99.39%), Postives = 977/982 (99.49%), Query Frame = 3
Query:   60 MLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENSINKNDPVNDEALMELXXXXXXXXXXXXXXXIGYSSFLPCMDSHTMIFQPGYVLTIDTSMIGSGSKLNILXXXXXXXXXXXXETNLQENHGCNLSNVTFKPAGVKKL 3005
            MLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLC+FQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQ IATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIE IDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE IGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENSINKNDPVNDEALMELYPTSSCYSTYPSETCIGYSSFLPCMDSHTMIFQPGYVLTIDTSMIGSGSKLNILDTSTDSGNGDSSETNLQENHGCNLSNVTFKPA VKK 
Sbjct:    1 MLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCQFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQKIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEAIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQETIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENSINKNDPVNDEALMELYPTSSCYSTYPSETCIGYSSFLPCMDSHTMIFQPGYVLTIDTSMIGSGSKLNILDTSTDSGNGDSSETNLQENHGCNLSNVTFKPADVKKF 982          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000023518.1 (SMESG000023518.1)

HSP 1 Score: 1852.03 bits (4796), Expect = 0.000e+0
Identity = 945/951 (99.37%), Postives = 946/951 (99.47%), Query Frame = 3
Query:  153 MNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENSINKNDPVNDEALMELXXXXXXXXXXXXXXXIGYSSFLPCMDSHTMIFQPGYVLTIDTSMIGSGSKLNILXXXXXXXXXXXXETNLQENHGCNLSNVTFKPAGVKKL 3005
            MNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLC+FQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQ IATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIE IDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQE IGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENSINKNDPVNDEALMELYPTSSCYSTYPSETCIGYSSFLPCMDSHTMIFQPGYVLTIDTSMIGSGSKLNILDTSTDSGNGDSSETNLQENHGCNLSNVTFKPA VKK 
Sbjct:    1 MNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCQFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQKIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEAIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQETIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVIKTVQKQKANRLINHNTKQIYTKKENSINKNDPVNDEALMELYPTSSCYSTYPSETCIGYSSFLPCMDSHTMIFQPGYVLTIDTSMIGSGSKLNILDTSTDSGNGDSSETNLQENHGCNLSNVTFKPADVKKF 951          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000014227.1 (SMESG000014227.1)

HSP 1 Score: 308.916 bits (790), Expect = 2.867e-89
Identity = 254/803 (31.63%), Postives = 403/803 (50.19%), Query Frame = 3
Query:   84 CIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEE-QAPSDWNYQSIPIAIDQDIELNAKILYRLTNHK--DKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNS-FKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGS--PRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENK----VNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIG----FSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNG 2450
            C+I+         + I  NFTY+M EE  PP  LGN+I DL+L  ++S+  L+  +L+F P +Q  SKF  I   S   Q L L K  DRE  C    T + SK+ ++ CIC    D   C+  I L L       ++  +++ ++DINDN P F      I I E+ Q  S +    +P+A DQD  LNA I Y+   ++  D   +    I   L +     LDRE    Y +II A D G   S+S SL + + ++D+ND  P F+   L++  ++ISE   +   +  + A D DIG+N ++ +SL  +   + A + F IN S G I + ++ DRE      L +   D GS PRS+S+ ++V I D NDN P I  P N    EN      +   +  D+D     N SC +   +  NS F+L      S + I +  V  + L T  I DRE+ S Y++ ++C D+ S   R+S S  IS+ + D NDN P   + N+ +   +N+     N   + ++ A D DIG+N+ + YFII +    F ++  +G L+Q+  +D+E+  +  + IG +D G+PS T++  +   I D ND  P     ++  S+AE+   GTV+  L++ D D+G  G  +  L    ++F      L+  + FDRE  ++YS+   ++D G+P L +   L I I D+NDN P + +    P +   NQT+ F+Y         F +  +   D D   N+ L +FI E    +F +   +G + L    S S++G+  + + V+D G
Sbjct:   21 CLINFLFIQKTFQELIFPNFTYTMKEEIIPPYNLGNLITDLKLRSIISINDLQPQSLSFLPSNQFGSKFLTIVFHSYLYQYLTLTKVFDREINCDLLSTKTISKVSTNKCIC-QNYDPFRCYFYIVLVLAPVHHSNMVFILQIFIDDINDNSPQFTKKEIQISIPEDAQLNSRF---PLPVAEDQDWNLNAVIDYKSFPNESFDIIIVDRFSINQTLYMTIKTNLDREIAQNYTLIIIASDRGIEISMSTSLTVQITVLDVNDCSPTFT--DLSIKPLYISEDIFVPSQLLIVNATDLDIGDNGQITYSLEIQPFSNLA-QTFSINPSNGEIRIISKPDREKQAFFTLIIWAQDHGSIPRSSSVKVSVNIIDVNDNDPIINGPSNPETYENNKTPLIISTYRITDLD--IHHNISCIIAKNQLENSVFQLK----RSKSMISQESV--YHLITQHIFDRESQSDYNITLICRDDFSDISRVS-SLTISLTILDLNDNSPELSK-NYNLSFRQNESYLPYNNDCITQISAIDKDIGLNSQIEYFIIHSDQQAFTVHLITGKLFQLNSLDYEKGSKCFVVIGARDSGNPSLTSSLTLTFDIIDTNDNAPHYDGPTI-VSIAENNLIGTVLIVLNISDKDSGLSGMTTSILTYKSDEFSLVENQLVALVSFDREKQNEYSVKFKMKDFGEPPLISIQELVIKILDVNDNHPTILY----PSI---NQTMVFAYNHYFPRQKIFQVTAV---DSDEGLNSNLRFFI-EPYSEFFQIDFKTGWISLKQYLSSSNIGNLSINLVVRDCG 794          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000014227.1 (SMESG000014227.1)

HSP 1 Score: 298.901 bits (764), Expect = 6.030e-86
Identity = 247/780 (31.67%), Postives = 392/780 (50.26%), Query Frame = 3
Query:  153 MNEEQDPPIYLGNIIHDLRLDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEE-QAPSDWNYQSIPIAIDQDIELNAKILYRLTNHK--DKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNS-FKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGS--PRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENK----VNLSSVLKLKASDNDIGINADLLYFIITNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIG----FSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNG 2450
            M EE  PP  LGN+I DL+L  ++S+  L+  +L+F P +Q  SKF  I   S   Q L L K  DRE  C    T + SK+ ++ CIC    D   C+  I L L       ++  +++ ++DINDN P F      I I E+ Q  S +    +P+A DQD  LNA I Y+   ++  D   +    I   L +     LDRE    Y +II A D G   S+S SL + + ++D+ND  P F+   L++  ++ISE   +   +  + A D DIG+N ++ +SL  +   + A + F IN S G I + ++ DRE      L +   D GS PRS+S+ ++V I D NDN P I  P N    EN      +   +  D+D     N SC +   +  NS F+L      S + I +  V  + L T  I DRE+ S Y++ ++C D+ S   R+S S  IS+ + D NDN P   + N+ +   +N+     N   + ++ A D DIG+N+ + YFII +    F ++  +G L+Q+  +D+E+  +  + IG +D G+PS T++  +   I D ND  P     ++  S+AE+   GTV+  L++ D D+G  G  +  L    ++F      L+  + FDRE  ++YS+   ++D G+P L +   L I I D+NDN P + +    P +   NQT+ F+Y         F +  +   D D   N+ L +FI E    +F +   +G + L    S S++G+  + + V+D G
Sbjct:    1 MKEEIIPPYNLGNLITDLKLRSIISINDLQPQSLSFLPSNQFGSKFLTIVFHSYLYQYLTLTKVFDREINCDLLSTKTISKVSTNKCIC-QNYDPFRCYFYIVLVLAPVHHSNMVFILQIFIDDINDNSPQFTKKEIQISIPEDAQLNSRF---PLPVAEDQDWNLNAVIDYKSFPNESFDIIIVDRFSINQTLYMTIKTNLDREIAQNYTLIIIASDRGIEISMSTSLTVQITVLDVNDCSPTFT--DLSIKPLYISEDIFVPSQLLIVNATDLDIGDNGQITYSLEIQPFSNLA-QTFSINPSNGEIRIISKPDREKQAFFTLIIWAQDHGSIPRSSSVKVSVNIIDVNDNDPIINGPSNPETYENNKTPLIISTYRITDLD--IHHNISCIIAKNQLENSVFQLK----RSKSMISQESV--YHLITQHIFDRESQSDYNITLICRDDFSDISRVS-SLTISLTILDLNDNSPELSK-NYNLSFRQNESYLPYNNDCITQISAIDKDIGLNSQIEYFIIHSDQQAFTVHLITGKLFQLNSLDYEKGSKCFVVIGARDSGNPSLTSSLTLTFDIIDTNDNAPHYDGPTI-VSIAENNLIGTVLIVLNISDKDSGLSGMTTSILTYKSDEFSLVENQLVALVSFDREKQNEYSVKFKMKDFGEPPLISIQELVIKILDVNDNHPTILY----PSI---NQTMVFAYNHYFPRQKIFQVTAV---DSDEGLNSNLRFFI-EPYSEFFQIDFKTGWISLKQYLSSSNIGNLSINLVVRDCG 751          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000053027.1 (SMESG000053027.1)

HSP 1 Score: 282.722 bits (722), Expect = 9.695e-82
Identity = 239/778 (30.72%), Postives = 387/778 (49.74%), Query Frame = 3
Query:  129 IGINFTYSMNEEQDPPIYLGNIIHDLRLDK-VLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQ--KKVDREKLCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIP-FFHRSNF-EIQVVENKVNLSSVLKLKASDNDIGINADLLYFII-TNVDHTFMINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNP-SVAEHMPKGTVVQTLSVIDPDT-GPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKV 2438
            + I   Y + EEQ PPI LGN++ DL+L+    S   L   ++ FFP  Q     + I       +  +L+  +++DREKLC+  HT S SK     C C  +N+N  C++  ++    +Q  M +  + + + DINDN PIF    FT+ I E       ++ +IP A D+D  ++  I Y L      F++ Y    N L+I   +TLDRE   KY + +  ID  +  S +G L LT+ + DIND  P+F   +   IS  + E + IGQ +  +   D D GNNS + F LN    D  +++HF IN  +G + +   LDRE  +   L ++  D GSP +++SM + +I+ D NDN+P I+      I ENR   S +      D D G +S  +C+L++ +    F L+ +         +  V+T+++ T  I DRE  + Y+ VI C DNG   L+    + IL+ D+ND  P F +  NF  I ++EN +  + + K +A D DI  N  L+Y I+ +     F +N ++G L+     D+E  K   + I  +D       +  +  + I + ND  P +++   N   + E++    ++    V+D D         V L+  EN FV   LNL+T   F+RE  DK+ I +I+RD  + +L+N  ++ + I D+ND  P        P  +  +  +  S    I F IA I   D D   NA+L+Y ++     YF + P SG LK+ +   + +L S ++++ +
Sbjct:   21 VSITINYQLVEEQPPPIILGNLLDDLKLNSNSFSKSDL---SINFFPMQQPGVTLFKI-------ENFLLKAVERIDREKLCK-SHTRSISKT-KDICFC-FKNENN-CYIRFNILQTPYQSLMNLHEVNIRIVDINDNYPIFTPNFFTLRISE--GSEIGSFFNIPKANDKDNIVHESITYILFPLSSSFSVVYQN--NSLRIKLKETLDRESIYKYNLKVLGIDKIEDLSNTGVLTLTIIVEDINDCSPKFLDSATRNIS--LPETSIIGQVVYVVQVTDCDSGNNSIIHFYLNNNGQDE-SLQHFSINPISGEVSIIEPLDRESIQGYVLIILAKDLGSPSKTSSMTINIIVTDINDNSPIIKIDPILFISENRPIRSVLTTFTVEDYDEGDNSRVTCELLSHETHPPFSLNFM-------FNRLFVYTYKIETNFIFDREKKTFYNFVIHCQDNGVNNLTTDVKVLILIEDENDFSPKFTNAHNFSSISIMENTLFPNPIFKFQAIDPDIKENGKLVYSIMRSRYPLRFRLNASTGYLFANGIFDYELVKTYELEIKVEDSSPHPLCSIIHFIINIINENDNSPEIINLGDNRIFIQENISINNIIFRFHVLDRDNENDSCSADVFLVNNENHFVIMGLNLITTDYFNREQKDKFQITIIVRDKEKHQLSNVYVVDVFIEDVNDCVPEFVF----PSKE--STPLEISCDVSIDFVIAQISARDGDSGYNAKLSYQLYNYNH-YFFMDPFSGFLKVRN--KLKELSSRQIILNI 761          
The following BLAST results are available for this feature:
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11Y7.189e-7627.47protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y7.189e-7627.47protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y8.687e-7627.47protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y1.304e-7527.47protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH94.654e-7527.46protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-16.415e-4928.03FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-15.894e-4526.95FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.038e-3426.64CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-13.655e-2524.87Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-13.655e-2524.87Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan2.984e-5527.76gene:FBgn0024836 transcript:FBtr0304900[more]
stan3.256e-5527.76gene:FBgn0024836 transcript:FBtr0304899[more]
stan3.256e-5527.76gene:FBgn0024836 transcript:FBtr0300578[more]
stan3.410e-5527.76gene:FBgn0024836 transcript:FBtr0339463[more]
stan3.737e-5527.76gene:FBgn0024836 transcript:FBtr0330601[more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a3.682e-8228.54protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.377e-8128.54protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh115.021e-7828.27protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh113.106e-7728.27protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
CR847522.14.342e-7227.22pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047798.11.485e-8228.40protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.12.496e-8228.40protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.14.492e-8228.40protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
vapa4.169e-7728.25VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
pcdh171.961e-7027.91protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x1.118e-8228.21protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.705e-8228.36protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x7.163e-8128.36protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x9.135e-8128.36protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.147e-8028.36protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6KEQ9|PC11X_PIG1.232e-7728.93Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q6X862|PC11X_GORGO3.147e-7527.88Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q71M42|PC11X_PANTR4.783e-7427.65Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA5.293e-7427.65Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q9BZA8|PC11Y_HUMAN1.516e-7327.48Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L8F7N21.140e-8128.78Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A3P8YZ513.833e-8129.77Protocadherin 11 OS=Esox lucius OX=8010 PE=4 SV=1[more]
A0A3P8YZ643.964e-8129.77Protocadherin 11 OS=Esox lucius OX=8010 PE=4 SV=1[more]
A0A3P8YZ995.028e-8129.77Protocadherin 11 OS=Esox lucius OX=8010 PE=4 SV=1[more]
A0A3Q3FN091.054e-8028.56Protocadherin 1a OS=Kryptolebias marmoratus OX=370... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a3.126e-8129.31protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a3.319e-8029.31protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh111.375e-7628.23protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh1b8.797e-7628.08protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh111.302e-7528.21protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.16.687e-6728.01pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh118.362e-6227.69protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000004042.12.201e-5327.84pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.12.458e-5327.84pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000008517.19.825e-5226.90pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461897.516e-6229.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354137.906e-6028.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404709.410e-5627.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.316e-5527.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354128.994e-5529.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a5.873e-8028.82protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1b6.721e-8028.42protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b6.241e-7928.42protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1a1.696e-7828.82protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh111.721e-7629.08protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023518.10.000e+099.39SMESG000023518.1[more]
SMESG000023518.10.000e+099.37SMESG000023518.1[more]
SMESG000014227.12.867e-8931.63SMESG000014227.1[more]
SMESG000014227.16.030e-8631.67SMESG000014227.1[more]
SMESG000053027.19.695e-8230.72SMESG000053027.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017705 ID=SMED30017705|Name=Protocadherin-11 X-linked|organism=Schmidtea mediterranea sexual|type=transcript|length=3096bp
ATTGAATGATATCTAGTGTATGAAAAATTGTAAATTTTAGGTACTTTTTT
TTCTTGTATATGCTTGTAATTTTACACTTTTGGTGTATTATTTCAATCAA
ACCCTTTGCTACCAACTTGCTTGACCAAATCGGAATCAACTTCACTTATT
CAATGAACGAAGAACAAGATCCACCAATATATTTAGGGAACATTATTCAT
GATCTCAGACTCGACAAAGTTCTTTCATTGAAGCAACTCGAAGAGAACAC
GTTGACATTTTTTCCTTGGTCGCAGGCTTCTTCAAAATTCTATATGATTT
ATAAAGATTCGGCAAATTCTCAAAAATTAGTTCTGCAAAAAAAGGTTGAT
AGGGAAAAATTATGCCGGTTCCAGCACACATTATCAAAGTCAAAAATATT
TTCCTCCGGTTGTATTTGCAATATGGAAAACGATAATAAAATATGTTTCA
TGTTAATCTCTCTGAGTTTATTGGAATTTCAGGAAGGAATGATAATTGTA
ACGATACGGGTAATTGTCAATGACATTAATGATAACCCCCCAATATTTCA
ATTGCCTAATTTCACAATTATGATCAAAGAAGAACAAGCTCCTTCCGACT
GGAATTACCAGTCAATTCCGATTGCCATTGATCAAGACATTGAATTGAAT
GCAAAGATCTTATATAGGCTTACAAATCACAAAGACAAGTTCACCATAAA
ATACATCCAAATTGCTAATGAATTGAAAATTGCCCCTCTACAAACGTTGG
ACAGAGAGAAAAAAGACAAATATTTAATCATCATAGAAGCCATCGACTGC
GGAAAGCCAGATTCATTATCCGGAAGTTTGAATCTCACAGTTAATATCAT
AGATATAAATGACTCGCAGCCAAGATTCAGCAAAGAATCCTTAAACTTAA
TATCCGTTTTCATTTCCGAACAAGCAAAAATTGGTCAGACAATCGCTACA
ATATTTGCTCACGACAACGACATTGGAAACAACTCGAAATTACAATTTTC
TTTAAACGAAAAATTGACCGACTCTTATGCTATGGAGCACTTTTTTATTA
ATAAGTCTACTGGAGCGATTCACGTTTGGAATGAATTGGATCGAGAAATC
TATGAGTCTGTACACTTATTTGTCATTGTATCCGATTGTGGATCGCCTCC
TCGCTCAAACTCAATGGCTTTGACAGTGATTATCAACGATGAAAACGACA
ATGCTCCTTTCATTGAATGTCCTGAGAACTTTATCATTGAAGAAAATAGG
GGAGAATTGTCCACAGTCGGTTTCATTAAAGCATTCGACATGGATTCCGG
AGCAAGTAGCAATTGTTCATGTGATCTTATTAACATAAAACCAACCAATT
CATTCAAACTATCCAATGTAACCCTTGAAAGTACGACCTACATTAAAAAG
TCTATCGTTTTCACATTTGAATTGAGTACAACTAGTATTTTAGACAGAGA
AAATATCTCTACATATAGTTTAGTTATTCTCTGCCACGACAATGGGAGTC
CTAGGTTATCAAATTCTAAGTTAATATCAATATTAGTGAGTGACCAAAAT
GACAATATCCCCTTTTTTCATCGTTCGAATTTTGAAATCCAAGTTGTGGA
GAATAAAGTAAACCTTTCCTCAGTTTTAAAACTGAAAGCTTCTGACAATG
ATATAGGTATCAATGCAGATTTATTATATTTTATCATTACTAATGTGGAT
CATACTTTTATGATAAATCAAACTTCGGGTGATCTGTATCAAATTGAACC
AATTGACTTTGAGAGACATAAACAAATTACAATTACGATTGGATGCAAGG
ATCAAGGAAGTCCCTCTTTTACTACCACTGCTTATGTTCACGTAACTATC
AAAGACATGAATGATGTTCCCCCTTCATTAGTTTCTTATTCCATGAATCC
TTCAGTTGCTGAACATATGCCAAAAGGTACAGTTGTCCAGACTCTTTCTG
TCATTGATCCAGATACCGGTCCGGGAGGAGAAGTATCTGTTGCTTTACTC
CCATGGGAAAACAAATTCGTTTTCAGAAATTTAAATTTGTTAACAAATCT
AGAATTTGATCGAGAGATCAATGATAAATATTCCATTCTTGTGATTCTTC
GAGACAATGGGCAACCCCGACTAACAAATAGTATTTTATTAACAATAACT
ATTTCCGATATCAATGACAATCGTCCCCGTCTAACGCATCTGATCGGTTC
TCCTGGAGTGAAAATCTCGAATCAAACGATTTCGTTCTCCTATCAAGAGC
CGATCGGATTTTCAATTGCGACAATTTATTTCCACGACGACGACATAAAT
CAAAATGCCCAACTTACATATTTTATTCATGAATCAGAAAAACCATATTT
TATTCTTCATCCAGACTCAGGAAATCTAAAACTCAATTCTACTTGTAGTG
TATCAGATTTGGGCTCATTTCGACTCGTTATCAAAGTCCAGGATAATGGG
ACTCCCCGACTGTTTTCGTTGTTAGAATTAATAATTCATGTTGTTGATGG
CCCCTCAAGTAATCCCGACTATGCCATTATCACAAATTTCCGAATCGTCC
TTATTGTCATTCCCACTTTAATAGGAATTTCTTTCAGTGTCATCTTATTA
TTTGTGATTAAAACTGTTCAAAAACAAAAGGCTAATAGATTAATAAATCA
TAATACAAAGCAGATTTATACAAAAAAAGAAAATTCCATTAATAAAAATG
ATCCAGTAAATGATGAAGCATTAATGGAATTGTATCCAACAAGTTCTTGC
TATTCAACATATCCCTCAGAAACATGTATTGGTTATTCATCTTTTCTCCC
GTGCATGGACAGTCATACAATGATCTTTCAACCGGGCTACGTTTTGACTA
TCGACACGAGCATGATTGGTAGCGGGAGCAAATTGAATATTCTTGATACG
AGCACCGATTCTGGGAACGGCGACAGCTCGGAAACGAATCTGCAGGAAAA
TCATGGTTGCAACCTAAGCAATGTGACATTCAAGCCCGCCGGTGTAAAAA
AATTAGTGATAGACTTTCGCCATTTAATAAATAAACCATTTTTCAGTTGT
AAGAATAAATCTTTCTAATTGGTTTCAATTTGTTTTTTTAAGAGTG
back to top

protein sequence of SMED30017705-orf-1

>SMED30017705-orf-1 ID=SMED30017705-orf-1|Name=SMED30017705-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1003bp
MLVILHFWCIISIKPFATNLLDQIGINFTYSMNEEQDPPIYLGNIIHDLR
LDKVLSLKQLEENTLTFFPWSQASSKFYMIYKDSANSQKLVLQKKVDREK
LCRFQHTLSKSKIFSSGCICNMENDNKICFMLISLSLLEFQEGMIIVTIR
VIVNDINDNPPIFQLPNFTIMIKEEQAPSDWNYQSIPIAIDQDIELNAKI
LYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKP
DSLSGSLNLTVNIIDINDSQPRFSKESLNLISVFISEQAKIGQTIATIFA
HDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYES
VHLFVIVSDCGSPPRSNSMALTVIINDENDNAPFIECPENFIIEENRGEL
STVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIV
FTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNI
PFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHTF
MINQTSGDLYQIEPIDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDM
NDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWE
NKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISD
INDNRPRLTHLIGSPGVKISNQTISFSYQEPIGFSIATIYFHDDDINQNA
QLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPR
LFSLLELIIHVVDGPSSNPDYAIITNFRIVLIVIPTLIGISFSVILLFVI
KTVQKQKANRLINHNTKQIYTKKENSINKNDPVNDEALMELYPTSSCYST
YPSETCIGYSSFLPCMDSHTMIFQPGYVLTIDTSMIGSGSKLNILDTSTD
SGNGDSSETNLQENHGCNLSNVTFKPAGVKKLVIDFRHLINKPFFSCKNK
SF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
GO:0010923negative regulation of phosphatase activity