NADH-quinone oxidoreductase subunit D

Overview
NameNADH-quinone oxidoreductase subunit D
Smed IDSMED30017699
Length (bp)3740
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH-quinone oxidoreductase subunit D (SMED30017699) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH-quinone oxidoreductase subunit D (SMED30017699) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH-quinone oxidoreductase subunit D (SMED30017699) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH-quinone oxidoreductase subunit D (SMED30017699) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017699

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30017699SMESG000028508.1 SMESG000000385.1 SmedASXL_018625SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000005044.1 SMESG000005033.1 Contig12192uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000005044.1 SMESG000005033.1 Contig12192newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000028508.1 Contig14574newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000028508.1 Contig14574uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000076091.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000066165.1 SMESG000065866.1 SMESG000065178.1 SMESG000062279.1 SMESG000053372.1 SMESG000050587.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000029226.1 SMESG000028508.1 SMESG000026530.1 SMESG000022236.1 SMESG000004687.1 Contig17376newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000076091.1 SMESG000070487.1 SMESG000069936.1 SMESG000066411.1 SMESG000066165.1 SMESG000065866.1 SMESG000065178.1 SMESG000062279.1 SMESG000053372.1 SMESG000050587.1 SMESG000048922.1 SMESG000047874.1 SMESG000046659.1 SMESG000046053.1 SMESG000043782.1 SMESG000029226.1 SMESG000028508.1 SMESG000026530.1 SMESG000022236.1 SMESG000004687.1 Contig17376uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000000385.1 Contig34259newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000028508.1 Contig21172newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000028508.1 Contig21172uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000043908.1 SMESG000028508.1 SMESG000024555.1 SMESG000012010.1 SMESG000081278.1 SMESG000081276.1 SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000052813.1 SMESG000043147.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig18859uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017699SMESG000043908.1 SMESG000028508.1 SMESG000024555.1 SMESG000012010.1 SMESG000081278.1 SMESG000081276.1 SMESG000080770.1 SMESG000065333.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000052813.1 SMESG000043147.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig18859newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH-quinone oxidoreductase subunit D vs. TrEMBL
Match: A0A4Y2BP85 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_185017_1 PE=4 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 9.942e-96
Identity = 113/231 (48.92%), Postives = 149/231 (64.50%), Query Frame = 2
Query: 1898 LEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDGKMLRDLTGKETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALNECGIADRVRAMSFDTTSSNTGLANGACV-LEQMLGINLLSLACRHHIFELVIGAVYQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDDKDVAAVLMD 2587
            ++V++P LAA LDRTKVSDRKAV++VAETA+SLG + +D                                  L VHWDGK+L++L GKE +DRLP++VSGK + +LL  AKL S TG+ QA AV  AL + GI D+V A+ FDTTS NTG  +G CV LEQ +   LL LA RHHI EL+IG V+   MG S A ++L+FKRFQ+ W+FID+  Y TG+++KD+ A + D
Sbjct:  144 MKVMTPYLAAALDRTKVSDRKAVFVVAETARSLGYEEQD--------------------------------AKLTVHWDGKLLQNLNGKEKVDRLPVIVSGKSVHQLLTVAKLASGTGENQAIAVYAALQDWGIDDKVSALCFDTTSVNTGQISGTCVLLEQKMNKKLLYLAYRHHIMELIIGVVFNKCMGFSCASDILLFKRFQAYWEFIDKNKYKTGINNKDILAQVAD 342          

HSP 2 Score: 93.9745 bits (232), Expect = 9.942e-96
Identity = 46/106 (43.40%), Postives = 69/106 (65.09%), Query Frame = 2
Query: 2777 FMFRSQFDLRPTEVKELRDICTFSVSLYIKVW*IAHCAATAPHNDLTFLQALIDYEVVHPAIXXXXXXXXXXHLWYISEELVGLALFDKYLSTVTKRELVSAIKVI 3094
            +MF  QF + PTE K L+ IC F++ +Y+K W  A     AP+ND   +++L+ Y+ +   ISK AS K+A HLWY+SE+LV LALFD  +    KR+++ A+K +
Sbjct:  407 WMFSYQFTITPTEEKGLQKICIFAIHVYLKAWMTASLPQNAPYNDFNLMKSLLKYKKIDEEISKVASEKLANHLWYLSEDLVALALFDNQVPRCNKRQMIKAMKEV 512          

HSP 3 Score: 93.2041 bits (230), Expect = 9.942e-96
Identity = 40/65 (61.54%), Postives = 52/65 (80.00%), Query Frame = 1
Query: 2590 RNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2784
            ++  ++FAE  L     RDDYREFLEL +IFLG+ P+RGIRF+A GAMHHARWMSK+LY LK+++
Sbjct:  344 KDNKIQFAEKLLHDSHSRDDYREFLELILIFLGKTPSRGIRFMAPGAMHHARWMSKMLYCLKIWM 408          

HSP 4 Score: 84.3445 bits (207), Expect = 2.305e-16
Identity = 38/73 (52.05%), Postives = 48/73 (65.75%), Query Frame = 2
Query: 1331 LGLLLHEHKENGKTIREASTIVIESTAKFWRKGRIPTRAVQHCQANLESEFDVWRLLKKNASRKAETEG*ESG 1549
            LGL LH H E  KTIRE+ST  IE   KFW+K RIP + +++CQ  LE  F+ WRLLKKN +R   T+  + G
Sbjct:    3 LGLFLHHHIELNKTIRESSTTTIEEVTKFWQKARIPVQELRNCQPKLEKLFEQWRLLKKNKNRSTLTQKNKEG 75          

HSP 5 Score: 33.113 bits (74), Expect = 2.305e-16
Identity = 15/16 (93.75%), Postives = 15/16 (93.75%), Query Frame = 1
Query: 1624 EFLLAQREKGRRGSML 1671
            EFLLAQ EKGRRGSML
Sbjct:  103 EFLLAQCEKGRRGSML 118          
BLAST of NADH-quinone oxidoreductase subunit D vs. TrEMBL
Match: A0A4Y2HIW3 (RT_RNaseH_2 domain-containing protein OS=Araneus ventricosus OX=182803 GN=AVEN_46098_1 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.497e-95
Identity = 135/244 (55.33%), Postives = 183/244 (75.00%), Query Frame = 2
Query: 1859 VHMPVRSQRKRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDGKMLRDLTGKETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALNECGIADRVRAMSFDTTSSNTGLANGACV-LEQMLGINLLSLACRHHIFELVIGAVYQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDDKDVAAVLMD 2587
            V MP   +  + RL+V++P LAA LDRTKVSDRKAV++VAETA+SLG +V ++ L+RS+IRR+R  H   +  +L+ EF+ + +  L+VHWDGK+L++LTGKE +DRLP++VSGK + +LL  AKL S TG+ QA AV  AL + G+AD+V AM FDTTS NTG  NG C+ LEQ +   LL LACRHHI +L+IGAV+   MG SSAP+VL+FKRFQ+ W+FID+  Y TG+++KD+ A + D
Sbjct:  139 VDMP---KGNKKRLKVMTPYLAAALDRTKVSDRKAVFVVAETARSLGYEVDEITLSRSSIRRERMKHHSNMFHQLKTEFQ-EQDAKLMVHWDGKLLQNLTGKEKVDRLPVIVSGKSVHQLLTVAKLASGTGENQAIAVYAALQDWGLADKVSAMCFDTTSVNTGQINGTCILLEQKMNKKLLYLACRHHIMKLIIGAVFNKCMGFSSAPDVLLFKRFQAYWEFIDKNKYKTGINNKDILAQVAD 378          

HSP 2 Score: 92.4337 bits (228), Expect = 1.497e-95
Identity = 40/65 (61.54%), Postives = 52/65 (80.00%), Query Frame = 1
Query: 2590 RNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2784
            ++  ++FAE  L     RDDYREFLEL +IFLG+ P+RGIRF+A GAMHHARWMSK+LY LK+++
Sbjct:  380 KDDRIQFAEKLLHDSHSRDDYREFLELILIFLGKTPSRGIRFMAPGAMHHARWMSKMLYCLKIWM 444          

HSP 3 Score: 39.2762 bits (90), Expect = 1.497e-95
Identity = 15/31 (48.39%), Postives = 22/31 (70.97%), Query Frame = 2
Query: 2777 FMFRSQFDLRPTEVKELRDICTFSVSLYIKV 2869
            +MF  QF + PTE K L+ IC F++ +Y+KV
Sbjct:  443 WMFSCQFTITPTEEKGLQKICIFAIHVYLKV 473          
BLAST of NADH-quinone oxidoreductase subunit D vs. TrEMBL
Match: X1X3C5 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.070e-94
Identity = 109/234 (46.58%), Postives = 156/234 (66.67%), Query Frame = 2
Query: 1889 RGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDGKMLRDLTGKETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALNECGIADRVRAMSFDTTSSNTGLANGAC-VLEQMLGINLLSLACRHHIFELVIGAVYQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDDKDVAAVLMD 2587
            RG+   ++P LA  LDR K+SDR AV+++  T ++ G  VKDL LNR++I R RQ  R+  + +LR+EF      P+VVHWDGK+L DLTGKE +DRLP++VS K   KLL    L S TG+ QAEAV  AL E G+ D V+A+  DTT+SNTG   GAC +LEQ+L  ++L   CRHHI+E+++ + ++     +S P++ +FKRFQ  W  ++  +Y+TG++D  V+  L D
Sbjct:  192 RGKKNFITPKLAIALDRCKISDRDAVHILTATVEAFGIHVKDLILNRTSINRIRQRLRKDRADQLRKEFNTSEVGPVVVHWDGKLLPDLTGKELVDRLPVIVSYKNSEKLLSVPNLISGTGQNQAEAVFQALEEWGLIDHVQALCCDTTASNTGRLKGACIILEQLLERDILYFPCRHHIYEIILRSAFEVNFVVTSGPDIQIFKRFQQFWPKVNINNYNTGLEDIIVSEKLND 425          

HSP 2 Score: 98.5969 bits (244), Expect = 2.070e-94
Identity = 49/105 (46.67%), Postives = 67/105 (63.81%), Query Frame = 2
Query: 2777 FMFRSQFDLRPTEVKELRDICTFSVSLYIKVW*IAHCAATAPHNDLTFLQALIDYEVVHPAIXXXXXXXXXXHLWYISEELVGLALFDKYLSTVTKRELVSAIKV 3091
            F+FR QF L+  E   +R IC F + LYIK W  A  A+ AP  DL FL++L+DYE +H  IS+S   K+  HLWY++ E V LA FD  L+  TK ++V +IK+
Sbjct:  490 FIFRKQFKLKKNEEDSIRSICIFLIRLYIKAWFCAPIASLAPFQDLQFLKSLVDYENIHKKISQSTLKKLCGHLWYLAPETVALAFFDTNLTIETKIKMVDSIKL 594          

HSP 3 Score: 83.1889 bits (204), Expect = 2.070e-94
Identity = 38/64 (59.38%), Postives = 46/64 (71.88%), Query Frame = 1
Query: 2593 NKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2784
            N +L F   QL+    RDDYRE LEL++IFLG  P RGI F   GAMHHARWMSK +YSLK+++
Sbjct:  428 NVMLLFYMDQLRKPHNRDDYRELLELAVIFLGGTPTRGISFKYPGAMHHARWMSKAIYSLKIFI 491          
BLAST of NADH-quinone oxidoreductase subunit D vs. TrEMBL
Match: A0A151ICQ4 (Uncharacterized protein OS=Cyphomyrmex costatus OX=456900 GN=ALC62_11109 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 5.371e-91
Identity = 146/443 (32.96%), Postives = 219/443 (49.44%), Query Frame = 2
Query: 1295 LTGGKLPSSRQVLGLLLHEHKENGKTIREASTIVIESTAKFWRKGRIPTRAVQHCQANLESEFDVWRLLKKNASRK--------AETEG*ESGI--LF*AG*FI*HRPCRCTQYKDRRRQNFF*LRGKRDGEEVCWGLM*EQRASEARDKLAARRHRAVCDQQQLDAKAXXXXXXXXXXXXXXXXXXXXXXMQGATGGVHMPVRSQRKRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDGKMLRDLTGK-ETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALNECGIADRVRAMSFDTTSSNTGLANGACVL-EQMLGINLLSLACRHHIFELVIGAVYQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDDKDVAAVLMD 2587
            + G  LPS++QVL L   +       +++A         + W    IP+    H    L++ +D W  L+KN   K         E E   + +  +F    FI  R     Q     R+ F       D       +   +    +R+ +  RR  + CD Q        + +   ++S +  ++E           +  P++      +L+V++P + A LDR KVSDR A++++    K+L  ++ D+ L+RSTI R+R   RE I+  L+E  +  V   LVVHWDGK+L D   K + +DRLP+++SG    +LL   KL S TGK Q+E+V   LNE  + DRV+A+ FDTT SNTG   G CVL E+ L   L  L CRHHI ELV+  V+Q Y   +SAP V +F RFQ  W  ID   +  G++D  ++ VL D
Sbjct:   20 IIGNNLPSNKQVLNLFFDKRDRLSLKVKQACNETASDIKRLWDSANIPSLRKDHVVKKLKTLYDKWSALRKNEYHKQKQLKKHNVEKEAFTTALDQVF----FIAQR--NIFQIISEDRKQFLLSHNLSDDVRKMTNVETSENNETSRNTMPCRR--STCDSQ-------ATAISGSNSSESQTTNEIERTYSNFEDSLIPPIKR-----KLDVMTPEVVAALDRGKVSDRNAMHIICALTKALNVNINDVNLSRSTIYRRRIKIREQIANDLKENLQ--VAAFLVVHWDGKLLPDDIFKFKKVDRLPVVISGLDTEQLLGVPKLDSGTGKKQSESVVEMLNEWNVEDRVKALCFDTTPSNTGPDKGTCVLIEKSLKRKLFYLGCRHHILELVLKNVFQIYWPATSAPTVSIFIRFQENWDRIDVTKFKPGINDPKISQVLSD 440          

HSP 2 Score: 88.9669 bits (219), Expect = 5.371e-91
Identity = 37/65 (56.92%), Postives = 52/65 (80.00%), Query Frame = 1
Query: 2590 RNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2784
            ++++L F  + LQI QPRDDY+E LEL+IIFLG++P  GI+F   GA+HHARW+SK +Y LK+Y+
Sbjct:  442 KDEILNFTLNFLQIRQPRDDYKELLELTIIFLGKLPPNGIKFKIPGAVHHARWLSKAIYGLKMYL 506          

HSP 3 Score: 85.1149 bits (209), Expect = 5.371e-91
Identity = 43/103 (41.75%), Postives = 62/103 (60.19%), Query Frame = 2
Query: 2777 FMFRSQFDLRPTEVKELRDICTFSVSLYIKVW*IAHCAATAPHNDLTFLQALIDYEVVHPAIXXXXXXXXXXHLWYISEELVGLALFDKYLSTVTKRELVSAI 3085
            ++FR +F L   EV  L + C F V+ YIK W  A  A  AP+NDL  +Q  I YE ++  I K++  K+A HLWY+SE L G+AL D  +    KR+++ A+
Sbjct:  505 YLFREEFRLTNYEVTALCEFCLFIVTFYIKWWYTAPFAIQAPYNDLMMIQDFITYEAINDKILKASQCKLANHLWYLSENLAGIALMDDRVPNELKRKMIKAM 607          
BLAST of NADH-quinone oxidoreductase subunit D vs. TrEMBL
Match: A0A151IM57 (Uncharacterized protein (Fragment) OS=Cyphomyrmex costatus OX=456900 GN=ALC62_03109 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 5.320e-89
Identity = 100/234 (42.74%), Postives = 155/234 (66.24%), Query Frame = 2
Query: 1895 RLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDGKMLRDLTGKET-IDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALNECGIADRVRAMSFDTTSSNTGLANGACVL-EQMLGINLLSLACRHHIFELVIGAVYQTYM-GPSSAPEVLMFKRFQSCWQFIDQASYSTGMDDKDVAAVLMD 2587
            ++ +V+  +AA LDR  +SDRK  ++++  AK+LG  + D++++RSTI+RQR+  R   S  +++ F+ D    LVVHWDGK+L + +G    +D+L I VSG    KLL    L+ STG+AQA+AV   L +  +  R+ AMSFDTT++NTG  NGACVL E  L  +LL LACRHH++ELV+ ++++  +  P + P V ++KRFQ  W  ID  ++ TG+ + ++A+VL +
Sbjct:    3 KINIVTTNVAAALDRCNISDRKGAFIISACAKALGCTLDDISISRSTIKRQREKARTESSVLIKQNFKPDE--WLVVHWDGKILPETSGTSIHVDKLAITVSGANSDKLLGIISLERSTGEAQADAVIGMLKKWNLESRIIAMSFDTTAANTGPYNGACVLIESQLKSDLLYLACRHHMYELVLRSIFEASIKTPVNGPNVGLYKRFQQSWSNIDTMAFETGISEINIASVLSN 234          

HSP 2 Score: 97.4413 bits (241), Expect = 5.320e-89
Identity = 47/104 (45.19%), Postives = 72/104 (69.23%), Query Frame = 2
Query: 2777 FMFRSQFDLRPTEVKELRDICTFSVSLYIKVW*IAHCAATAPHNDLTFLQALIDYEVVHPAIXXXXXXXXXXHLWYISEELVGLALFDKYLSTVTKRELVSAIK 3088
            +M++SQF L P E+  LRD+C F V L++K W       TAP++DL FL++LI +E ++   +++A  K   HLWY++EELVGLA FD  +S+ TK ++V+A+K
Sbjct:  299 YMYKSQFQLTPQELSGLRDVCIFIVQLFVKAW------FTAPNHDLQFLKSLIRFENINKKAAQAAVKKFTGHLWYLNEELVGLAFFDSTVSSDTKEKMVAALK 396          

HSP 3 Score: 92.0485 bits (227), Expect = 5.320e-89
Identity = 41/67 (61.19%), Postives = 52/67 (77.61%), Query Frame = 1
Query: 2584 GSRNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2784
             S++ ++ F   QL+  QPR+DYREFLEL IIFLG +P+RGI F A GA+H ARWMSK LYSLK+Y+
Sbjct:  234 NSKDDIIAFCIDQLKKTQPREDYREFLELVIIFLGGIPSRGILFRAPGAVHDARWMSKALYSLKIYM 300          
BLAST of NADH-quinone oxidoreductase subunit D vs. Planmine SMEST
Match: SMESG000028508.1 (SMESG000028508.1)

HSP 1 Score: 178.718 bits (452), Expect = 5.308e-118
Identity = 94/104 (90.38%), Postives = 96/104 (92.31%), Query Frame = 2
Query: 2777 FMFRSQFDLRPTEVKELRDICTFSVSLYIKVW*IAHCAATAPHNDLTFLQALIDYEVVHPAIXXXXXXXXXXHLWYISEELVGLALFDKYLSTVTKRELVSAIK 3088
            +MFRSQFDLRPTEVK LRDICTFSVSLYIKVW  A CAAT P NDLTFLQALIDYEVVHPAISK+ASAKMAKHLWYISEELVGLALFDK LST TKRELVSAIK
Sbjct:  903 YMFRSQFDLRPTEVKGLRDICTFSVSLYIKVWFTAPCAATGPRNDLTFLQALIDYEVVHPAISKAASAKMAKHLWYISEELVGLALFDKDLSTTTKRELVSAIK 1006          

HSP 2 Score: 158.303 bits (399), Expect = 5.308e-118
Identity = 76/83 (91.57%), Postives = 77/83 (92.77%), Query Frame = 2
Query: 2342 NTGLANGACVL-EQMLGINLLSLACRHHIFELVIGAVYQTYMGPSSAPEVLMFKRFQSCWQFIDQASYSTGMDDKDVAAVLMD 2587
            N  LANGACVL EQMLGINLLSLACRHHIFELVIGAV+QT MGPSSA EVLMFKRFQSCWQFID ASYSTGMDDKDVAAVLMD
Sbjct:  756 NRSLANGACVLLEQMLGINLLSLACRHHIFELVIGAVFQTCMGPSSAQEVLMFKRFQSCWQFIDPASYSTGMDDKDVAAVLMD 838          

HSP 3 Score: 130.954 bits (328), Expect = 5.308e-118
Identity = 61/66 (92.42%), Postives = 63/66 (95.45%), Query Frame = 1
Query: 2587 SRNKLLEFAESQLQIMQPRDDYREFLELSIIFLGRVPARGIRFIASGAMHHARWMSKVLYSLKVYV 2784
            +RNKLLEFAESQLQIMQPRDDYREFLELSIIFLG VPARGIRFIA GAM HARWMSKVLYSLKVY+
Sbjct:  839 TRNKLLEFAESQLQIMQPRDDYREFLELSIIFLGGVPARGIRFIAPGAMQHARWMSKVLYSLKVYM 904          

HSP 4 Score: 330.487 bits (846), Expect = 7.492e-93
Identity = 208/279 (74.55%), Postives = 219/279 (78.49%), Query Frame = 2
Query: 1238 MNSTRSKTKVYLLESYTEVLTGGKLPSSRQVLGLLLHEHKENGKTIREASTIVIESTAKFWRKGRIPTRAVQHCQANLESEFDVWRLLKKNASRKAETE-G*ESGI------LF*AG*FI*HRPCRCTQYKDRRRQNFF*L-------RGKRDGEEVCWGLM*EQRASEARDKLAARRHRAVCDQQQLDAKAXXXXXXXXXXXXXXXXXXXXXXMQGATGGVHMPVRSQRKRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDVKDLALNRS 2032
            +NSTRSKTKVYLLESYTEVLTG KLPS  QVLGL LHEHKENGKTIR ASTI IESTAKFW+K RIPTRAV HCQA LESEFD WRLLKKNASRKAET+   E+        LF       H+  +  +  DR+    F +       RG   G +V      EQRASEARDKLAARRHRAVCDQQQLDAKAELSELDSHSNSSTSES ESGDEMQG TG VH PVRSQRKRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQD+KDLALNRS
Sbjct:  487 INSTRSKTKVYLLESYTEVLTGRKLPSLLQVLGLFLHEHKENGKTIRVASTIAIESTAKFWQKARIPTRAVHHCQAKLESEFDAWRLLKKNASRKAETQKAKEAAFCSRLDDLFDIAHADAHKNIKIEE--DRK----FLIAQREKGRRGSMLGLDVTLTNK-EQRASEARDKLAARRHRAVCDQQQLDAKAELSELDSHSNSSTSESYESGDEMQGTTGRVHTPVRSQRKRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDMKDLALNRS 758          

HSP 5 Score: 58.151 bits (139), Expect = 2.566e-14
Identity = 29/33 (87.88%), Postives = 30/33 (90.91%), Query Frame = 3
Query: 1530 QKAKKAAFCSRLDDLFDIVHADA-LNIKIEEDR 1625
            QKAK+AAFCSRLDDLFDI HADA  NIKIEEDR
Sbjct:  585 QKAKEAAFCSRLDDLFDIAHADAHKNIKIEEDR 617          

HSP 6 Score: 41.2022 bits (95), Expect = 2.566e-14
Identity = 18/20 (90.00%), Postives = 20/20 (100.00%), Query Frame = 1
Query: 1624 EFLLAQREKGRRGSMLGLDV 1683
            +FL+AQREKGRRGSMLGLDV
Sbjct:  618 KFLIAQREKGRRGSMLGLDV 637          
BLAST of NADH-quinone oxidoreductase subunit D vs. Planmine SMEST
Match: SMESG000014243.1 (SMESG000014243.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.244e-31
Identity = 73/182 (40.11%), Postives = 107/182 (58.79%), Query Frame = 2
Query: 1964 VYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDGKMLRDLTGK--ETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALNEC-GIADRVRAMSFDTTSSNTGLANGAC-VLEQMLGINLLSLACRHHIFELVIGAVYQTYMGPSSAPEVLMF 2497
            +++VA   K++G D+  L+L  S+I R R+  R+ ++   +E F      PL+ H+DGK+L D  G+  E +DR+PI+VSG  I KLL   KL  STG+    AV   L    G+ D +  + FDTT SNTG+  GA  V+++     LL LACRHHI E+V  AV+  +   SS P++ +F
Sbjct:    1 MHIVAPALKAVGVDIDTLSLPTSSIYRARKPVRKSLAQTQKELFVP--TTPLITHFDGKLLPDNDGRTEELVDRMPIVVSGLSIEKLLAIPKLPVSTGELMGNAVVYTLQAWKGVPDWLAGLCFDTTISNTGINIGAINVIQRAFDKRLLFLACRHHILEIVSAAVFDKFFK-SSGPQIALF 179          
BLAST of NADH-quinone oxidoreductase subunit D vs. Planmine SMEST
Match: SMESG000033311.1 (SMESG000033311.1)

HSP 1 Score: 108.227 bits (269), Expect = 4.691e-26
Identity = 68/165 (41.21%), Postives = 95/165 (57.58%), Query Frame = 2
Query: 2069 ISGRLREEFRADVNVPLVVHWDGKMLRDLTGK--ETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALN--ECGIADRVRAMSFDTTSSNTGLANGA-CVLEQMLGINLLSLACRHHIFELVIGAV-YQTYMGPSSAPEVLMFKRFQSCWQFIDQASYS 2545
            +S   +E+F      PL+ H+DGK L D  G+  E +DR+ I+VS   I KLLV  KL  STG+     V   L   +C ++D +    FDTTSSNT +  GA  V+++     LL LACRHHI E+V  AV YQ +   SS P++ +F RF+  W+FID   ++
Sbjct:   36 LSQTQKEQFVP--TTPLIAHFDGKSLPDNDGRTEELVDRMTIVVSALNIEKLLVIPKLPVSTGELMGNTVVHTLQTWKC-VSDWLAGQCFDTTSSNTSINTGAITVIQRAFDKRLLFLACRHHILEIVSAAVSYQFF--ESSGPQIALFGRFKQQWKFIDLTKHA 195          
BLAST of NADH-quinone oxidoreductase subunit D vs. Planmine SMEST
Match: SMESG000000162.1 (SMESG000000162.1)

HSP 1 Score: 107.457 bits (267), Expect = 3.488e-24
Identity = 108/388 (27.84%), Postives = 171/388 (44.07%), Query Frame = 2
Query: 1307 KLPSSRQVLGLLLHEHKENGKTIREASTIVIESTAKFWRKGRIPTRAVQHCQANLESEFDVWRLLKKNASRK--AETEG*ESGILF*AG*F--I*HRPCRCTQYKDRRRQNFF*LRGKRDGEEVCWGLM*EQRASEARDKLAARRHRAVCDQQQLDAKAXXXXXXXXXXXXXXXXX--------XXXXXMQGATGGVHMPVRSQRKRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDGKMLRDLTG--KETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALNEC-GIADRVRAMSFDTTSSNTGLANGA-CVLEQMLGINLLSLACRHH 2422
            +LP++   L  +  E K N  T+    + + +    +W K  IPT A  H  A L+S       + K+  R+  A   G E+      G    I H       +    RQ     RG R        ++  +     R   A  R R    Q+QLD +       + + ++              S +++Q +    H P    R  G    + P     LDRT+ + R+A+ +V     + G DV  L+L+R+T+   R   RE ++  +R+  +    VPLV  +DGK+L ++ G  +E  D +P+ VS  GI KLL   KL + TG    + V   + +  G+ D + A+ FDTT+SNTG+  GA  V++Q     LL LACR +
Sbjct:   42 QLPTNGLALRRIYCEMKTNKATLAATFSTLADEVLSYWAKANIPTTAKPHVVAKLKSLHQDHATVSKHKQRQHSASQIGLETDFTLKMGHLLDIAHAEWEHKTFIPEDRQFLIDQRGPRQ-------MLMTREYLNYRHAAAKYRKR---KQEQLDHQERYKAESTAAAATAVVLTCSDDSDEDSSLNQLQLSQSANHTP----RSTGSTRDLQPPNQPALDRTRTTTRQAMMIVTPALAAAGVDVSQLSLSRATLMETRNTSRETLAATVRQNIQP--AVPLVAQFDGKLLPNIDGGKRELQDCMPVGVSSLGIEKLLGIPKLPAGTGALMGQKVVEFVRDWPGVEDHLAALYFDTTASNTGIHTGAITVVQQAFSRRLLFLACRRY 413          
BLAST of NADH-quinone oxidoreductase subunit D vs. Planmine SMEST
Match: SMESG000018265.1 (SMESG000018265.1)

HSP 1 Score: 103.219 bits (256), Expect = 4.344e-24
Identity = 66/168 (39.29%), Postives = 99/168 (58.93%), Query Frame = 2
Query: 1886 KRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETAKSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDGKMLRDLTGK--ETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*VALNEC-GIADRVRAMSFDTTSSNTGLANGACVLEQ 2380
            KR RL V +P   + LDRTK + R+A+++VA   K++G D+   +L+ S+I R R+  R+ ++   +E F      PL+ H+DGK+L D  G+  + +DR+PI+VSG    KLL   +L  STG+    AV   L    G+ D +  + FDTTSSNTG+  GA  + Q
Sbjct:   67 KRCRL-VDNPLFVSSLDRTKTTAREAMHIVAPALKAVGVDIDTRSLSISSIYRPRKTFRKSLAQTQKELFVP--TTPLIAHFDGKLLPDNDGRTEDLVDRMPIVVSGLNNEKLLAIPRLLVSTGELMGNAVVHTLQAWKGVPDWLAGLCFDTTSSNTGINTGAITVIQ 231          
The following BLAST results are available for this feature:
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2BP859.942e-9648.92Uncharacterized protein OS=Araneus ventricosus OX=... [more]
A0A4Y2HIW31.497e-9555.33RT_RNaseH_2 domain-containing protein OS=Araneus v... [more]
X1X3C52.070e-9446.58Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A151ICQ45.371e-9132.96Uncharacterized protein OS=Cyphomyrmex costatus OX... [more]
A0A151IM575.320e-8942.74Uncharacterized protein (Fragment) OS=Cyphomyrmex ... [more]
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-quinone oxidoreductase subunit D vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028508.15.308e-11890.38SMESG000028508.1[more]
SMESG000014243.11.244e-3140.11SMESG000014243.1[more]
SMESG000033311.14.691e-2641.21SMESG000033311.1[more]
SMESG000000162.13.488e-2427.84SMESG000000162.1[more]
SMESG000018265.14.344e-2439.29SMESG000018265.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017699 ID=SMED30017699|Name=NADH-quinone oxidoreductase subunit D|organism=Schmidtea mediterranea sexual|type=transcript|length=3740bp
CCTATTCAAGACTAAATGTTTCTATTTATTTATGTTATTTATTCGAATTA
TTTATTCTCGTGATTTTATTTACGGCTGATTTCATCTTCTTTATTTTAGC
AATTTGTCTGATTCCGCATTTAACTAAAAAGTTTTACTTCTGAATTCTTT
CAACATATTTCAAAGTTTAAATTGTTGAAGTTTTGATTAACAACGCAATG
ATAGCTATGAGCAATTTCTTTTTCCCGGAACAAAGTTGAGAACCTATTTA
TTTGAATGGGCATTTTATACAGTCAAAATTCAAAAACTAATTTTTATAAA
AACTACGCTTCTAGTTTAAATATAGAAAAGAGCGTATGCGTATTTTATTG
ACAAGTTACGATTTATGACAAATCAAGGGTGTGAAACATTAAAAATTATA
ATTTTGAATTCAATTTTACATTTTTTAAATCAATAGTGGATTGCAAATAA
TACTAATAAAATAAAGTATGGCTATGTACATATGTCACGCTTCATTGTAT
AATTATTATTTATTATATTACTTATAAATATCAGTAGTATATATATATAT
ATATATAGGTAAGGATTACGGGAATTGCCATAAATTACCAGTAACTCAAT
ATAAAACAGGTCGTGTGGAATTTGTCGATTTTATGGCGGATTACTTTATT
TACGCCAATACCTATGGATTAGGGTGGTCCTTATTTTTCAACTTTCAAAA
AGTGCCTGTCTCACCCTTTTATTTTGTTCCTATATATAAGAAAAAAATTT
AGGCCAAATATGAGCTCAATTGAACAACATTTAGAGGTAGCTCAATGAAG
TCAAAGTTTTATAATAGACTGCATTATCAAAAATAGTGAAATACATAACC
CCCACTACTGCTGAGTTTAAAATTTAGCAATAGATTATCATTTAAATCAT
CCCTGATTTTGTTACTTACTACTCAGTGTGTGGGAACCAGCCTTTGGTGT
TCTTGTTCTACTTCAATATTTTGTGCAACTTACTGTCTGGTGAAGTTATA
GGGAATTGTTATTTACGTTTAAGAAAAGCTCTGAATAGTATTTATTACTG
TAATTATTTAAAGGTATGTACTGATTATCTGCTAACTTATTGATTACATT
TTTGTGTAGCTTCTTGTTGAAAATATTGTAATAGTTTTTCTGTTACTGCA
ATAGTGGCAACCTGACTGTGAATTGTAGTTGCAGTTTTACTGGACTTAGT
GGATTGCTAGCAGTAATTAATAAATAATTTCTCACTAATGAACAGTACCA
GGTCTAAGACAAAGGTGTATCTGCTGGAGAGTTATACAGAGGTTTTGACT
GGTGGGAAGTTGCCTTCATCACGGCAGGTACTCGGTCTTTTACTTCATGA
ACACAAAGAGAATGGCAAAACAATACGAGAGGCATCAACGATTGTCATTG
AAAGTACTGCTAAGTTTTGGCGAAAGGGAAGAATACCAACAAGGGCAGTT
CAGCATTGCCAAGCTAACCTAGAGAGTGAATTTGATGTATGGCGTCTACT
AAAGAAAAATGCATCAAGGAAAGCTGAGACAGAAGGCTAAGAAAGCGGCA
TTTTGTTCTAGGCTGGATGATTTATTTGACATCGTCCATGCCGATGCACT
CAATATAAAGATAGAAGAAGACAGAATTTCTTTTAGCTCAGAGGGAAAAG
GGACGGAGAGGAAGTATGCTGGGGCTTGATGTAAGAGCAAAGAGCATCTG
AAGCTAGGGACAAGCTTGCGGCTAGACGGCATCGAGCAGTGTGTGACCAG
CAGCAGTTGGATGCGAAGGCTGAACTCAGTGAACTGGACAGCCACAGCAA
CAGCTCCACATCTGAATCTGACGAATCAGGTGATGAAATGCAGGGTGCTA
CTGGCGGAGTTCACATGCCTGTTCGATCTCAACGCAAGAGAGGGAGGTTG
GAAGTGGTTAGCCCTGGGTTAGCTGCAATGCTGGACAGAACGAAGGTGTC
TGACCGTAAGGCTGTGTACCTAGTGGCAGAAACGGCAAAAAGTCTTGGTC
AAGATGTGAAAGATCTTGCCTTGAACAGGAGTACAATACGTCGACAGCGA
CAAGATCATCGGGAGATGATATCAGGCCGTCTAAGAGAGGAATTCCGAGC
TGATGTTAACGTCCCACTGGTTGTGCATTGGGACGGCAAAATGCTTCGTG
ACCTAACGGGCAAAGAGACCATAGATCGACTACCCATCCTCGTCTCTGGA
AAAGGCATTTCTAAGTTGTTGGTAGCAGCCAAGCTTCAATCGTCAACTGG
AAAAGCACAAGCTGAAGCCGTGTAAGTTGCTCTAAATGAATGCGGGATTG
CCGACCGGGTGAGAGCCATGTCATTTGACACGACGAGTTCCAACACAGGT
CTGGCCAATGGGGCTTGTGTCCTCGAGCAGATGCTTGGCATCAATTTGTT
GTCCCTTGCGTGTCGCCATCACATATTTGAACTTGTTATTGGAGCCGTGT
ATCAGACATACATGGGACCATCATCAGCACCAGAGGTCCTAATGTTCAAG
CGGTTCCAGTCATGCTGGCAGTTCATCGACCAGGCATCATACTCGACTGG
AATGGATGACAAAGATGTTGCAGCTGTCCTGATGGATCACGGAATAAACT
ACTGGAGTTTGCAGAGAGCCAGCTGCAAATAATGCAGCCAAGGGATGATT
ATCGGGAATTTCTGGAACTGTCGATAATTTTCCTCGGAAGAGTCCCAGCA
AGAGGCATTCGTTTCATCGCTTCAGGTGCCATGCACCATGCTCGATGGAT
GAGCAAAGTACTGTACAGTTTGAAGGTTTATGTTTCGATCGCAGTTTGAT
CTCAGACCAACAGAAGTAAAAGAACTGCGAGACATCTGTACTTTCTCGGT
CAGCCTTTACATAAAAGTCTGGTAAATAGCTCATTGTGCTGCAACAGCAC
CGCATAATGATCTCACGTTCCTTCAGGCCCTCATTGATTATGAAGTAGTG
CACCCGGCTATCTCCAAGTCAGCTTCTGCTAAAATGGCCAAACATCTTTG
GTATATCTCGGAGGAACTCGTTGGACTGGCTCTGTTTGACAAGTATCTAT
CAACTGTAACGAAGCGCGAACTTGTCAGTGCTATCAAGGTGATTGCTTGA
TGTTTACTTGACTTATGTCATTTACCATTAATTTCTTGTTTTTGAGTGTT
TGATAGAACTGTTAGCTCTGGTACTAAAAGTAATTTATAATGTTTACCAT
ACTGGAAAATGACGGAGCGGACAAACCGCCAAAACGAATCAACATCGACA
TTCAGTCCGTTCGTGGCAAATCACTTGCTTACTTCATGACCAAGCATTCG
CATGTTCTGTTCGAACGATTGGAACTTCCAGATATTCATGAATCGGACGC
GAATGTGTAAGACAAGTGACAGTGGGGTGCCCGGTGCTGGCTGCCGAATG
CCGATGCTGCATCCTAGCAACAGTGTGATGCTAAAACTTCTCCATTTGTC
TTTGGTTTATCTTATACCAACTCCAATGTCAGTGATATTTGTTGATGGCA
TTAAAAGCGTGACAATTTGCTTCTTTCATTTTTATATAAGAGTTGCGAAA
AACGCACCATTCGTAAAAACTTTGATAATCAATAAAGTTTTAAGTCGTTG
GAATTCGTCAATATCGTTATTAATAGAAAACGGTCGGATTCAGATCCACA
ATTGGTAGTTCATTAATCACCGACAAATAATAGCAACACAACAATACAAA
ACACACAATAAGAAGTGCATAGGAACGTTCGATATGCGGC
back to top

protein sequence of SMED30017699-orf-1

>SMED30017699-orf-1 ID=SMED30017699-orf-1|Name=SMED30017699-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MFCSNDWNFQIFMNRTRMCKTSDSGVPGAGCRMPMLHPSNSVMLKLLHLS
LVYLIPTPMSVIFVDGIKSVTICFFHFYIRVAKNAPFVKTLIINKVLSRW
NSSISLLIENGRIQIHNW*
back to top

protein sequence of SMED30017699-orf-2

>SMED30017699-orf-2 ID=SMED30017699-orf-2|Name=SMED30017699-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MNSTRSKTKVYLLESYTEVLTGGKLPSSRQVLGLLLHEHKENGKTIREAS
TIVIESTAKFWRKGRIPTRAVQHCQANLESEFDVWRLLKKNASRKAETEG
*
back to top

protein sequence of SMED30017699-orf-3

>SMED30017699-orf-3 ID=SMED30017699-orf-3|Name=SMED30017699-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
MQGATGGVHMPVRSQRKRGRLEVVSPGLAAMLDRTKVSDRKAVYLVAETA
KSLGQDVKDLALNRSTIRRQRQDHREMISGRLREEFRADVNVPLVVHWDG
KMLRDLTGKETIDRLPILVSGKGISKLLVAAKLQSSTGKAQAEAV*
back to top

protein sequence of SMED30017699-orf-4

>SMED30017699-orf-4 ID=SMED30017699-orf-4|Name=SMED30017699-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MSFDTTSSNTGLANGACVLEQMLGINLLSLACRHHIFELVIGAVYQTYMG
PSSAPEVLMFKRFQSCWQFIDQASYSTGMDDKDVAAVLMDHGINYWSLQR
ASCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002111X2 cell