TIR domain-containing protein

Overview
NameTIR domain-containing protein
Smed IDSMED30017691
Length (bp)2038
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TIR domain-containing protein (SMED30017691) t-SNE clustered cells

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30017691) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TIR domain-containing protein (SMED30017691) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30017691) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017691

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017691SMESG000047638.1 SmedASXL_015638SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30017691SMESG000047638.1 dd_Smed_v4_6471_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017691SMESG000047638.1 dd_Smed_v6_6471_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017691SMESG000047638.1 dd_Smed_v4_6471_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30017691SMESG000047638.1 dd_Smed_v4_6471_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30017691SMESG000047638.1 dd_Smed_v4_6471_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A210QF19 (Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22612 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 1.755e-93
Identity = 171/564 (30.32%), Postives = 300/564 (53.19%), Query Frame = 2
Query:  191 DNLNHALFQNLSQSYFSMKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIH-INDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGL---LSNINLFMNDTETLIVPKTDVPNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQI 1870
            + L   L ++L  +Y+  + H+K +G+ +    +  V   ++   N  G F  DSIWF  YY LN  WN+ D++  +A ++  +        N  H+P++ NL + NVYY++K+S+SIIHN+ R       F+  +  + ++  +    + + L ++++LTL+ +V+E E   L +   +I   I  I  A+E + +R  GF+  EL++GL  ++ NDN KK IV    + + + +++  S ++       + W L FDKE+ Q ++    +   ++       + ++K   G  ++++ ++   +R +S +         K K  +F+SYSW  K I+L IR+ L    + VWID+++M GSTL AMA+ +EN+ + ++ +SE Y+ SPNCR EAEY F L+K  IPL+++ KY+P  WLG I+G+K Y++FS +  F +   GL   L  I      + T     TD P  A        +  S    S   K T +DV  WL +  L+      + FDG+L+  +  +  ++P+F Y +L+ +  M L+++L F  AL ++
Sbjct:  155 NGLGMKLVKSLGDTYWGYRPHRKKIGDSMAEAGFGEVAMKMLKSLNAKGIFKTDSIWFPAYYTLNTLWNFTDASLRLAKTVAESDGVRFFTVNCSHEPFLTNLDNKNVYYIVKSSMSIIHNIARNPDVIHFFKENKTTDVMLKFVRSYEEHEMLKIMAMLTLSHIVEEEENDKLMDDTGSIEGTIKYIDKAIEDERRRYRGFTPQELMDGLGKLAVNDNNKKKIVEAGALPVFMKMLKSDSAEEQTVTARAI-WTLSFDKEVSQKIVEHPDMMTSLEKLRESSDSDVRKNVNGALFVLKGENDVSRRPRSGK---------KNKGHVFISYSWNEKEIVLKIRERLKAEGVEVWIDIERMGGSTLTAMAEAVENAAVVLLCMSEKYKQSPNCRLEAEYTFQLRKDYIPLMMQKKYRPDGWLGAILGAKLYFDFSGKYPFEKPWNGLQKELRGIGRLSTPSATPGKDVTDGPIMATSACTAASSPGSLSTSSHAHKMTTEDVGNWLCQVKLDGCVPSLAQFDGKLLVQLQRMKVEAPEFYYASLEKKLNMNLVEILTFTEALDKL 708          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A0L8HV44 (TIR domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22006151mg PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 2.587e-86
Identity = 176/609 (28.90%), Postives = 324/609 (53.20%), Query Frame = 2
Query:  113 NFSKKQAVNFIKESIEKISQIQNPLADNLNHA----LFQNLSQSYFSMKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLG--VLWNLCFDKEIKQTLIIDYK-LSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLL-------------SNINLFMNDTETLIVPKTDVPNEANHVEIR-NVNTVSNEIR--SEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQI 1870
             ++  Q ++ I+E + ++ ++++      +H     L + +  +Y+     +K +G+ L    YA V   ++   N +G F ND IWF TYYA N  WN+ D++ ++A S+  +    LL  N  H+PY+  + S NV+Y++KAS+SI+HN+ R    +  F+ ++  E +   I   D  F  ++S++T+A +V+E +   L E   +I  ++  +  A++   +R  GF+ +E+V GL+ ++  D+ K  IV+   + +L  +++    DD  E+C    +LW L FD+ +++ LI D + L  L++  + +    +    +G+ WL+   +   +  K     + K +       +F+SYS  +K  +  IRD L +    +WIDVD M  S L+AMA GIEN+ + ++ +SE Y+ SP+CRTEAEY F L+K  IP++++ KY P  WLG ++G+K +++FS +  F +S  GL+             + ++   + T        +  NE      + +++ + N+I   S I + TN ++  WL  H L      FS FDG+++  + ++  ++P++ Y  ++ +  M L+D L+F  AL  I
Sbjct:   32 GYTLDQVLDSIRELVHELEKLED-----YHHGEAMKLQKKIGDAYWDYYNWRKEIGDLLSSEGYAVVSMKMLKVLNTIGIFKNDEIWFPTYYAYNTMWNFSDASAQLALSLAESDAVRLLTCNCGHKPYLNAIHSKNVHYIIKASLSILHNIARNPSIKHYFKEQKTSEVIQTFISSKDEMF-KVLSMMTMAYIVEEEDNQTLIEETGSILCMLQWLDKALDCNKRRYKGFTPYEIVQGLEKLAVTDSNKLKIVDGGILSMLSRMLQ---FDDVREQCSAARILWTLMFDENVRERLINDEQALVTLLESLKDNKDKLVSANVKGVLWLLNGATQVTEVDKETVRARAKTH-------VFISYSVVDKESVWRIRDRLKEEGYQLWIDVDCMGPSNLQAMASGIENAAVVLICMSEKYKQSPSCRTEAEYTFRLRKDYIPMMMQKKYNPDGWLGTMLGAKLFFDFSGKYPFEKSFGGLIKELRGRGQYSPGDAQVDGAEDQTNKAGTSTENSGNEQQSPSKKISIDHLVNDIGALSPIVEMTNDEIASWLHYHKLAEYSEAFSQFDGKMLFQLSEMKKEAPEYFYQCMEKKMNMSLVDTLRFTAALASI 624          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A2C9JLY3 (TIR domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106059484 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 5.063e-85
Identity = 178/572 (31.12%), Postives = 294/572 (51.40%), Query Frame = 2
Query:  233 YFSMKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTK-RINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEK--PSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENK---SHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTE-AEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNI-----NLFMNDTETLIVPKTDVPNEANHV-------------EIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQIN 1873
            Y+     ++ +GN L  + YA +   ++ + N +G F ND IWF TYY  N  WNY D+++++A  +  T    L+  N+ H+PY+ N+ S NVYYV+KAS+S +HN+ R  G +  F++ +  EG                S  +   LV     H+ +  KN +N     I  A+E+K K R  GF+ WEL  GL  ++ ND+ K  I+ E  +     ++    P       +C   LW L FDK ++QT++    L   ++  ++  ++ +K   +G  W+I+ +   + S  R  S  A          K  IF+SYSWA K ++  I + LL     +W+D +QM GSTL+AMAD +EN+ + ++ +SE Y+ SPNCRTE +++ F   KP I    + KY+P  WLG I+G+K +++F+ +  + + + GLL  +        +   +   V + D   EANHV                N +    +I +     +N+ VE WL+   L+ L   FS  DG LI  +  +  ++P++ + +L+ ++GM LID+L+FN AL  ++
Sbjct:  113 YWDYPAEREDIGNFLADLGYAEITITMLRQMNSLGIFKNDDIWFPTYYTYNTCWNYSDASEKLARYLAETGAVKLMTMNLGHKPYLDNMHSKNVYYVLKASLSTLHNIARCTGVKHHFKDIKTAEG----------------SYWSQNVLVTS---HVSDTIKNIVNW----IHKALENKQKRRYRGFTPWELTQGLSKLAVNDSNKAKIIEEGALSDFTQMLRHTDPREQSSAAEC---LWTLAFDKTVRQTIVESPDLVPALEELKNSENSLVKNNVQGALWMIKGENDPAASVSRPNSGNAI---------KNHIFISYSWAEKEMVKKIHNSLLSEGYKIWVDYEQMGGSTLQAMADAVENAAVVLICMSEKYKQSPNCRTENSKFVF---KP-IQKNGKKKYRPDGWLGAILGAKLFFDFTGKYPYEKPLQGLLKELRGRGKTAQIQGNKNPSVDEIDSNIEANHVTGSSSGRKNVLSSPTSNPHNQITQISASCVTMSNEHVEHWLVSKGLQRLTSAFSQIDGELIWQLKAMRERAPEYFHTSLERQFGMTLIDILRFNAALDSLH 645          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A2G8LPG8 (SAM domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_00875 PE=4 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 3.750e-81
Identity = 177/574 (30.84%), Postives = 310/574 (54.01%), Query Frame = 2
Query:  209 LFQNLSQSYFSMKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDI---EKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIEN-----------KSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKTDVPNEANHVEIRNVNTVSNEIRSEISK-----WTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMK-LIDVLKFNLALQQI 1870
            + + ++  ++     + ++ + + R+  A ++  V+   +  G F  +++W+   Y  N  WN  D + E+A S+ +  +  L  +NV H+PY+ +L+  NV +++KAS+SI+HN+ ++      F+  +L + L+      D  +L  + +L LA +V E++  LL+E K TI  LI  ++ A ES+ +R  G S  EL NGL  ++ ND  K  I + NG+   ++++      +DI   E     LW+L FD  I + L  + K    ++  +S  +  ++   +G  W++              S  + R KS++   L+      +  + +SY W+++ ++L IRD L+ +   VW+DVD+M GSTL+AMA+ +E +   ++ +SE Y++SPNCRTEAEYA+ L+K IIPL++++ Y+P  WLG+I+G+K Y +FS    F ESV  L   ++      ET   P +    E    +I    T S E+  + S      W  +DV+ WL++HNLE  +  F    G+L++ M  L  ++P+F + +LK + G+    D+L+F  ALQ I
Sbjct:  188 ILKGIANHHWQHPQFRGSIASAVDRVQGADILLTVLKSLSKEGLFKRNNVWYPANYCYNVVWNLSDESSELAASLGDCGIIGLCATNVAHKPYIDHLEKKNVMFLIKASLSILHNLSKIPANRRQFRENDLVQKLLPFT-TTDHKYLKALCMLILANIVDEDQESLLDE-KGTIEFLIKLLKEAQESEDRRAQGLSCTELANGLGRLAVNDTNKLKIQSANGLPPFINMLNS----EDILEQEAATEALWSLSFDPSICKLLSTNEKALSSLRHLQSCGNKAVELSAKGTMWMLRQVRKSIEDEGSVDSKKRGRPKSSRQSSLR------RIHVMISYQWSSQKMVLKIRDVLVAAGYIVWVDVDRMCGSTLQAMAEAVEKAAAVIICMSEGYKMSPNCRTEAEYAYQLQKWIIPLMMDMYYEPDGWLGLILGAKYYMDFSGIVPFEESVQKLTRELDSSKGSFET---PDSVFVEENVEPDI----TKSCELSCQASPPGTMNWRAEDVQSWLMEHNLEKYQDSFQECTGKLLHQMKALRQEAPEFFFRSLKEDLGISNFFDILRFTEALQDI 742          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: W4XMC6 (TIR domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.681e-78
Identity = 154/480 (32.08%), Postives = 268/480 (55.83%), Query Frame = 2
Query:  482 PYVQNLKSTNVYYVMK------------ASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLL-EEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQA-FKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKTDVPNEA-NHVEIR-NVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGM-KLIDVLKFNLALQQI 1870
            PY++ +    + Y+++             S++I+HN+ +  G + +++ +++ E +   +      +L  VS++TLA +V+E +  +L E+G NTI  L+  ++ A  SK KR  G S+ E+   L  ++ +DN K  IV   G+ L++ ++   S +   E     +WNL F  ++ + L  +    + ++   +  S+++ K   G  W+I  +   K  +K  +    L  +  + +  I LSY W  +P++L +RD L K+  N+W+DVD M GSTL+AMA+ IEN+   VM +SE Y+ SPNCRTEAEYAF L+K IIP+++E  Y+P  WLG+I+G+K Y +FS R +  E +  LL  +   M+  E  I+ K D  +       I   + +    I+ E   W+   V+ WLI++ LEHL+   + ++G+L+N +  +  ++PDF Y ++K ++G+ KLID+L+F  AL  +
Sbjct:    9 PYLKAVSMMTLAYIVEEGQEEILAEKGTTSLNILHNLAKAPGNKHVYREEKVVESMEPFLE--GDPYLKAVSMMTLAYIVEEGQEEILAEKGTNTIEYLVEILKDAQNSKDKRCQGLSVEEVTAALGRLAVHDNNKYKIVEAGGLPLMISMLHDESVETQ-EASAHAVWNLAFSDDVSEKLRSNTDCMMALQDLSTSSSSEVAKAANGALWVINKEGEKKDLVKENEDDTGLGHSLSRKQPHIMLSYQWGCQPLVLKMRDVLAKAGYNIWVDVDCMYGSTLQAMAEAIENACAIVMCMSERYKESPNCRTEAEYAFQLRKRIIPVMMEEYYQPDGWLGIILGAKFYMDFSGRLDIEEEMNKLLKEVQ--MHSAEAKIIYKDDTDDGVLVGASISFPLESAGISIKMESLDWSASQVQDWLIENELEHLRPLMAEYNGKLLNQLYKMRQEAPDFFYLSIKEDFGLKKLIDILRFTEALDSL 483          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO45030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU69])

HSP 1 Score: 211.846 bits (538), Expect = 1.082e-58
Identity = 143/478 (29.92%), Postives = 243/478 (50.84%), Query Frame = 2
Query:  440 TKLPNLLISNVLHQ-PYVQNLK-STNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENK-SHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNF--NESVIGLLSNINLFMNDTETLIVPKTDVPNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLE--HLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMK-LIDVLKF 1849
            +KL +   S V +Q P  Q LK  T    ++  ++  +HN+ R       F+  +  + L+ +++   S F    ++L LA L  E+   L+   +  I  LI  +  +  S + R  GF+  EL  GL  ++ ND+ KK I     I +L+D++     D+        LW L FD E K+ ++       L+K  +      +KK   G+ W IE K SH+          K     +  +  + +SY W  +P ++ ++ +L  +   VW+D++QM GSTL+AMA+ +EN+ + +M +S+ Y+ SPNCR+EAEYAF L+K I+PL++E  Y+P  WLGMIMG+K + +FSD++    ++S   L   I +       ++        E+  V +++ + V    + +ISKW+  DV  W+    L   +     S   G+L+  +  L S+SP+F Y ++K ++G   L +VL F
Sbjct:  363 SKLRDCTASMVKYQNPETQALKCKTQRGKILNTAMGTMHNLSRRIPCRQYFKKADTVKVLLPMLNDEVSQFAA-KALLILAYLTDESNNSLIMASEEPIQFLIHILSKSCSSNSNRYLGFTNSELAEGLSQIAVNDSNKKLIGQHGAIPILVDMLANAKNDEQRRCGAEALWVLAFDNENKEAILTTPNAVELLKELQHSEDDSVKKAAAGVLWEIEGKESHT---------VKESTADEPLRNHVMISYQWDVQPTMIQVKSKLQAAGYRVWMDLEQMGGSTLQAMANAVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEKSYRPDGWLGMIMGAKLWIDFSDKQTLRVDDSFEKLQKEIGMRGRGRGNVV--------ESKLVAVQH-DVVDVFPKIDISKWSKDDVMNWMNGFGLRLGNDSTIASHLSGKLLQRLAKLRSESPEFFYSSVKQDFGFAHLQEVLLF 821          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO41008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P1])

HSP 1 Score: 205.297 bits (521), Expect = 1.228e-55
Identity = 152/543 (27.99%), Postives = 257/543 (47.33%), Query Frame = 2
Query:  344 NNDSIWFSTYY---ALNGFWNYCDSNQE----IANSILNTKLPNLLISNVLHQPYVQNLKST----NVYYVMKAS---------------ISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKTDVPNEANHV-------EIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMK-LIDVLKFNLALQQI 1870
            +ND    + Y+    L+GF+   D   E    +   +L+   P LL+       Y++ LK T    + Y   K                 +  +HN+ R    +  F+     + L+  +    + F+ + ++L LA LV E    L+   +  I  L+  + SA+    ++  GF+ WE+  G+  V++ND  K+ I   +G+ +L  ++++   D +    L  L+ L FD E K+ L  D     L++  +     +++K   GI W IE K    +   S Q              I +SY W N+  +LA+   L ++   VW+DV+QM GSTLEAMA  +EN+ + ++A+S+ Y+ SPNCR+EAEYAF  +K I+PL++E  Y+P  WLGMI+G+K + +F  R + +  ++ L+  +    N T  L  P   V  +   V       E           R ++SKW  +DV KWL    L          DG ++  +  L  +SP+F Y ++K +     +I+VL+F   L+++
Sbjct:  734 DNDIAASAVYWRADELSGFYRKLDETNEDYQIVIQFLLDVDAPKLLVD------YIRILKQTFPDASTYDREKPGGKDDFSRRGELLSHVLGALHNLSRRPAVKRFFEESNGVKHLLLFMKCGVTYFV-MNALLCLAYLVDERNNDLIMADEEPITFLLRMLSSAISDSRRQHLGFAAWEIACGIGRVASNDKNKRLIGRHDGVSILSTLVKEAKNDAERVYGLQALYMLSFDGENKKILCKDKATVNLLRNLKQSGHKEVQKAAVGILWEIEGKVGRDRNEDSQQ-------------HIMISYQWDNQKAMLAVNKRLKEAGHKVWMDVEQMGGSTLEAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQDYRPDGWLGMILGAKLWMDF--RESVDTGIVHLMKELQY--NQTAALQQPHDPVTVDTTTVISSPPDKEDGPPGPTDVVDRPDVSKWKKEDVAKWLSDIGLSSSNKVRKKLDGSMLILLYRLKQESPEFYYASVKKDMDFPTVIEVLQFTEELRKL 1252          

HSP 2 Score: 140.584 bits (353), Expect = 1.586e-34
Identity = 60/125 (48.00%), Postives = 89/125 (71.20%), Query Frame = 2
Query: 1166 IFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNIN 1540
            + LSY W  + ++L +RDEL  +   VWIDV+QM+GSTLEAMA  +EN+   +M +S AY+ SPNCR+EAEY+F L+K IIPL++E +YKP  WLG+I+G+K + +F  +   + +V GL+  + 
Sbjct:  555 VMLSYQWGYQDVVLKVRDELRAAGYKVWIDVEQMEGSTLEAMASAVENAAAVLMCVSRAYKESPNCRSEAEYSFQLRKDIIPLMMEPQYKPDGWLGIIVGAKLWMDFRSKDATSSAVQGLIKELG 679          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG5])

HSP 1 Score: 97.8265 bits (242), Expect = 7.940e-25
Identity = 44/75 (58.67%), Postives = 57/75 (76.00%), Query Frame = 2
Query: 1265 MKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFS 1489
            M GSTLEAMA+ +ENS + +M  S  Y+ S N R+EAEYA++ KKPI+PL++E  YKP  WLGMIMGSK Y+ F+
Sbjct:    1 MGGSTLEAMANAVENSAVVLMCASRKYKDSVNYRSEAEYAYTQKKPIVPLMMENGYKPDGWLGMIMGSKLYFNFA 75          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO39316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI7])

HSP 1 Score: 72.7886 bits (177), Expect = 5.459e-14
Identity = 56/217 (25.81%), Postives = 95/217 (43.78%), Query Frame = 2
Query: 1166 IFLSYSWANKPIILAIRDELLKSKINVWIDV-DQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKP----IIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKTDVPNEANHVEIRNVNTVSNEIRSEISK-WTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLY 1798
            + LSY W  + ++  + D L    I VW+D+   ++G    +MA G++ + I    +S  Y  S NC+ E  YA          I+P++ E  +K   WLG+I     + +F D  NF  SV  L   I   + D+  + +     P+E      ++V   + E++    + + +K   K+L     E  ++KF    G    S +DL     D  Y
Sbjct:    4 VMLSYQWDIQDLVKKVYDGLRAYGIRVWMDIHGGIRGDINGSMAKGVDGAAILCCFMSTKYSESKNCKKELSYADGKTGCEEVIIVPVMCEKGFKAKGWLGIITAGLLWIDFRDEANFENSVKSLAQEIMHAVGDSSDITL----APDEKQEAASKSVVKPTAEVKKNPGRAFRHKIAGKFL----AETGQVKFHPASGN--RSTLDLRDTPEDTSY 210          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST59])

HSP 1 Score: 68.5514 bits (166), Expect = 4.573e-12
Identity = 39/117 (33.33%), Postives = 61/117 (52.14%), Query Frame = 2
Query: 1157 KFDIFLSYSWANKPIILAIRDELLKSKINVWIDV-DQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNF 1504
            KFDI LSY+W  +  +  +  EL +     W+D+   M+G+  EAMA  +ENS + V  ++E Y+ S NC  E +YA   +KPII +  E       W+  ++     +E S   +F
Sbjct:  410 KFDIMLSYNWGIQSFVREVYMELSQQTFQTWMDIWGGMQGNINEAMATAVENSTMLVAFLTEKYQQSVNCNLELKYATMKEKPIIFIKAEKDLVLKDWIQQLVDKSVVFEMSSSGDF 526          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000047638.1 (SMESG000047638.1)

HSP 1 Score: 1104.35 bits (2855), Expect = 0.000e+0
Identity = 542/544 (99.63%), Postives = 543/544 (99.82%), Query Frame = 2
Query:  242 MKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKTDVPNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQIN 1873
            MKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYR SPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTET+IVPKTDVPNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQIN
Sbjct:    1 MKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRTSPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETIIVPKTDVPNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQIN 544          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000015387.1 (SMESG000015387.1)

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 339/593 (57.17%), Postives = 462/593 (77.91%), Query Frame = 2
Query:   92 DIPAYDTNFSKKQAVNFIKESIEKISQIQNPLADNLNHALFQNLSQSYFSMKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKTDVPNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQI 1870
            ++P Y+ +F++ QAV+++K+++EK+ ++Q+ L  N+ + +F+ +SQSYF +K+H  A+ N LL + Y S+ ++ + KF+  G+F ND +WF+TYYALN  WNYCD  QEIAN I+ T LP  LI+N+LH+PY+ N+K+TN++Y++KASISIIHN+VR  G E  FQ  ELK  LVGLI  NDSDF+ L+S+LTL+CLV E+ELHLL+EGKN+I  LI++IR+A E+ +K++NGF+IWELVNGLKCVSANDN+KK+IV ENGI+L+ DI++ P+CD+DIEKCLGVLWNLCFDK+IK  L+ D+ L L I  F++H  + IK+C+ GI WLI+ K  SK+R+ SA   K+KA+K  WKFD+F+SY WANK ++L+IRD L++S I +WID+DQMKGSTLEAMADGIENS+IF+MAISEAYR SPNCRTEAEYAFSL KPIIPLIVE+KYKP SWLG+IMGSK YYEFS RRNF ES+  LL+N+N  + + E  IV +  VP   N    ++ +  + +I S +  W+NK VEKWL+K+ L H+K +F +FDG+L+ S++D+ +KS  +L   LK EYGMK ID+LK + A+ +I
Sbjct:    5 EVPDYEKSFTEPQAVDYMKKALEKLKELQDSLNFNIIYKIFKGISQSYFDLKSHLNALSNVLLNLKYVSITSNYVGKFSKEGYFVNDDVWFATYYALNSLWNYCDGFQEIANEIVVTDLPQYLIANLLHRPYLDNMKNTNIFYLIKASISIIHNIVRCPGNEEKFQIIELKNVLVGLIKRNDSDFIVLISMLTLSCLVNESELHLLDEGKNSIKALIMKIRTAFENDSKKVNGFAIWELVNGLKCVSANDNVKKTIVTENGIKLIFDILKNPTCDNDIEKCLGVLWNLCFDKDIKAILVNDFDLKLFINRFKNHKLSTIKRCYNGILWLIDEKIQSKERILSAHLSKVKASKTHWKFDVFISYCWANKQMVLSIRDFLVQSNIKIWIDLDQMKGSTLEAMADGIENSNIFIMAISEAYRTSPNCRTEAEYAFSLNKPIIPLIVEMKYKPTSWLGIIMGSKMYYEFSKRRNFEESIHSLLANVNTIIQNVERKIVTEIIVPVAQNE-SYQSSDGGTPKILS-VHSWSNKIVEKWLVKNGLGHVKSRFMNFDGKLLFSLIDVKNKSRKYLIDALKVEYGMKFIDLLKLHSAINEI 595          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000065938.1 (SMESG000065938.1)

HSP 1 Score: 391.734 bits (1005), Expect = 2.556e-128
Identity = 227/537 (42.27%), Postives = 336/537 (62.57%), Query Frame = 2
Query:  269 NELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYALNGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPS-CDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKTDVPNEANHVEIRNVNTVSNE-IRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQIN 1873
            N L ++NY S I  V C  ND+               L+   N  DSN++   S+  + L +LLISN++  P+         +  +K S+ I+HN+ R        Q+ +LK  +  +I  +  + + LVS++ LA LVKEN+LHLLE+G+N++  +I  I  A  +K KR  GFS+WELV  LK +S NDNMKK+IV E G+++++ I+   S C+  +E  LG++WNLCFD+ I+  L+ D+ LS  ++  ++H S KI+K    I W IE+KS   ++LK+  A          KF++FLSY+WANK I+ +I + L+KS I VWID  QMK S LE MA+GIENS IFVMA+S++YRISPNCR EAEYA+SLKK IIP+I+ELKYKP  WLG+I G+K Y+EFS+RR+FN ++  LL ++   + +        TDV ++     I  +   S E +  ++  W+ +DVE+WL+++ L  +K KFSS +GRL+ SM+ L +KSP ++  NL  E+GM  I+++KFN A+  +N
Sbjct:   64 NHLKQINYFSTIDTVSC-CNDI---------------LSCVCNLTDSNEKFVISVAQSPLLSLLISNIIDIPHETASTDRFHFQFLKLSLCIVHNIKRFPICRRKIQSNKLKTVICEIIESDLCEPVRLVSMMILASLVKENDLHLLEKGQNSLKTIIELINKAYLNKNKRYLGFSVWELVLALKNISVNDNMKKNIVEEKGVEIIICILNDSSFCEKSVENSLGIIWNLCFDENIRIMLMNDFNLSDTLEKLKTHESPKIRKLATSIIWSIESKS---KKLKNNNA-------ATEKFNVFLSYAWANKTIVSSIYEHLVKSDIKVWIDEKQMKRSILEDMAEGIENSTIFVMAMSDSYRISPNCRLEAEYAYSLKKTIIPIILELKYKPKGWLGIISGNKMYHEFSERRDFNVTLTKLLEDVKCKLKN------ENTDVEDKIEFKSIALLTEFSKESVHFDMKLWSFQDVERWLVENELGRIKSKFSSINGRLLFSMIKLMNKSPKYVCQNLFKEFGMNFIEIIKFNAAIIDLN 568          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000035607.1 (SMESG000035607.1)

HSP 1 Score: 322.013 bits (824), Expect = 1.132e-101
Identity = 192/525 (36.57%), Postives = 303/525 (57.71%), Query Frame = 2
Query:  374 YALNGFWNYCDSNQEIANSILNTKLPNLLISNV----LHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDD-IEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKT----------DVPNEANHVEIRNVNTV----------SNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQIN 1873
            Y L    N+ + ++ +A  I ++++   +I       L  P  +  KS+ ++   K  ++IIHN  R       ++  ++K+    +I ++  D+ G++S+L L+ ++   E+ +L +G+N ++ L+ +I+    S TKRI GF++ EL++GL+ ++AND MKK I +E GI++L+++I+    D D IE  LGV+ +LCFD EIK  LI   K+  LIKP+    S KIK+ ++GI W ++ KS             LK   D  KFD+F+SY WANK  I  I + L   KI  WID +QM GS++EAMA GIENS +F++ +S +Y+ S NCR EAEYAF +KKPIIPLI+E+KYKP  WLG ++G+K Y+EFSDRRN NE V GL+  IN  ++  +  +  K+          D+PN  +  +  + N V           ++   +I  WTN+DV KWL K  +   K  F    G  + +M ++  K P  +  +LK  + M +I+++KF  AL+ ++
Sbjct:   46 YILTFLVNFSEHSEIMACEIGSSEILKYVIDKYFGMNLSDP--EECKSSRIF---KLYVTIIHNFFRYPHNRSEYKIDDIKQSFFKMIQLDSDDYFGIISMLILSYVIDGKEVDMLIKGQNILHNLLQKIKFTSTS-TKRIEGFNLQELMHGLRFIAANDTMKKRIYDE-GIEILINVIKFHKDDKDVIESTLGVIEHLCFDNEIKLKLINSCKIKNLIKPYAKCKSVKIKEIYDGILWELDKKS-----------VDLKTKSDNMKFDVFISYCWANKEQIEEILESLKIHKIRAWIDKEQMSGSSIEAMAKGIENSAVFIIGVSSSYKKSCNCRHEAEYAFRIKKPIIPLIMEMKYKPTEWLGFLLGNKIYFEFSDRRNPNEEVKGLIVEINRNLHPIDNEVQSKSNSVKNTQKSHDLPNSNSETKNEDCNKVISKSNFPVPSDSDTLGKIKMWTNEDVLKWLDKIQMSGFKTHFKDLSGSHLLTMQEICLKDPSLIRDDLKKTFNMNIIEIVKFETALKNLS 552          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000035587.1 (SMESG000035587.1)

HSP 1 Score: 308.916 bits (790), Expect = 2.886e-96
Identity = 194/495 (39.19%), Postives = 292/495 (58.99%), Query Frame = 2
Query:  395 NYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKASISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACLVKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVSANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQTLIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFKLKANKDKWK--FDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTLEAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKYKPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKTDV-PNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFSSFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQI 1870
            N+ + + E A  + ++   N +I   L Q    N+K+       K+ I+IIHN       +  ++  E+K+  + ++++N  D+ GL+S++TL+ L+ ENE++L +  +N +  LI +I+   E+K  R  GF+I EL++GL+ +SAND +K  I  ENGIQ+L+DI+   + ++ IE  L V+  LCF+ +IK  LI  YK+   +  F +H +AKI + + GI W+++NK  S            K N +K    FD F+SYSWANK  +L I   L    +NVWID ++M  STLEAMA GIENS + V+A S AY+ S NCR EAEYA  +KKPIIPL++E KYKP +WLG++ G+K Y EFSDRRN NE V  L+ NI   +N    L   K D+   E N    R    + +E+++    W+ ++V  WL K  + +LK KF   DG +I  M+D+   S D+    LK+E+ M  I+V+KF+ AL  +
Sbjct:  111 NFSEHDYEFAGMLESSNTINYIIDKYL-QFDSSNIKNCKENKNFKSLITIIHNFASHKLDKINYRVDEIKKTFLNIVNLNCDDYYGLISLVTLSYLIDENEINLFDGHENIVKELIKKIKLINENKL-RSEGFTIKELIHGLRRLSANDEIKTIIDTENGIQVLIDILNSTNNENVIEPTLDVIKQLCFNNDIKIKLINHYKIGETLTKFSNHSNAKICQHYNGILWILDNKLESLP----------KGNTEKTAIVFDAFMSYSWANKDKVLEICSILKSYNVNVWIDQEEMISSTLEAMATGIENSKVVVIAASTAYKNSSNCRLEAEYAQKIKKPIIPLVMEHKYKPSNWLGILFGTKVYIEFSDRRNANEQVQQLIKNIKFHLNRPVKL-AEKIDLNAGEKNRSNSRTRIVLVDEVKN----WSCENVGDWLDKFGIGYLKEKFIGVDGSMIEVMLDIRINSGDYFNNCLKNEFKMNFIEVVKFHKALNDL 588          
The following BLAST results are available for this feature:
BLAST of TIR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QF191.755e-9330.32Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6... [more]
A0A0L8HV442.587e-8628.90TIR domain-containing protein OS=Octopus bimaculoi... [more]
A0A2C9JLY35.063e-8531.12TIR domain-containing protein OS=Biomphalaria glab... [more]
A0A2G8LPG83.750e-8130.84SAM domain-containing protein OS=Stichopus japonic... [more]
W4XMC61.681e-7832.08TIR domain-containing protein OS=Strongylocentrotu... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450301.082e-5829.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410081.228e-5527.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337207.940e-2558.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393165.459e-1425.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331054.573e-1233.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047638.10.000e+099.63SMESG000047638.1[more]
SMESG000015387.10.000e+057.17SMESG000015387.1[more]
SMESG000065938.12.556e-12842.27SMESG000065938.1[more]
SMESG000035607.11.132e-10136.57SMESG000035607.1[more]
SMESG000035587.12.886e-9639.19SMESG000035587.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017691 ID=SMED30017691|Name=TIR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2038bp
CTCAAGCATTCGCAACTTCAACCTTGACTTTAAATAAAATCAAGAAAAAG
TGATTTTTGGTTATTTGATTTACGATATTATTATGGCTACAGATATACCA
GCTTATGACACAAACTTTTCAAAAAAACAAGCTGTGAATTTTATAAAAGA
ATCAATTGAAAAAATAAGTCAAATACAAAACCCTTTAGCTGATAACCTAA
ATCATGCCCTTTTTCAAAATCTATCCCAATCATATTTTAGTATGAAAACT
CATCAAAAAGCTATGGGAAACGAACTATTGAGAATGAATTACGCAAGCGT
TATAGCCGATGTAATCTGTAAATTTAACGATGTGGGGTTTTTCAACAACG
ATTCTATTTGGTTTTCTACGTATTATGCATTGAATGGGTTCTGGAACTAT
TGCGACAGCAATCAAGAAATAGCCAACAGTATCCTCAATACAAAACTGCC
AAATTTGCTGATCTCAAACGTTCTCCATCAGCCATATGTGCAGAATTTGA
AAAGCACAAATGTTTACTATGTTATGAAAGCCTCTATAAGCATTATCCAC
AATGTGGTTCGAGTAGCGGGCTATGAAGGAATCTTCCAAAATAAAGAGCT
GAAAGAAGGATTGGTTGGATTAATTCACATAAATGATTCTGATTTCTTGG
GTCTAGTGTCAATCTTGACGCTTGCTTGTTTGGTAAAAGAAAATGAATTG
CATTTACTGGAAGAAGGAAAGAATACTATTAATTTGCTAATAGTTCAGAT
CCGAAGTGCCATGGAAAGTAAAACTAAACGCATTAACGGATTTTCTATTT
GGGAATTGGTCAACGGACTGAAATGCGTTTCAGCCAACGACAACATGAAA
AAGTCTATTGTCAATGAAAATGGCATTCAATTATTACTTGATATAATTGA
AAAACCGAGTTGCGACGATGACATTGAAAAGTGTCTTGGAGTTCTTTGGA
ATCTCTGTTTTGATAAAGAAATCAAGCAGACTTTGATTATTGACTATAAG
TTAAGTTTATTGATTAAACCTTTTGAAAGTCATCCTTCGGCAAAAATAAA
AAAATGCTTCGAAGGAATATCGTGGCTTATTGAAAATAAAAGCCATTCCA
AGCAAAGACTTAAGTCTGCTCAAGCATTCAAATTGAAAGCAAATAAAGAC
AAATGGAAATTTGATATATTTTTGAGTTATTCTTGGGCGAATAAGCCGAT
CATTTTAGCGATTCGCGATGAATTATTGAAATCTAAAATTAATGTCTGGA
TCGATGTCGACCAAATGAAGGGTTCCACCCTTGAAGCGATGGCAGACGGC
ATAGAGAATTCTCATATCTTTGTAATGGCGATATCGGAAGCATATCGTAT
AAGCCCTAATTGCCGCACTGAAGCGGAATATGCCTTTTCTCTAAAAAAGC
CAATTATTCCTTTAATTGTAGAATTAAAATACAAACCAATGAGTTGGCTG
GGAATGATAATGGGCAGCAAGACTTATTACGAATTCAGTGACCGGAGAAA
CTTCAACGAGTCTGTTATTGGACTTTTAAGTAACATAAACCTTTTTATGA
ATGACACGGAAACTTTAATAGTTCCAAAAACTGATGTTCCTAACGAAGCA
AATCATGTGGAGATTCGAAACGTTAACACCGTTTCAAATGAAATTCGTTC
TGAAATTAGCAAATGGACAAATAAAGACGTTGAAAAATGGCTGATAAAAC
ATAACTTAGAACATCTTAAAATTAAATTCTCCTCGTTTGATGGCCGATTG
ATTAATTCTATGGTAGATTTAAATTCGAAATCTCCAGACTTTCTTTATGG
AAATTTGAAAAGTGAATATGGGATGAAATTGATTGATGTACTTAAATTTA
ACCTAGCACTTCAGCAGATCAATTAGCACCCAAAGGTGCTTCCTGCTTGA
TCTTGTAGATTTAACACTTTTGCCTAGATCTTGTCGATTAGATTTATTTT
AGATTTCTTTGTTGAAACTCACTTTAGAGCATTCATTTCAAATTCTTTTA
AGTCATCACAAACATTTTTGTCAAGATTTCTAATATAT
back to top

protein sequence of SMED30017691-orf-1

>SMED30017691-orf-1 ID=SMED30017691-orf-1|Name=SMED30017691-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=598bp
MATDIPAYDTNFSKKQAVNFIKESIEKISQIQNPLADNLNHALFQNLSQS
YFSMKTHQKAMGNELLRMNYASVIADVICKFNDVGFFNNDSIWFSTYYAL
NGFWNYCDSNQEIANSILNTKLPNLLISNVLHQPYVQNLKSTNVYYVMKA
SISIIHNVVRVAGYEGIFQNKELKEGLVGLIHINDSDFLGLVSILTLACL
VKENELHLLEEGKNTINLLIVQIRSAMESKTKRINGFSIWELVNGLKCVS
ANDNMKKSIVNENGIQLLLDIIEKPSCDDDIEKCLGVLWNLCFDKEIKQT
LIIDYKLSLLIKPFESHPSAKIKKCFEGISWLIENKSHSKQRLKSAQAFK
LKANKDKWKFDIFLSYSWANKPIILAIRDELLKSKINVWIDVDQMKGSTL
EAMADGIENSHIFVMAISEAYRISPNCRTEAEYAFSLKKPIIPLIVELKY
KPMSWLGMIMGSKTYYEFSDRRNFNESVIGLLSNINLFMNDTETLIVPKT
DVPNEANHVEIRNVNTVSNEIRSEISKWTNKDVEKWLIKHNLEHLKIKFS
SFDGRLINSMVDLNSKSPDFLYGNLKSEYGMKLIDVLKFNLALQQIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR000157TIR_dom
IPR011989ARM-like
IPR013761SAM/pointed_sf
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000157Toll/interleukin-1 receptor homology (TIR) domainSMARTSM00255till_3coord: 359..492
e-value: 6.5E-4
score: 22.6
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPFAMPF13676TIR_2coord: 362..474
e-value: 1.6E-20
score: 73.9
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 358..483
e-value: 3.2E-17
score: 64.7
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 356..477
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 238..351
e-value: 8.4E-8
score: 34.1
NoneNo IPR availablePANTHERPTHR46270FAMILY NOT NAMEDcoord: 9..595
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 90..339
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 519..560