N-terminal Xaa-Pro-Lys N-methyltransferase 1

Overview
NameN-terminal Xaa-Pro-Lys N-methyltransferase 1
Smed IDSMED30017670
Length (bp)909
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-terminal Xaa-Pro-Lys N-methyltransferase 1 (SMED30017670) t-SNE clustered cells

Violin plots show distribution of expression levels for N-terminal Xaa-Pro-Lys N-methyltransferase 1 (SMED30017670) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-terminal Xaa-Pro-Lys N-methyltransferase 1 (SMED30017670) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-terminal Xaa-Pro-Lys N-methyltransferase 1 (SMED30017670) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017670

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017670SMESG000059668.1 SmedASXL_005829SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30017670SMESG000059668.1 dd_Smed_v4_1236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017670SMESG000059668.1 dd_Smed_v4_1236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017670SMESG000059668.1 dd_Smed_v4_1236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017670SMESG000059668.1 dd_Smed_v4_1236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017670SMESG000059668.1 dd_Smed_v4_1236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017670SMESG000059668.1 dd_Smed_v4_1236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017670SMESG000059668.1 dd_Smed_v6_1236_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30017670SMESG000059668.1 dd_Smed_v4_1236_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30017670SMESG000059668.1 H.101.2gsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 4 cellSMED30017670SMESG000059668.1 H.101.2gsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Human
Match: NTMT1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:23373])

HSP 1 Score: 196.052 bits (497), Expect = 1.587e-61
Identity = 98/226 (43.36%), Postives = 135/226 (59.73%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S  DI  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV++T+ FL ++  Y+GE    + N  CC LQ+FTP   +YD+IW QWV GHLTD  L EFL+RC KG      +I+IK+N         D  DSS  R + +++ +   A L L+ EE+Q   P E+Y V+ F LR
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRC-KGSLRPNGIIVIKDNMAQEGVI-LDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Human
Match: NTMT1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:23373])

HSP 1 Score: 196.052 bits (497), Expect = 1.587e-61
Identity = 98/226 (43.36%), Postives = 135/226 (59.73%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S  DI  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV++T+ FL ++  Y+GE    + N  CC LQ+FTP   +YD+IW QWV GHLTD  L EFL+RC KG      +I+IK+N         D  DSS  R + +++ +   A L L+ EE+Q   P E+Y V+ F LR
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRC-KGSLRPNGIIVIKDNMAQEGVI-LDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Human
Match: NTMT1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:23373])

HSP 1 Score: 196.052 bits (497), Expect = 1.587e-61
Identity = 98/226 (43.36%), Postives = 135/226 (59.73%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S  DI  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV++T+ FL ++  Y+GE    + N  CC LQ+FTP   +YD+IW QWV GHLTD  L EFL+RC KG      +I+IK+N         D  DSS  R + +++ +   A L L+ EE+Q   P E+Y V+ F LR
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRC-KGSLRPNGIIVIKDNMAQEGVI-LDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Human
Match: NTMT1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:23373])

HSP 1 Score: 196.052 bits (497), Expect = 1.587e-61
Identity = 98/226 (43.36%), Postives = 135/226 (59.73%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S  DI  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV++T+ FL ++  Y+GE    + N  CC LQ+FTP   +YD+IW QWV GHLTD  L EFL+RC KG      +I+IK+N         D  DSS  R + +++ +   A L L+ EE+Q   P E+Y V+ F LR
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRC-KGSLRPNGIIVIKDNMAQEGVI-LDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Human
Match: NTMT1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:23373])

HSP 1 Score: 196.052 bits (497), Expect = 1.587e-61
Identity = 98/226 (43.36%), Postives = 135/226 (59.73%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S  DI  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV++T+ FL ++  Y+GE    + N  CC LQ+FTP   +YD+IW QWV GHLTD  L EFL+RC KG      +I+IK+N         D  DSS  R + +++ +   A L L+ EE+Q   P E+Y V+ F LR
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAEFLRRC-KGSLRPNGIIVIKDNMAQEGVI-LDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENLPDEIYHVYSFALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Celegans
Match: homt-1 (Alpha N-terminal protein methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4D9])

HSP 1 Score: 196.823 bits (499), Expect = 4.749e-62
Identity = 97/213 (45.54%), Postives = 132/213 (61.97%), Query Frame = 3
Query:  111 YENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRP 749
            YE AE+YW+  +  VNGMLGGFE++   DI  S + I  L  +  L    +  LDCGAGIGRVTKHLL+P +S VDM +V +  + +S +YIG+     ++    LQ F P E+ YDLIW QWV+GHL D  LV+F KRC KGL      I++K+N  N  +  FD DD S+TR    L   F  + L+++ +  QT FP+E+YPV M+ L+P
Sbjct:   16 YEKAEEYWSRASQDVNGMLGGFEALHAPDISASKRFIEGLKKKN-LFGYFDYALDCGAGIGRVTKHLLMPFFSKVDMEDVVEELITKSDQYIGKHPRIGDKFVEGLQTFAPPERRYDLIWIQWVSGHLVDEDLVDFFKRCAKGL-KPGGCIVLKDNVTNHEKRLFDDDDHSWTRTEPELLKAFADSQLDMVSKALQTGFPKEIYPVKMYALKP 226          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Fly
Match: Ntmt (gene:FBgn0033457 transcript:FBtr0088375)

HSP 1 Score: 174.481 bits (441), Expect = 1.082e-52
Identity = 92/230 (40.00%), Postives = 137/230 (59.57%), Query Frame = 3
Query:   81 TQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRV-LDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRLC----CPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRPIS 755
            T+    E+ FY  A+KYW++V  TVNGMLGG   +S  DI+ S   +  +   G      NR+ LDCGAGIGRVT++LLIP +S VD+VE    F D++ +Y    + +  ++       LQ FTP ++ YDL+W QWV GHLTD  LV F +R  +GL +  + + +KEN  +S +   D +DSS TRP+   +    +A   ++++ KQ  FP+ L+PV+M   +P+S
Sbjct:   53 TKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLREIRVPG------NRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCTSEDGSRGKVGQIYNVGLQKFTPTQQ-YDLVWTQWVLGHLTDRDLVSFFRRIKQGL-APGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIVRKVKQQNFPKGLFPVYMIACKPVS 274          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Fly
Match: Ntmt (gene:FBgn0033457 transcript:FBtr0472834)

HSP 1 Score: 174.481 bits (441), Expect = 1.082e-52
Identity = 92/230 (40.00%), Postives = 137/230 (59.57%), Query Frame = 3
Query:   81 TQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRV-LDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRLC----CPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRPIS 755
            T+    E+ FY  A+KYW++V  TVNGMLGG   +S  DI+ S   +  +   G      NR+ LDCGAGIGRVT++LLIP +S VD+VE    F D++ +Y    + +  ++       LQ FTP ++ YDL+W QWV GHLTD  LV F +R  +GL +  + + +KEN  +S +   D +DSS TRP+   +    +A   ++++ KQ  FP+ L+PV+M   +P+S
Sbjct:   53 TKVAAPESEFYNKAQKYWSEVPATVNGMLGGLGYISAIDIQGSNVFLREIRVPG------NRLALDCGAGIGRVTRNLLIPRFSCVDLVEQDPAFADKAREYCTSEDGSRGKVGQIYNVGLQKFTPTQQ-YDLVWTQWVLGHLTDRDLVSFFRRIKQGL-APGAFLCLKENVSSSKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIVRKVKQQNFPKGLFPVYMIACKPVS 274          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Zebrafish
Match: ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:NCBI gene;Acc:405834])

HSP 1 Score: 205.682 bits (522), Expect = 1.971e-65
Identity = 101/217 (46.54%), Postives = 136/217 (62.67%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            +T+FY  AE YW DV PTV+GMLGG+ S+S  DI  S K +   + EG         LDCGAGIGR+TK LL+P++  VD+V+VT+ FLD++  Y+GE +  + N  CC LQ+F P  + YD+IW QWV GHLTD+ LV+FL+RC  GL  +  LI++K+N         D  DSS  R + +L  L  +A L +I EE+Q  FP E+Y V    LR
Sbjct:    9 QTSFYSKAEHYWKDVPPTVDGMLGGYGSISSIDINGSKKFLQKFLGEGQGKTGTGCALDCGAGIGRITKRLLLPLFRTVDLVDVTQEFLDKARTYLGEESKRVENYFCCGLQDFQPQPERYDVIWIQWVIGHLTDDHLVKFLRRCRSGLRPE-GLIVVKDNVAYEGVIP-DDVDSSVCRDLNVLHRLVARAGLSIIYEEQQKNFPEEIYQVHALALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Zebrafish
Match: ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:NCBI gene;Acc:405834])

HSP 1 Score: 205.682 bits (522), Expect = 1.971e-65
Identity = 101/217 (46.54%), Postives = 136/217 (62.67%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            +T+FY  AE YW DV PTV+GMLGG+ S+S  DI  S K +   + EG         LDCGAGIGR+TK LL+P++  VD+V+VT+ FLD++  Y+GE +  + N  CC LQ+F P  + YD+IW QWV GHLTD+ LV+FL+RC  GL  +  LI++K+N         D  DSS  R + +L  L  +A L +I EE+Q  FP E+Y V    LR
Sbjct:    9 QTSFYSKAEHYWKDVPPTVDGMLGGYGSISSIDINGSKKFLQKFLGEGQGKTGTGCALDCGAGIGRITKRLLLPLFRTVDLVDVTQEFLDKARTYLGEESKRVENYFCCGLQDFQPQPERYDVIWIQWVIGHLTDDHLVKFLRRCRSGLRPE-GLIVVKDNVAYEGVIP-DDVDSSVCRDLNVLHRLVARAGLSIIYEEQQKNFPEEIYQVHALALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Zebrafish
Match: ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:NCBI gene;Acc:405834])

HSP 1 Score: 206.453 bits (524), Expect = 2.123e-65
Identity = 101/217 (46.54%), Postives = 136/217 (62.67%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            +T+FY  AE YW DV PTV+GMLGG+ S+S  DI  S K +   + EG         LDCGAGIGR+TK LL+P++  VD+V+VT+ FLD++  Y+GE +  + N  CC LQ+F P  + YD+IW QWV GHLTD+ LV+FL+RC  GL  +  LI++K+N         D  DSS  R + +L  L  +A L +I EE+Q  FP E+Y V    LR
Sbjct:   29 QTSFYSKAEHYWKDVPPTVDGMLGGYGSISSIDINGSKKFLQKFLGEGQGKTGTGCALDCGAGIGRITKRLLLPLFRTVDLVDVTQEFLDKARTYLGEESKRVENYFCCGLQDFQPQPERYDVIWIQWVIGHLTDDHLVKFLRRCRSGLRPE-GLIVVKDNVAYEGVIP-DDVDSSVCRDLNVLHRLVARAGLSIIYEEQQKNFPEEIYQVHALALR 243          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Zebrafish
Match: mettl11b (methyltransferase like 11B [Source:NCBI gene;Acc:568419])

HSP 1 Score: 142.895 bits (359), Expect = 2.727e-40
Identity = 76/218 (34.86%), Postives = 120/218 (55.05%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYK-YIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            E  FY  A+ ++ DV P+  GM+G F  +SD D++ S + +   +  G         LDCG GIGRV+K +L P++ +++M+++ + F+  +++ Y+G+    + +     LQ F P  K YD+IW QWV  HLTD  L+EFL R  + L     +IIIK+N         D  DSS  R + ++  +  +A L ++  EKQ  FP  + PVWM  +R
Sbjct:   72 EKQFYYRAQNFYKDVPPSEEGMMGDFVEISDIDLEGSRQFLKKFVGPG--KAGTKCALDCGCGIGRVSKGVLFPVFESMEMLDMMEEFILHAHECYLGDYADRVESYYLYNLQEFIPPRKKYDVIWMQWVACHLTDKDLMEFLMRAKESLRP-NGVIIIKDNMARQG-CKLDPIDSSIIRHLDIMNGIIQRAGLNILDVEKQEGFPEAIVPVWMIAMR 285          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Xenopus
Match: ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:NCBI gene;Acc:100145456])

HSP 1 Score: 197.593 bits (501), Expect = 4.708e-62
Identity = 102/225 (45.33%), Postives = 139/225 (61.78%), Query Frame = 3
Query:   78 STQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNR-VLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            ST+  + E  FY  A+KYW +V  TV+GMLGG+  +S+ D+  S K +   + +    K+ N   LDCGAGIGR+TK LL+P++  VDMV+VT  FL ++  Y+GE  + + N  CC LQ F+P    YD+IW QWV GHLTD  LV+FLKRC  GL     +I+IK+N V  +    D  DSS  R I L++ L  QA L L+  E+Q  FP E+Y V+ F +R
Sbjct:    2 STELVEDEAQFYCKAQKYWKNVPATVDGMLGGYGHISNIDLNGSKKFLQRFLRQEGSNKTGNMYALDCGAGIGRITKRLLLPLFKKVDMVDVTDEFLSKAKSYLGEEGSRVGNYFCCGLQEFSPEPNRYDVIWIQWVIGHLTDEHLVDFLKRCSLGLRP-NGIIVIKDN-VTQDVSIMDDVDSSICRDIDLVRKLIKQAGLSLLAVERQENFPDEIYHVFSFAMR 224          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Xenopus
Match: psmb8 (proteasome subunit beta 8 [Source:Xenbase;Acc:XB-GENE-479064])

HSP 1 Score: 170.244 bits (430), Expect = 9.084e-51
Identity = 84/224 (37.50%), Postives = 137/224 (61.16%), Query Frame = 3
Query:   78 STQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRL-CCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            +++  D E  FY  A  ++ DV  T  GM+GGF  +SD DI+ S++  +   + G      +  LDCG+GIGRV+K++L+P++SN+++V++ + FL+E+  Y+ E    +  L C  LQ+F P  + YD+IW QWV+G+LTD  L+EFL RC  GL  K + +II ++ V       D  DSS  R I +L+++  ++ + ++ EE+Q  FP    P+WMF ++
Sbjct:   58 TSEVIDGEMQFYARARNFYRDVPATEEGMMGGFSELSDIDIE-SSREFLRKFAGGPGKAGTDFALDCGSGIGRVSKNVLLPVFSNIELVDMMEPFLEEAQNYLEEEGERVETLYCYSLQDFAPPVRKYDVIWIQWVSGYLTDRDLLEFLIRCKNGL--KDNGVIILKDNVARQGCILDPTDSSIIRDIHILRNIIEKSGMSILAEERQPGFPELCIPIWMFAIQ 278          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Mouse
Match: Ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1913867])

HSP 1 Score: 196.438 bits (498), Expect = 1.021e-61
Identity = 97/226 (42.92%), Postives = 137/226 (60.62%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S+ D+  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV+VT+ FL ++  Y+GE    + N  CC LQ+F+P   +YD+IW QWV GHLTD  L EFL+RC +GL     +I+IK+N         D  DSS  R + +++ +   A L L+ EE+Q   P E+Y V+ F LR
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISNIDLNSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFRVVDMVDVTEDFLAKAKTYLGEEGKRVRNYFCCGLQDFSPEPGSYDVIWIQWVIGHLTDQHLAEFLRRCKRGLRP-NGIIVIKDNMAQEGVI-LDDVDSSVCRDLEVVRRIIRTAGLSLLAEERQENLPDEIYHVYSFALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Mouse
Match: Mettl11b (methyltransferase like 11B [Source:MGI Symbol;Acc:MGI:2685053])

HSP 1 Score: 168.318 bits (425), Expect = 4.251e-50
Identity = 88/228 (38.60%), Postives = 134/228 (58.77%), Query Frame = 3
Query:   78 STQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRL-CCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRPISH 758
            ++Q  D E  FY  A+ ++ +V  T  GM+G F  +S+ DI+ S + +   +  G         LDCG+GIGRV+KH+L+P++S+V++V++ + FL E+  Y+      +    C  LQ FTP+   YD+IW QWV+G+LTD  L+ FL RC  GL  +  +II+K+N        FD  DSS TR + +L+SL  ++ L ++ +EKQ  FP +  PVWMF L    H
Sbjct:   58 TSQVIDGEMQFYARAKLFYQEVPATEEGMMGNFIELSNPDIQASREFLRKFVG-GPGRAGTGCALDCGSGIGRVSKHVLLPVFSSVELVDMMESFLLEAQSYLQVNEDKVESYHCYSLQEFTPHLGRYDVIWIQWVSGYLTDKDLLAFLSRCRDGL-KENGVIILKDNVAREG-CIFDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQEGFPEQCVPVWMFALHSDRH 282          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Mouse
Match: Ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1913867])

HSP 1 Score: 146.362 bits (368), Expect = 3.093e-43
Identity = 68/147 (46.26%), Postives = 94/147 (63.95%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNAL 509
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S+ D+  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV+VT+ FL ++  Y+GE    + N  CC LQ+F+P   +YD+IW QWV GHLTD  L
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISNIDLNSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFRVVDMVDVTEDFLAKAKTYLGEEGKRVRNYFCCGLQDFSPEPGSYDVIWIQWVIGHLTDQHL 146          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Mouse
Match: Ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1913867])

HSP 1 Score: 132.88 bits (333), Expect = 3.848e-38
Identity = 59/129 (45.74%), Postives = 83/129 (64.34%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWV 482
            E  FY  A+ YW  + PTV+GMLGG+  +S+ D+  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV+VT+ FL ++  Y+GE    + N  CC LQ+F+P   +YD+IW QWV
Sbjct:    8 EKQFYSKAKTYWKQIPPTVDGMLGGYGHISNIDLNSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFRVVDMVDVTEDFLAKAKTYLGEEGKRVRNYFCCGLQDFSPEPGSYDVIWIQWV 136          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Mouse
Match: Ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1913867])

HSP 1 Score: 106.301 bits (264), Expect = 3.130e-28
Identity = 51/118 (43.22%), Postives = 73/118 (61.86%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCC 422
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S+ D+  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV+VT+ FL ++  Y+GE    + N  CC
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISNIDLNSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFRVVDMVDVTEDFLAKAKTYLGEEGKRVRNYFCC 117          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q6NWX7|NTM1A_DANRE (N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Danio rerio OX=7955 GN=ntmt1 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 3.224e-65
Identity = 102/217 (47.00%), Postives = 136/217 (62.67%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            +T+FY  AE YW DV PTV+GMLGG+ S+S  DI  S K +   + EG         LDCGAGIGR+TK LL+P++  VD+V+VT+ FLD++  Y+GE +  + N  CC LQ+F P  + YD+IW QWV GHLTD+ LVEFL+RC  GL  +  LI++K+N         D  DSS  R + +L  L  +A L +I EE+Q  FP E+Y V    LR
Sbjct:    9 QTSFYSEAEHYWKDVPPTVDGMLGGYGSISSIDINGSKKFLQKFLGEGQGKTGTGCALDCGAGIGRITKRLLLPLFRTVDLVDVTQEFLDKARTYLGEESKRVENYFCCGLQDFQPQPERYDVIWIQWVIGHLTDDHLVEFLRRCRSGLRPE-GLIVVKDNVAYEGVIP-DDVDSSVCRDLNVLHRLVARAGLSIIYEEQQQNFPEEIYQVHALALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q4KLE6|NT1AB_XENLA (N-terminal Xaa-Pro-Lys N-methyltransferase 1-B OS=Xenopus laevis OX=8355 GN=ntmt1-b PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 6.659e-62
Identity = 99/224 (44.20%), Postives = 136/224 (60.71%), Query Frame = 3
Query:   78 STQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINR-LCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            ST+  + ET FY  A+ YW +V  TV+GMLGG+  +S+ D+  S K +   + EG         LDCGAGIGR+TK LL+P++  VDMV+VT  FL+++  Y+GE    + +  CC LQ F+P    YD+IW QWV GHLTD  LV FL+RC  GL     +I+IK+N V  +    D  DSS  R I L++ L  QA L ++  E+Q  FP E+Y V+ F +R
Sbjct:    2 STELVEDETQFYGKAQNYWKNVPATVDGMLGGYGHISNTDLNSSKKFLQRFLREGSQKTGNTCALDCGAGIGRITKRLLLPLFKTVDMVDVTDEFLNKAKSYLGEEGKRVGKYFCCGLQEFSPEPSRYDVIWIQWVIGHLTDEHLVSFLQRCKLGLRP-NGIILIKDN-VTQDGSIMDDADSSICRDIDLVRKLIKQAGLSVLAIERQENFPDEIYQVFSFAMR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q4KL94|NT1AA_XENLA (N-terminal Xaa-Pro-Lys N-methyltransferase 1-A OS=Xenopus laevis OX=8355 GN=ntmt1-a PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.075e-61
Identity = 100/225 (44.44%), Postives = 139/225 (61.78%), Query Frame = 3
Query:   78 STQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNR-VLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            ST+  + ET FY  A+ YW +V PTV+GMLGG+  +S+ D+  S K +   + +    K+ N   LDCGAGIGR+TK LL+P++  VDMV+VT  FL+++  ++GE    + N  CC LQ F+P    YD+IW QWV GHLTD  LV FL+RC  GL     +I+IK+N V  +    D  DSS  R I L++ L  QA L ++  E+Q  FP E+Y V+ F +R
Sbjct:    2 STELVEDETQFYGKAQNYWKNVPPTVDGMLGGYGHISNVDLNGSKKFLQRFLRQEGSNKTGNACALDCGAGIGRITKRLLLPLFKTVDMVDVTDEFLNKAKSFLGEEGKRVGNYFCCGLQEFSPEPNRYDVIWIQWVIGHLTDEHLVNFLQRCRLGLRP-NGIIVIKDN-VTQDASIMDDVDSSICREIDLVRKLIKQAGLSILAVERQENFPDEIYHVFSFAMR 224          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. UniProt/SwissProt
Match: sp|B1H2P7|NTM1A_XENTR (N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=ntmt1 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.494e-61
Identity = 102/225 (45.33%), Postives = 139/225 (61.78%), Query Frame = 3
Query:   78 STQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNR-VLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            ST+  + E  FY  A+KYW +V  TV+GMLGG+  +S+ D+  S K +   + +    K+ N   LDCGAGIGR+TK LL+P++  VDMV+VT  FL ++  Y+GE  + + N  CC LQ F+P    YD+IW QWV GHLTD  LV+FLKRC  GL     +I+IK+N V  +    D  DSS  R I L++ L  QA L L+  E+Q  FP E+Y V+ F +R
Sbjct:    2 STELVEDEAQFYCKAQKYWKNVPATVDGMLGGYGHISNIDLNGSKKFLQRFLRQEGSNKTGNMYALDCGAGIGRITKRLLLPLFKKVDMVDVTDEFLSKAKSYLGEEGSRVGNYFCCGLQEFSPEPNRYDVIWIQWVIGHLTDEHLVDFLKRCSLGLRP-NGIIVIKDN-VTQDVSIMDDVDSSICRDIDLVRKLIKQAGLSLLAVERQENFPDEIYHVFSFAMR 224          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. UniProt/SwissProt
Match: sp|Q5BJX0|NTM1A_RAT (N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ntmt1 PE=2 SV=3)

HSP 1 Score: 196.823 bits (499), Expect = 4.784e-61
Identity = 97/226 (42.92%), Postives = 137/226 (60.62%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            M+S   +D E  FY  A+ YW  + PTV+GMLGG+  +S+ D+  S K +   + EG      +  LDCGAGIGR+TK LL+P++  VDMV+VT+ FL ++  Y+GE    + N  CC LQ+F+P   +YD+IW QWV GHLTD  L EFL+RC +GL     +I+IK+N         D  DSS  R + +++ +   A L L+ EE+Q   P E+Y V+ F LR
Sbjct:    1 MTSEVIED-EKQFYSKAKTYWKQIPPTVDGMLGGYGHISNIDLNSSRKFLQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFRVVDMVDVTEDFLAKAKTYLGEEGKRVRNYFCCGLQDFSPEPSSYDVIWIQWVIGHLTDQHLAEFLRRCRRGLRP-NGIIVIKDNMAQEGVI-LDDVDSSVCRDLEVVRRIIRSAGLSLLAEERQENLPDEIYHVYSFALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. TrEMBL
Match: A0A0N5A6I1 (Uncharacterized protein OS=Parastrongyloides trichosuri OX=131310 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.103e-68
Identity = 109/215 (50.70%), Postives = 145/215 (67.44%), Query Frame = 3
Query:  108 FYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRP 749
             YE +  YW  V  TV+GMLGGFE + D D++ S KLI  L S+  L K ++R LDCGAGIGRVTKH LIP +  VDMV+VT  F++ S KY+G++   I NR  C LQNF PNE  YD IW QWVTG+LTD   V+F KRC  GL     LI++K+N   S EP FD +D+S+TR    +++L   +DL++I+++KQ  FP+ +Y V MFV++P
Sbjct:   11 LYEKSASYWAGVNSTVDGMLGGFERLHDPDVQDSKKLITYLRSKK-LFKQMDRALDCGAGIGRVTKHTLIPYFKTVDMVDVTDSFIENSKKYMGDSEHKIGNRFICGLQNFEPNENYYDCIWVQWVTGYLTDGDFVKFFKRCKNGLRD-GGLIVLKDNITKSEEPLFDEEDNSWTRSREYIRNLLKDSDLDIIEDKKQLNFPKGMYEVRMFVMKP 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. TrEMBL
Match: A0A553NCF5 (Uncharacterized protein OS=Tigriopus californicus OX=6832 GN=TCAL_03914 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.628e-67
Identity = 109/213 (51.17%), Postives = 134/213 (62.91%), Query Frame = 3
Query:  111 YENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRP 749
            YE    YW+ V PT++GMLGGF  +S  DI            EG  + S  R LDCGAGIGRVTK+LL   +  VDMVE    FLD S  Y+G T+    R C  LQ+FTP    YD+IW QWV GHL D+ LV F +RC +GL +   ++I+KENT +S+  + D  D S TRP ALLKSLF QADL LIK+ +Q +FP ELYPV M+ LRP
Sbjct:   23 YELGADYWSKVDPTIDGMLGGFAQISPLDI------------EGSSSPSTGRALDCGAGIGRVTKYLLQRHFQTVDMVEQDAKFLDHSRAYLGPTSKVDQRFCSGLQSFTPQSAHYDVIWSQWVLGHLADSDLVAFFQRCARGLKA-NGVLIVKENTTSSDTVEQDPQDGSVTRPDALLKSLFAQADLVLIKDLQQLKFPAELYPVKMYALRP 222          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. TrEMBL
Match: K1QC85 (Methyltransferase-like protein 11A OS=Crassostrea gigas OX=29159 GN=CGI_10016856 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 2.319e-66
Identity = 107/219 (48.86%), Postives = 144/219 (65.75%), Query Frame = 3
Query:   93 DIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRL-CCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            D E  FY +A+KYW  +TPTV+GMLGGF  +S  DI  S   +   +  G       R LDCGAGIGR+TK LL+PI+  VDMVE+ + FLDE+  +IGE ++ +++L C  LQ+FTP    YD+IW QWV GHLTD+ L++FL+RC  GL S   +II+KEN   + E DFD  DSSYTR    L  +  Q+ L+++K EKQ  FP+ LY V+M+ L+
Sbjct:    4 DDEGKFYGDAKKYWEGITPTVDGMLGGFAKISPTDINGSHAFLRPFLMVGGGKTETTRALDCGAGIGRITKRLLLPIFKTVDMVELNQKFLDEARSFIGEESSRVDKLFCSGLQDFTPGTGTYDVIWTQWVLGHLTDDHLLKFLQRCQSGLTS-NGIIILKENV--AQERDFDELDSSYTRTREELDKVISQSGLKILKCEKQKGFPKGLYDVYMYALQ 219          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. TrEMBL
Match: A0A1S3HJA8 (N-terminal Xaa-Pro-Lys N-methyltransferase 1-B OS=Lingula unguis OX=7574 GN=LOC106155768 PE=4 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 3.860e-66
Identity = 109/214 (50.93%), Postives = 146/214 (68.22%), Query Frame = 3
Query:  108 FYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLM-SEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINR-LCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVL 743
            FY++A+KYW +V  TV+GMLGGF  +S+ DI  STK +   +  E   TKS +R LDCGAGIGR+TK LLIP++  VDMVE+   FL+++ +++GE    + + +   LQ+FTP    YD+IWCQWV GHLTD+ LVEF KRC  GL +   +I +KEN  +S+E D D  DSS TRP  +L  L ++A L++IKEEKQ  FP+ LY V MF L
Sbjct:    9 FYQDADKYWKEVPATVDGMLGGFSHISNTDINGSTKFLRQFIRGENAKTKS-HRALDCGAGIGRITKRLLIPLFDTVDMVELNPDFLNKAREFLGEHADKVEQYIAKGLQDFTPEAGRYDVIWCQWVLGHLTDSHLVEFFKRCKVGL-APDGMIFVKENVTSSDEVDKDDTDSSVTRPRDILVKLMMEAGLKIIKEEKQKGFPKGLYDVIMFAL 220          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. TrEMBL
Match: V4AAA5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_225615 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 5.049e-66
Identity = 104/221 (47.06%), Postives = 141/221 (63.80%), Query Frame = 3
Query:   90 KDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEP-DFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            K ++  FY +A+ YW  ++PTV+GMLGGF  +S  DI  S   +   M          R LDCGAGIGR+TK LL+P++  VDMVE+ +HFL E+  +IG+ +  + N  C  LQ+FTP+   YD+IWCQWV GHL D  L EF +RC  GL     +I++KEN+  S E  DFDS DSS+TRP   LK +  +A L ++KEEKQ  FP+ +Y V+MF L+
Sbjct:   21 KVVDERFYGDAKSYWEKISPTVDGMLGGFAKISPTDINGSRAFLRQFMKISGGKVDNKRALDCGAGIGRITKRLLLPMFETVDMVELNQHFLKEARTFIGDDSKRVENLFCSGLQDFTPDRGQYDVIWCQWVLGHLKDQHLKEFFQRCKLGLKP-GGIIVVKENSSTSEEERDFDSSDSSFTRPKHELKEIMAKAGLTVLKEEKQKGFPKGVYDVFMFALQ 240          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Cavefish
Match: ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:NCBI gene;Acc:103027538])

HSP 1 Score: 195.282 bits (495), Expect = 2.148e-61
Identity = 96/217 (44.24%), Postives = 131/217 (60.37%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            + AFY  AE YW +V PTV+GMLGG+ S+S  DI  S K +   + EG         LDCGAGIGR+TK LL+P++  VD+V+VT+ FLD++  Y+GE    + N  C  LQ+F P  + YD+IW QWV GHLTD+ LVEFL+RC   L     L++IK+N         D  DSS  R + ++  +  +A L ++ EE+Q  FP E+Y V    LR
Sbjct:    9 QGAFYSKAEHYWKEVPPTVDGMLGGYGSISSIDINGSKKFLQKFLGEGKGKTRPGCALDCGAGIGRITKRLLLPLFRTVDLVDVTQEFLDKARSYLGEEGRRVENYFCSGLQDFQPQPQRYDVIWIQWVIGHLTDDHLVEFLRRCQSALRPD-GLVVIKDNVAYEGVVP-DEVDSSVCRDLQVVHRIVARAGLTVVYEEQQQNFPEEIYQVHTLALR 223          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Cavefish
Match: mettl11b (methyltransferase like 11B [Source:NCBI gene;Acc:103038020])

HSP 1 Score: 134.42 bits (337), Expect = 3.221e-37
Identity = 70/217 (32.26%), Postives = 121/217 (55.76%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESY-KYIGETNATI-NRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVL 743
            E  FY  A+ ++  +  +  GM+G F  +S+ D++ S + +   +  G       R LDCG GIGRV+K +L P++ +++M+++ + F+  ++ +Y+G+    + +     LQ+F P    YD+IW QWV  HLTD  +++FL+R  + L     +IIIK+N         D  DSS  R + ++K++  +A L ++  EKQ  FP  + PVWM  +
Sbjct:   72 EKQFYYRAQNFYKGIPASEEGMMGDFVEISEVDLEGSRQFLKKFVGPG--KAGSRRALDCGCGIGRVSKGVLFPVFESMEMLDMMEDFILHAHQRYLGDYADRVESYYVYNLQDFIPPPNRYDVIWMQWVACHLTDKDVMQFLRRAKESLRP-NGVIIIKDNMARQG-CRLDPVDSSIIRHLDIMKNIIQKAGLTILDVEKQEGFPEVVVPVWMIAM 284          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Yeast
Match: TAE1 (AdoMet-dependent proline methyltransferase; catalyzes the dimethylation of ribosomal proteins Rpl12 and Rps25 at N-terminal proline residues; has a role in protein synthesis; fusion protein localizes to the cytoplasm [Source:SGD;Acc:S000000465])

HSP 1 Score: 147.517 bits (371), Expect = 1.246e-43
Identity = 89/221 (40.27%), Postives = 128/221 (57.92%), Query Frame = 3
Query:  111 YENAEKYWNDVTPTVNGMLGGFES---VSDADIKLSTKLIMNLMSEGFLTKS-VNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGE--TNATINRLC-CPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRPI 752
            YE+A  YW DV  TV+G+LGG+     V   D+  S   +  L S     ++ V   +D GAGIGRV+K +L    + +D+VE  K F+++ +  + E      I ++    +Q++TP+   Y LIWCQW  GHL D  LV FLKRC+ GL    + I++KEN   ++  DFD  DSS TR  A  + +F +A L+LI  E+Q   PRELYPV M+ L+P+
Sbjct:   11 YEDAIDYWTDVDATVDGVLGGYGEGTVVPTMDVLGSNNFLRKLKSRMLPQENNVKYAVDIGAGIGRVSKTMLHKHAAKIDLVEPVKPFIEQMHVELAELKDKGQIGQIYEVGMQDWTPDAGKYWLIWCQWCVGHLPDAELVAFLKRCIVGLQPNGT-IVVKENNTPTDTDDFDETDSSVTRSDAKFRQIFEEAGLKLIASERQRGLPRELYPVRMYALKPM 230          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Nematostella
Match: EDO32912 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STP3])

HSP 1 Score: 172.555 bits (436), Expect = 4.983e-53
Identity = 94/222 (42.34%), Postives = 132/222 (59.46%), Query Frame = 3
Query:   93 DIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVL---DCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRLC-CPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIA----LLKSLFLQADLELIKEEKQTEFPRELYPVWM 734
            D +  +Y  A+KYW ++  TV+GMLGGF ++S AD+  STK +  L+  G       R +   DCGAGIGRVTKH+L+P++  VDMVE    +L+++ +Y+GE +  I       LQ F P    YD+IWCQWV  +LTD   V FL RC K L  +  ++ +KEN V+  + +FD++DSS TR           LF QA+L LIK+E Q   P ++Y V M
Sbjct:    2 DNKDQWYGGAQKYWKEIPATVDGMLGGFSAISPADVWGSTKFLKELLKNGEKQPRKKRCVMQTDCGAGIGRVTKHVLLPLFETVDMVEQNPDYLEKAKEYLGEKSCRIGHFYPVGLQEFDPEAGRYDVIWCQWVMLYLTDEDFVSFLNRCKKSL-KEGGVVCVKEN-VSKKDYEFDAEDSSVTRQDTGSHRQYTQLFKQANLNLIKQETQKNMPSDIYKVNM 221          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Medaka
Match: ntmt1 (N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Source:NCBI gene;Acc:101168668])

HSP 1 Score: 209.92 bits (533), Expect = 3.418e-67
Identity = 105/217 (48.39%), Postives = 141/217 (64.98%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIG-ETNATINRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            ET+FY NAE YW DV PTV+GMLGG+ S+S  DI  S   +   + EG      +  LDCGAGIGR+TK LL+P++S VD+V+VT+ FLD++  Y+G E     N  CC LQ+F P    YD+IW QWV GHLTD+ LV+FL+RC KGL     LI+IK+N V+      D  DSS  R + +++SL  +A L+++ EE+Q  FP+E+Y V    LR
Sbjct:    8 ETSFYSNAEGYWRDVPPTVDGMLGGYGSISSIDINGSKAFLNKFLGEGEGKTGCSCALDCGAGIGRITKRLLLPLFSTVDLVDVTQEFLDKAKHYLGTEGRRVENYFCCGLQDFEPMSGRYDIIWIQWVIGHLTDSHLVQFLRRCQKGLRP-NGLIVIKDN-VSFEGVVPDEVDSSVCRDLEIVRSLVHRAGLQIVHEEQQMNFPQEIYQVHTLALR 222          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Medaka
Match: mettl11b (methyltransferase like 11B [Source:NCBI gene;Acc:101166618])

HSP 1 Score: 154.836 bits (390), Expect = 7.692e-45
Identity = 80/218 (36.70%), Postives = 128/218 (58.72%), Query Frame = 3
Query:   99 ETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYK-YIGETNATINRL-CCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLR 746
            E  FY  A+K++ DV  +  GM+G F  +S+ D++ S + +   +  G      +  LDCG+GIGRVTK +L+P++  +++V++ +HFL  +++ Y+G+    +    C  LQ FTP +  YD+IW QWV  HLTD  L+ FL RC K L     +IIIK+N         DS DSS +R + +++ +  +A LE++  E+Q  FP  + PVWM  ++
Sbjct:   80 EKQFYYRAQKFYEDVPASEEGMMGDFVEISNIDLEGSRQFLKRFVGPG--KAGTHCALDCGSGIGRVTKGVLLPVFEKMELVDMMEHFLLHAHEEYLGDGADRVETYYCFTLQEFTPPKNKYDVIWLQWVACHLTDKDLMNFLIRCKKSLRP-NGVIIIKDNMARQG-CKLDSIDSSISRHLDIMRVIIAKAGLEILGVERQDGFPDVIMPVWMVAMK 293          
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Planmine SMEST
Match: SMESG000059668.1 (SMESG000059668.1)

HSP 1 Score: 474.167 bits (1219), Expect = 1.746e-171
Identity = 227/229 (99.13%), Postives = 227/229 (99.13%), Query Frame = 3
Query:   72 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRPISH 758
            MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNR LDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCV GLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRPISH
Sbjct:    1 MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLIMNLMSEGFLTKSVNRALDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDESYKYIGETNATINRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFLKRCVTGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQADLELIKEEKQTEFPRELYPVWMFVLRPISH 229          
The following BLAST results are available for this feature:
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTMT11.587e-6143.36N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
NTMT11.587e-6143.36N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
NTMT11.587e-6143.36N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
NTMT11.587e-6143.36N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
NTMT11.587e-6143.36N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
homt-14.749e-6245.54Alpha N-terminal protein methyltransferase 1 [Sou... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ntmt1.082e-5240.00gene:FBgn0033457 transcript:FBtr0088375[more]
Ntmt1.082e-5240.00gene:FBgn0033457 transcript:FBtr0472834[more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ntmt11.971e-6546.54N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
ntmt11.971e-6546.54N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
ntmt12.123e-6546.54N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
mettl11b2.727e-4034.86methyltransferase like 11B [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ntmt14.708e-6245.33N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
psmb89.084e-5137.50proteasome subunit beta 8 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ntmt11.021e-6142.92N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
Mettl11b4.251e-5038.60methyltransferase like 11B [Source:MGI Symbol;Acc:... [more]
Ntmt13.093e-4346.26N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
Ntmt13.848e-3845.74N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
Ntmt13.130e-2843.22N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NWX7|NTM1A_DANRE3.224e-6547.00N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Da... [more]
sp|Q4KLE6|NT1AB_XENLA6.659e-6244.20N-terminal Xaa-Pro-Lys N-methyltransferase 1-B OS=... [more]
sp|Q4KL94|NT1AA_XENLA2.075e-6144.44N-terminal Xaa-Pro-Lys N-methyltransferase 1-A OS=... [more]
sp|B1H2P7|NTM1A_XENTR2.494e-6145.33N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Xe... [more]
sp|Q5BJX0|NTM1A_RAT4.784e-6142.92N-terminal Xaa-Pro-Lys N-methyltransferase 1 OS=Ra... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N5A6I11.103e-6850.70Uncharacterized protein OS=Parastrongyloides trich... [more]
A0A553NCF54.628e-6751.17Uncharacterized protein OS=Tigriopus californicus ... [more]
K1QC852.319e-6648.86Methyltransferase-like protein 11A OS=Crassostrea ... [more]
A0A1S3HJA83.860e-6650.93N-terminal Xaa-Pro-Lys N-methyltransferase 1-B OS=... [more]
V4AAA55.049e-6647.06Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ntmt12.148e-6144.24N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
mettl11b3.221e-3732.26methyltransferase like 11B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAE11.246e-4340.27AdoMet-dependent proline methyltransferase; cataly... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO329124.983e-5342.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ntmt13.418e-6748.39N-terminal Xaa-Pro-Lys N-methyltransferase 1 [Sour... [more]
mettl11b7.692e-4536.70methyltransferase like 11B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of N-terminal Xaa-Pro-Lys N-methyltransferase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000059668.11.746e-17199.13SMESG000059668.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017670 ID=SMED30017670|Name=N-terminal Xaa-Pro-Lys N-methyltransferase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=909bp
TTTAATAGTATATTTAAACCACACTTTTAAAATTTTCTTTATTTCAATTT
TAGTGTTTTACAGCTTTTACCATGTCTAGCACTCAAACAAAGGATATTGA
AACAGCATTTTACGAAAATGCTGAAAAATATTGGAATGATGTCACACCTA
CTGTTAACGGCATGTTAGGTGGTTTTGAAAGTGTATCCGATGCTGATATA
AAATTATCTACCAAATTAATTATGAACTTGATGTCTGAAGGATTTTTAAC
AAAATCTGTTAATAGAGTACTTGATTGTGGTGCTGGAATAGGTCGGGTAA
CAAAGCATTTACTTATCCCAATTTATTCCAATGTTGACATGGTAGAAGTT
ACAAAGCATTTTTTAGATGAATCATACAAATATATTGGTGAGACTAATGC
AACCATTAATCGTTTATGCTGTCCATTGCAAAATTTTACTCCAAATGAAA
AAGCATACGACCTCATTTGGTGCCAGTGGGTTACCGGGCATCTGACTGAC
AATGCGCTCGTCGAATTTCTCAAACGCTGTGTCAAAGGATTGCACTCAAA
AACAAGTTTAATCATCATTAAAGAAAATACTGTCAATAGCAACGAGCCTG
ATTTCGATAGCGATGACAGCTCATATACCAGACCGATTGCTCTTTTGAAA
AGTCTTTTCCTTCAAGCAGATCTTGAATTGATAAAAGAAGAAAAACAAAC
AGAATTTCCGAGAGAGCTCTATCCGGTTTGGATGTTTGTTCTGAGGCCCA
TCTCCCATTAAGATCTTGTCATCGTTTATTAATAAAATATTCGTCTCATA
TTATCGATTTTGCTGTATGTATGAAAAGTAATGAAAAAAATGCATTAGTA
GAGGGGTAACTCAAAATGTGTCTTAACAAATTGAATATTGATTTTAAAGT
AAAATGTGC
back to top

protein sequence of SMED30017670-orf-1

>SMED30017670-orf-1 ID=SMED30017670-orf-1|Name=SMED30017670-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=230bp
MSSTQTKDIETAFYENAEKYWNDVTPTVNGMLGGFESVSDADIKLSTKLI
MNLMSEGFLTKSVNRVLDCGAGIGRVTKHLLIPIYSNVDMVEVTKHFLDE
SYKYIGETNATINRLCCPLQNFTPNEKAYDLIWCQWVTGHLTDNALVEFL
KRCVKGLHSKTSLIIIKENTVNSNEPDFDSDDSSYTRPIALLKSLFLQAD
LELIKEEKQTEFPRELYPVWMFVLRPISH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000018Category 4 cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR008576MeTrfase_NTM1
IPR029063SAM-dependent_MTases
Vocabulary: biological process
TermDefinition
GO:0006480N-terminal protein amino acid methylation
GO:0032259methylation
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 2..225
e-value: 4.0E-64
score: 218.0
NoneNo IPR availablePANTHERPTHR12753:SF0ALPHA N-TERMINAL PROTEIN METHYLTRANSFERASE 1coord: 7..226
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 65..166
e-value: 0.00126026
score: 35.4835
IPR008576Alpha-N-methyltransferase NTM1PIRSFPIRSF016958Mtase_AD-003coord: 1..229
e-value: 1.3E-80
score: 267.8
IPR008576Alpha-N-methyltransferase NTM1PFAMPF05891Methyltransf_PKcoord: 11..225
e-value: 2.0E-76
score: 256.4
IPR008576Alpha-N-methyltransferase NTM1PANTHERPTHR12753AD-003 - RELATEDcoord: 7..226
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 12..224