Anosmin-1

Overview
NameAnosmin-1
Smed IDSMED30017664
Length (bp)2188
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Anosmin-1 (SMED30017664) t-SNE clustered cells

Violin plots show distribution of expression levels for Anosmin-1 (SMED30017664) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Anosmin-1 (SMED30017664) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Anosmin-1 (SMED30017664) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017664

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017664h1SMcG0016202 dd_Smed_v4_6746_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017664h1SMcG0016202 dd_Smed_v4_6746_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30017664h1SMcG0016202 dd_Smed_v4_6746_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30017664h1SMcG0016202 dd_Smed_v4_6746_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017664h1SMcG0016202 Contig34686newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30017664h1SMcG0016202 Contig34686uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
body wall musculatureSMED30017664h1SMcG0016202 dd_Smed_v4_6746_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30017664h1SMcG0016202 dd_Smed_v4_6746_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermis progenitor cellSMED30017664h1SMcG0016202 dd_Smed_v4_6746_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermis progenitor cellSMED30017664h1SMcG0016202 dd_Smed_v4_6746_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Anosmin-1 vs. Ensembl Human
Match: ANOS1 (anosmin 1 [Source:HGNC Symbol;Acc:HGNC:6211])

HSP 1 Score: 152.14 bits (383), Expect = 7.782e-38
Identity = 148/605 (24.46%), Postives = 264/605 (43.64%), Query Frame = 3
Query:  141 QCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLS-SLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKC----ADYLTLIPSQPENLTSKLI-NPTSKTYELSWRHPISVMVRHEDIYH--SRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            Q +  C K     KES D     C+   + C+   P     CL+ C+FLK  L +  G CP+    +     +C+  C+ D EC + + KCC  GC + C  P  +Y   +P  P + +      S  +E +W S++   I    P+ +++Q R        E  A  WQT+  T+    +L +    + YQFR+AAV+  G RGF  PS  F    + PS P +   L    + V S G ++VTI W   +E   P+  Y V W     ++ S    +    +  ++    + + +LE L+P+  Y VE+    YW G   L S   +L  ++   T+ + E++      G  T        R     + +  P Y++G+  + +     +D + + Y V + P+ C    +     +  S  T E   N I +++L F+C+Y + ++ I  KS  K   +       +F  P C+ +   ++ +P  C       L+ + ++PENL++  I    + T   SW+      +   ++Y   + +++TW     E  + S+           +S  S  +++  D   + + NL+P T+Y ++ Q
Sbjct:   78 QNHKQCSKCLEPCKESGDLRKHQCQ---SFCEPLFPKKSYECLTSCEFLKYILLVKQGDCPAPEKASGFAA-ACVESCEVDNEC-SGVKKCCSNGCGHTCQVPKTLYK-GVPLKPRKELRFTELQSGQLEVKWSSKFNISIE---PVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSAPPAPANLRLANSTVNSDGSVTVTIVWDLPEEPDIPVHHYKVFW----SWMVSSKSLVPTKKKRRKTTDGFQNSVILEKLQPDCDYVVELQAITYW-GQTRLKSAKVSLHFTSTHATNNK-EQLVKTRKGGIQTQLPFQR--RRPTRPLEVGAPFYQDGQLQVKVYWKKTEDPTVNRYHVRWFPEACAH--NRTTGSEASSGMTHE---NYIILQDLSFSCKYKVTVQPIRPKSHSKAEAV-------FFTTPPCSAL-KGKSHKPVGCLGEAGHVLSKVLAKPENLSASFIVQDVNITGHFSWK------MAKANLYQPMTGFQVTWAEVTTESRQNSL----------PNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQ 635          
BLAST of Anosmin-1 vs. Ensembl Celegans
Match: kal-1 (KALlmann syndrome homolog [Source:UniProtKB/TrEMBL;Acc:G5EDX1])

HSP 1 Score: 89.3521 bits (220), Expect = 3.660e-18
Identity = 98/391 (25.06%), Postives = 153/391 (39.13%), Query Frame = 3
Query:  144 CYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYND-SIPELPAQLIPIKIPNSSDIEFEWMS-QYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEF-DHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRW--LKSDEYVFPISEYAVKWM-------------------IDYGY-----VQSDGH----AISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSS 1217
            C A C + F  IK  K  C  +                  C   C +L+       G CPS  + +  +   C + C+ D EC  T  KCC  GCS  C++P  +D  +  +P  +   +      I   W + +       +N   F++Q R       DES   +WQT+ + ++  A L      G+ Y+FR AAVS +G+ GF  PS PF +I +    P   K LS   ++V ++G  +  + W    SD    PI  Y + W                    +++       +QSD       I    + +  VP   T+  +  L PN+ Y VE+   V  + D  L  E   +F+ T        E+   + Y GP     + S
Sbjct:   62 CSAPCREQFDDIKACKKSCVAS-------------DDRETCEDSCHYLQRIYQEKPGACPSVSNQSNYE---CSALCQMDGECPET-QKCCSSGCSRQCLKPRSSDIKLLPIPRNISVQERKRKRSIIIRWATGRLSKAQQNENANLFLVQWRWG--LHADESAMTEWQTVTVRNKPYAILKHLLSPGRFYEFRTAAVSQEGSLGFSSPSKPF-KISKEAKAPPPPKDLSLGASKVVASGLWNQMVHWNPPPSD---LPIKNYQISWASSTKSEADAFEEQMRKKSTLEFAAHEKRSLQSDDDEEFIGIQERDRQSVVVPSHATSSEITGLFPNSVYLVEIHASVD-SSDGELHGEKGVVFIRTADSLSAVPED--REPYTGPKARIAHGS 426          
BLAST of Anosmin-1 vs. Ensembl Fly
Match: Kal1 (gene:FBgn0039155 transcript:FBtr0084549)

HSP 1 Score: 80.1073 bits (196), Expect = 2.705e-15
Identity = 74/312 (23.72%), Postives = 136/312 (43.59%), Query Frame = 3
Query:  246 PSSEPG---CLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPI---YNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDH---------GKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLST 1136
            P+++ G   CL+ C   +  L   +G CP  +      + SCL  C+ D EC   + KCC   C  +CVEP+    N  +P +P +++  +      ++ +  S    +       +F ++ R    R F       WQ   +       +    H         G+ Y+ R+AAV+A G RG+  PS PFP     P  P S    S+++ + +    +++ + W  S   + P+ +Y + W +   YV S   ++   + + +    D   + +++L PN++Y ++V    Y  G   L SE  ++  +T
Sbjct:   72 PTTKAGREQCLNKC-IQELLLGPRAGSCPK-IGRQSRARLSCLDNCQYDHEC-PEVQKCCPSSCGPMCVEPLGVRNNTQLPPIP-KILYFRRSRGHAVDLKIESSLLVY-------YFHVEVRSHIGRHFAARKLGPWQWQKVEKTMEENIGHSKHTYIFFHMRPGRWYEVRVAAVNAYGFRGYSEPSDPFPS-TGNPKPPKSPND-SKIIGKQFDGRYMTLKLVWCPSKSNL-PVEKYKITWSL---YVNSAKASMITNSSYVK----DTHQFEIKELLPNSSYYIQVQAISYL-GSRRLKSEQWSMLFNT 361          
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Match: anos1a (anosmin 1a [Source:ZFIN;Acc:ZDB-GENE-000201-9])

HSP 1 Score: 140.198 bits (352), Expect = 3.328e-34
Identity = 146/621 (23.51%), Postives = 259/621 (41.71%), Query Frame = 3
Query:  102 PSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGK---ISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIE---SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEG-YFCVPSCTNIASSEASEPPKCADYLTLIPS---QPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            P +   + +    Q +  C K     K+S +     C+   ++C+   P     C++ C+FL+  + +  G CP     +     +C+  C+ D EC +   KCC  GC + C  P  +Y  + P  P + +  +   S  +E  W S++        P+  +LQ R        E  A +WQ +  TS+    L +   G+ YQFR+AAV+  G RG+  PS  F        +P      S+L     + G     SV + W  S +   P++ Y + W        S  H +    +  ++V  D T   L+DL+ N +Y VE+    YW G   L S  + L  +T S T   LE   +  +  P ++  +            +  P Y++G+  + +         + YRV + P+ C           H  +RT E   ++ N  S+  L F+C+Y + I+ + LK           Q+E   F  PSC  I  S++ +P  C+    + P    + ENLT+   +   + T   SW     V +  +    + Y++TW   + E  + ++           +S  S  +++  + N ++++ LQ  ++Y ++ Q
Sbjct:   56 PRHFQSNGSLGWCQSHKQCAKCLEPCKDSWELKDGPCR---DLCEHAFPKRHGECVTSCEFLRSVMVVKQGDCPPPERASGFAA-ACVEGCEEDGEC-SGQKKCCPNGCGHTCQSPKNLYRGA-PLKPRKELVFEELESGVLEVRWSSKFNV---SAEPVLNVLQRRWNYGIHPSEDGATEWQVVARTSEERVWLTDIRPGRWYQFRVAAVNVHGTRGYTTPSRHF----RSSKDPPPPPAPSDLHVSDMTFGADHSASVRLSWSISADLDIPVNHYKLSW-------SSSDHTLPPKLKKRETVNGDSTYAELDDLRENGSYTVELQAVSYW-GQVPLKSSKAILQFTT-SQTQSDLEPTVSPVFIKPQSDLLD------------VGTPFYQDGQLQVRVYWKKKDPTVNRYRVQWAPEFC----------SHNRSRTQEKLITQENFASLSGLQFSCKYKVIIQPVGLKGRA--------QVESTTFYTPSCATI-QSKSPKPIPCSSVPVVQPKVLVKAENLTAAFSVYLGNVTGLFSW----VVAMPQQPQQVTGYQVTWAEVITESRRNNL----------PNSLISQSQILPPERNILVVSGLQLASLYRLEVQ 609          
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Match: anos1b (anosmin 1b [Source:ZFIN;Acc:ZDB-GENE-000201-13])

HSP 1 Score: 117.087 bits (292), Expect = 7.660e-27
Identity = 100/445 (22.47%), Postives = 188/445 (42.25%), Query Frame = 3
Query:  195 QCTKACKGL--------PNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPI-YNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVE--RPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDI----KINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEII 1484
            QC + CK L        P  C+         C++  +FL+       G CP     +     +C+  C  D+EC + + KCC  GC + C  P      +P  P + I     +   ++  WMS++   +    P+ ++LQ R        E  A  WQT+++T +  + L +    + YQFR++AV++ G RGF  PS  F  + +   P  P + +  ++ L   +  G +SV + W    E    +  + V W          G   S+ ++  +    D T   L+ L+PNT Y  ++    YW  +    S     F +T   +       F+ +   P ++  + S+LR     +  + P Y + +  + +    ++ +++  SS Y + + P++C   +          T T++  + VI+   L F C+Y + ++ +
Sbjct:   74 QCLQPCKELWETRRALSPKTCE------HHECVTSAEFLRSLRVQKQGDCPPAQRASGFA-AACVESCARDREC-SGVKKCCSNGCGHTCQSPANLFKGVPLKPRRDISFSEDHQGHVKVTWMSKFNVSVE---PVLYVLQRRWNHGIHPSEDEASAWQTVLMTMEDRSVLKDIRPHRWYQFRVSAVNSQGTRGFTTPSKHFFSVRDPLPPETPQNARTANQTL---HPDGTVSVLVLWETPRESDLVVHHHKVTW-------SPRGTPSSSQSRAGRVTDGDVTQMELQGLQPNTPYTAQIQAISYWGQNRLKSSRAHISFTTTSQNSATSSNGEFSNEL--PVSH-SSPSVLR-----LEAAAPHYHDNQLQVKVFWKSRVQESQKDSSSYILRWYPEVCSHNVTKD-----EKTATVQGTHYVIT--GLLFACKYRVAVKPV 482          
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Match: anos1b (anosmin 1b [Source:ZFIN;Acc:ZDB-GENE-000201-13])

HSP 1 Score: 117.087 bits (292), Expect = 7.660e-27
Identity = 100/445 (22.47%), Postives = 188/445 (42.25%), Query Frame = 3
Query:  195 QCTKACKGL--------PNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPI-YNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVE--RPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDI----KINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEII 1484
            QC + CK L        P  C+         C++  +FL+       G CP     +     +C+  C  D+EC + + KCC  GC + C  P      +P  P + I     +   ++  WMS++   +    P+ ++LQ R        E  A  WQT+++T +  + L +    + YQFR++AV++ G RGF  PS  F  + +   P  P + +  ++ L   +  G +SV + W    E    +  + V W          G   S+ ++  +    D T   L+ L+PNT Y  ++    YW  +    S     F +T   +       F+ +   P ++  + S+LR     +  + P Y + +  + +    ++ +++  SS Y + + P++C   +          T T++  + VI+   L F C+Y + ++ +
Sbjct:   74 QCLQPCKELWETRRALSPKTCE------HHECVTSAEFLRSLRVQKQGDCPPAQRASGFA-AACVESCARDREC-SGVKKCCSNGCGHTCQSPANLFKGVPLKPRRDISFSEDHQGHVKVTWMSKFNVSVE---PVLYVLQRRWNHGIHPSEDEASAWQTVLMTMEDRSVLKDIRPHRWYQFRVSAVNSQGTRGFTTPSKHFFSVRDPLPPETPQNARTANQTL---HPDGTVSVLVLWETPRESDLVVHHHKVTW-------SPRGTPSSSQSRAGRVTDGDVTQMELQGLQPNTPYTAQIQAISYWGQNRLKSSRAHISFTTTSQNSATSSNGEFSNEL--PVSH-SSPSVLR-----LEAAAPHYHDNQLQVKVFWKSRVQESQKDSSSYILRWYPEVCSHNVTKD-----EKTATVQGTHYVIT--GLLFACKYRVAVKPV 482          
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Match: ANOS1 (anosmin-1-like [Source:NCBI gene;Acc:100535716])

HSP 1 Score: 107.457 bits (267), Expect = 1.094e-24
Identity = 78/287 (27.18%), Postives = 128/287 (44.60%), Query Frame = 3
Query:   87 ISMSRPSNAYQDL----TFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKW 929
            + ++R S A++ L    +    + +  C K     + S D     C+   ++C+   P     CL+ C+FL+    L  G CP+    +   + +C+  C SD +C  +L KCC  GC + C  P  +Y  S P  P + +      S  +E  W S++   +    P+ ++LQ R  S     E +A  W+ +   S+    L++    + YQFR+AAV+  G RGF  PS  F    + PS P     L  +   V + G +S+ I W    E   P+  Y + W
Sbjct:   44 LHITRISAAFRHLQSNGSLVWCENHKQCSKCLEPCRASWDLKENQCQ---DLCETQFPKKHYECLTSCEFLRSVQTLKQGDCPAEEKASGF-EAACVQSCDSDSDC-TSLKKCCSNGCGHTCQTPKNVYKGS-PLKPRKDLQFVEHPSGQLELRWSSRFNVSVE---PVLYVLQRRWNSGIHPTEDHATHWRDIAQVSEERVVLSDVRPSRWYQFRVAAVNVHGTRGFTAPSKHFRSHRD-PSPPPCPSALRVVNMSVCADGLLSLRIHWSLPAESDVPVHHYKIFW 320          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 151.369 bits (381), Expect = 1.088e-37
Identity = 140/606 (23.10%), Postives = 257/606 (42.41%), Query Frame = 3
Query:  141 QCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLST--PSLTHGRLEEI--FNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKD-LSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASE---PPKCADYLTLIPSQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            Q +  C K     KE+ D     C    N+C+   P     CL+ C+FLK  L +  G CP+    +     +C+  C +D EC + + KCC  GC + C  P  +Y   +P  P + +    P    ++ +W S++   +    P+ +++Q R        E  A  WQT+   +    +L++    + YQFR+AAV+  G RGF  PS  F    + PS P +   L        + G +SV I W   +E   P+  Y V W     +  +    + A  +  ++    + +  L+ L+ N+ Y VE+    YW G   L S   +L+ ST  PS +  ++ +I     D   P    + + +L        +  P Y++ +  + +     +D +  LY V + P+ C           H  T+  E  ++ I +  L F+C+Y + +     K   K   +       +F  P C+ +      +   P   A  ++ + ++PENL++   +   + T   SW+  +S +  H+ +  + +++TW     E  + S+           +S  S  +++  D   + + NL+P  +Y ++ Q
Sbjct:   83 QNHKQCSKCLEPCKETWDLRKNNCH---NLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAA-ACVESCDADNEC-SGVKKCCSNGCGHTCQVPKNLYK-GVPLKPRKELTFDEPQPGHLDIKWSSKFNISVE---PVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPDIPVHHYKVFW----SWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYW-GQVRLKSGKVSLYFSTSPPSTSLDQISKISKMKTDILAPPQRKRTARMLE-------IGAPFYQDNQLQVKVYWKKTEDSMLGLYHVQWFPESCA----------HNETKGPEKADHHIVLPALLFSCKYKVTVHPARPKDHLKAESI-------FFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQ--LSKVNLHQPM--TGFQVTWAEVTTESRQNSL----------PNSIISQSQILPADHYMLTVHNLRPSMLYKLEVQ 635          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 148.288 bits (373), Expect = 7.172e-37
Identity = 142/640 (22.19%), Postives = 269/640 (42.03%), Query Frame = 3
Query:   48 VDLAIVIFTLNVFISMSRPSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLST--PSLTHGRLEEI--FNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKD-LSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIE---SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASE---PPKCADYLTLIPSQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            +     ++ +N+F+          + +    Q +  C K     KE+ D     C    N+C+   P     CL+ C+FLK  L +  G CP+    +     +C+  C +D EC + + KCC  GC + C  P  +Y   +P  P + +    P    ++ +W S++   +    P+ +++Q R        E  A  WQT+   +    +L++    + YQFR+AAV+  G RGF  PS  F    + PS P +   L        + G +SV I W   +E   P+  Y V W     +  +    + A  +  ++    + +  L+ L+ N+ Y VE+    YW G   L S   +L+ ST  PS +  ++ +I     D   P    + + +L        +  P Y++ +  + +     +D +  LY V + P+ C           H  T+  E   ++++ I +  L F+C+Y + +     K   K   +       +F  P C+ +      +   P   A  ++ + ++PENL++   +   + T   SW+  +S +  H+ +  + +++TW     E  + S+           +S  S  +++  D   + + NL+P  +Y ++ Q
Sbjct:    4 IQPGFALWNINIFMK--------NNGSLIWCQNHKQCSKCLEPCKETWDLRKNNCH---NLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAA-ACVESCDADNEC-SGVKKCCSNGCGHTCQVPKNLYK-GVPLKPRKELTFDEPQPGHLDIKWSSKFNISVE---PVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPDIPVHHYKVFW----SWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYW-GQVRLKSGKVSLYFSTSPPSTSLDQISKISKMKTDILAPPQRKRTARMLE-------IGAPFYQDNQLQVKVYWKKTEDSMLGLYHVQWFPESCA----------HNETKGPEKAVTQDHHIVLPALLFSCKYKVTVHPARPKDHLKAESI-------FFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQ--LSKVNLHQPM--TGFQVTWAEVTTESRQNSL----------PNSIISQSQILPADHYMLTVHNLRPSMLYKLEVQ 582          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 147.132 bits (370), Expect = 2.624e-36
Identity = 141/613 (23.00%), Postives = 259/613 (42.25%), Query Frame = 3
Query:  129 FASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLST--PSLTHGRLEEI--FNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKD-LSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIE---SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASE---PPKCADYLTLIPSQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            F   QC   C       KE+ D     C    N+C+   P     CL+ C+FLK  L +  G CP+    +     +C+  C +D EC + + KCC  GC + C  P  +Y   +P  P + +    P    ++ +W S++   +    P+ +++Q R        E  A  WQT+   +    +L++    + YQFR+AAV+  G RGF  PS  F    + PS P +   L        + G +SV I W   +E   P+  Y V W     +  +    + A  +  ++    + +  L+ L+ N+ Y VE+    YW G   L S   +L+ ST  PS +  ++ +I     D   P    + + +L        +  P Y++ +  + +     +D +  LY V + P+ C           H  T+  E   ++++ I +  L F+C+Y + +     K   K   +       +F  P C+ +      +   P   A  ++ + ++PENL++   +   + T   SW+  +S +  H+ +  + +++TW     E  + S+           +S  S  +++  D   + + NL+P  +Y ++ Q
Sbjct:   70 FKHFQCLEPC-------KETWDLRKNNCH---NLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAA-ACVESCDADNEC-SGVKKCCSNGCGHTCQVPKNLYK-GVPLKPRKELTFDEPQPGHLDIKWSSKFNISVE---PVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPDIPVHHYKVFW----SWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYW-GQVRLKSGKVSLYFSTSPPSTSLDQISKISKMKTDILAPPQRKRTARMLE-------IGAPFYQDNQLQVKVYWKKTEDSMLGLYHVQWFPESCA----------HNETKGPEKAVTQDHHIVLPALLFSCKYKVTVHPARPKDHLKAESI-------FFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQ--LSKVNLHQPM--TGFQVTWAEVTTESRQNSL----------PNSIISQSQILPADHYMLTVHNLRPSMLYKLEVQ 622          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 147.132 bits (370), Expect = 3.290e-36
Identity = 140/609 (22.99%), Postives = 259/609 (42.53%), Query Frame = 3
Query:  141 QCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLST--PSLTHGRLEEI--FNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKD-LSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIE---SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASE---PPKCADYLTLIPSQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            Q +  C K     KE+ D     C    N+C+   P     CL+ C+FLK  L +  G CP+    +     +C+  C +D EC + + KCC  GC + C  P  +Y   +P  P + +    P    ++ +W S++   +    P+ +++Q R        E  A  WQT+   +    +L++    + YQFR+AAV+  G RGF  PS  F    + PS P +   L        + G +SV I W   +E   P+  Y V W     +  +    + A  +  ++    + +  L+ L+ N+ Y VE+    YW G   L S   +L+ ST  PS +  ++ +I     D   P    + + +L        +  P Y++ +  + +     +D +  LY V + P+ C           H  T+  E   ++++ I +  L F+C+Y + +     K   K   +       +F  P C+ +      +   P   A  ++ + ++PENL++   +   + T   SW+  +S +  H+ +  + +++TW     E  + S+           +S  S  +++  D   + + NL+P  +Y ++ Q
Sbjct:   83 QNHKQCSKCLEPCKETWDLRKNNCH---NLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAA-ACVESCDADNEC-SGVKKCCSNGCGHTCQVPKNLYK-GVPLKPRKELTFDEPQPGHLDIKWSSKFNISVE---PVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPDIPVHHYKVFW----SWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYW-GQVRLKSGKVSLYFSTSPPSTSLDQISKISKMKTDILAPPQRKRTARMLE-------IGAPFYQDNQLQVKVYWKKTEDSMLGLYHVQWFPESCA----------HNETKGPEKAVTQDHHIVLPALLFSCKYKVTVHPARPKDHLKAESI-------FFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQ--LSKVNLHQPM--TGFQVTWAEVTTESRQNSL----------PNSIISQSQILPADHYMLTVHNLRPSMLYKLEVQ 638          
BLAST of Anosmin-1 vs. Ensembl Xenopus
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:Xenbase;Acc:XB-GENE-5855370])

HSP 1 Score: 144.821 bits (364), Expect = 1.597e-35
Identity = 138/606 (22.77%), Postives = 254/606 (41.91%), Query Frame = 3
Query:  141 QCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLST-PSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKD-LSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIE---SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASE---PPKCADYLTLIPSQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            Q +  C K     KE+ D     C    N+C+   P     CL+ C+FLK  L +  G CP+    +     +C+  C +D EC + + KCC  GC + C  P  +Y   +P  P + +    P    ++ +W S++   +    P+ +++Q R        E  A  WQT+   +    +L++    + YQFR+AAV+  G RGF  PS  F    + PS P +   L        + G +SV I W   +E   P+  Y V W     +  +    + A  +  ++    + +  L+ L+ N+ Y VE+    YW G   L S   +L+ ST P +           D   P    + + +L        +  P Y++ +  + +     +D +  LY V + P+ C           H  T+  E   ++++ I +  L F+C+Y + +     K   K   +       +F  P C+ +      +   P   A  ++ + ++PENL++   +   + T   SW+  +S +  H+ +  + +++TW     E  + S+           +S  S  +++  D   + + NL+P  +Y ++ Q
Sbjct:   80 QNHKQCSKCLEPCKETWDLRKNNCH---NLCEPLFPKKHYECLTSCEFLKSVLSVKQGDCPAPEKASGFAA-ACVESCDADNEC-SGVKKCCSNGCGHTCQVPKNLYK-GVPLKPRKELTFDEPQPGHLDIKWSSKFNISVE---PVIYVVQRRWNYGIHPSEDDASNWQTMAQITDERVQLSDIRPSRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSPPPAPTNLRISNLTTNNEGTVSVRITWDLPEEPDIPVHHYKVFW----SWTANRKSVVPAKKKRRKTTEGSQNSVALDGLQANSNYMVELQAITYW-GQVRLKSGKVSLYFSTSPPMDQISKISKMKTDILAPPQRKRTARMLE-------IGAPFYQDNQLQVKVYWKKTEDSMLGLYHVQWFPESCA----------HNETKGPEKAVTQDHHIVLPALLFSCKYKVTVHPARPKDHLKAESI-------FFTTPPCSTLKGKTHKQINCPSDTAPVVSKVLAKPENLSATFNVQEANITGYFSWQ--LSKVNLHQPM--TGFQVTWAEVTTESRQNSL----------PNSIISQSQILPADHYMLTVHNLRPSMLYKLEVQ 632          
BLAST of Anosmin-1 vs. UniProt/SwissProt
Match: sp|P23352|KALM_HUMAN (Anosmin-1 OS=Homo sapiens OX=9606 GN=ANOS1 PE=1 SV=3)

HSP 1 Score: 152.14 bits (383), Expect = 3.737e-37
Identity = 148/605 (24.46%), Postives = 264/605 (43.64%), Query Frame = 3
Query:  141 QCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLS-SLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKC----ADYLTLIPSQPENLTSKLI-NPTSKTYELSWRHPISVMVRHEDIYH--SRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            Q +  C K     KES D     C+   + C+   P     CL+ C+FLK  L +  G CP+    +     +C+  C+ D EC + + KCC  GC + C  P  +Y   +P  P + +      S  +E +W S++   I    P+ +++Q R        E  A  WQT+  T+    +L +    + YQFR+AAV+  G RGF  PS  F    + PS P +   L    + V S G ++VTI W   +E   P+  Y V W     ++ S    +    +  ++    + + +LE L+P+  Y VE+    YW G   L S   +L  ++   T+ + E++      G  T        R     + +  P Y++G+  + +     +D + + Y V + P+ C    +     +  S  T E   N I +++L F+C+Y + ++ I  KS  K   +       +F  P C+ +   ++ +P  C       L+ + ++PENL++  I    + T   SW+      +   ++Y   + +++TW     E  + S+           +S  S  +++  D   + + NL+P T+Y ++ Q
Sbjct:   78 QNHKQCSKCLEPCKESGDLRKHQCQ---SFCEPLFPKKSYECLTSCEFLKYILLVKQGDCPAPEKASGFAA-ACVESCEVDNEC-SGVKKCCSNGCGHTCQVPKTLYK-GVPLKPRKELRFTELQSGQLEVKWSSKFNISIE---PVIYVVQRRWNYGIHPSEDDATHWQTVAQTTDERVQLTDIRPSRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSAPPAPANLRLANSTVNSDGSVTVTIVWDLPEEPDIPVHHYKVFW----SWMVSSKSLVPTKKKRRKTTDGFQNSVILEKLQPDCDYVVELQAITYW-GQTRLKSAKVSLHFTSTHATNNK-EQLVKTRKGGIQTQLPFQR--RRPTRPLEVGAPFYQDGQLQVKVYWKKTEDPTVNRYHVRWFPEACAH--NRTTGSEASSGMTHE---NYIILQDLSFSCKYKVTVQPIRPKSHSKAEAV-------FFTTPPCSAL-KGKSHKPVGCLGEAGHVLSKVLAKPENLSASFIVQDVNITGHFSWK------MAKANLYQPMTGFQVTWAEVTTESRQNSL----------PNSIISQSQILPSDHYVLTVPNLRPSTLYRLEVQ 635          
BLAST of Anosmin-1 vs. UniProt/SwissProt
Match: sp|P33005|KALM_CHICK (Anosmin-1 OS=Gallus gallus OX=9031 GN=ANOS1 PE=2 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 1.763e-34
Identity = 160/669 (23.92%), Postives = 277/669 (41.41%), Query Frame = 3
Query:   48 VDLAIVIFTLNVFISMSRPSNA---YQDLTFASAQCYALCL-----------KNF-----LKIKESKDQCTKA---CKG----LPNMCDIGC----PSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYL--SNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIE-----SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIP---SQPENLTSKLI-NPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
              LA++++   V  S + P  A    QD  F++A+C + CL           K+F     L   ++  QC+K    CK       N C   C    P     CL+ C+FLK  L +  G CP+    +     +C+  C++D EC + + KCC  GC + C  P  +Y   +P  P + +      S D+E +W S++   I    P+ +++Q R        E  A  WQT+  T+    +L++    + YQFR+AAV+  G RGF  PS  F    + PS P +   +        + G ++V I W   +E   P+  Y V W   Y       + I A  +  +     +   VLE L+PN+ Y VE+     W G   L S   +L  ST        E+      + P          +    T +L    P Y++ +  + +         + ++V    + C+          H  T+ +E     +  N + +++L F+C+Y + +     KS  K   +       +F  PSC+             A+ + ++P   ++PENL++  I    + T   SW+  IS  V H+ +  + +++TW     E  + S+           +S  S  +++  D   + + NL+P  +Y ++ Q
Sbjct:    8 ASLALLLWVTAVSGSPAGPGAATARRQDEAFSTARCTSRCLSLQITRISAFFKHFQNNGSLAWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAA-ACVESCEADSEC-SGVKKCCSNGCGHTCQVPKNLYK-GVPLKPRKELKFIELQSGDLEVKWSSKFNISIE---PVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSAPPAPSNIRIANISANNDGTVNVMITWDLPEEPDIPVHHYKVFWSWTY-----SKYVIPAKKKRRKITDGPQNYVVLEGLQPNSNYNVELQAVTRW-GQIRLKSAKVSLHFSTAQDNRNNNEQ--TSAGKPPKGLVDPYPTFQRRKPTRFLKIGTPFYQDNQLQVKVYWKKTDINMNQFQVHSLLESCV----------HNDTKGLEKVTELTYENYMILKDLSFSCKYKVTVLPAKSKSRFKAESI-------FFVTPSCSAFKEKTHKHINCAAEEVPVLPKVLAKPENLSASFIVQEGNITGHFSWK--ISKAVLHQPM--TGFQVTWAEVTTESRQNSL----------PNSIISQSQILPADHYVLTVPNLRPSMLYRLEVQ 630          
BLAST of Anosmin-1 vs. UniProt/SwissProt
Match: sp|Q90369|KALM_COTJA (Anosmin-1 OS=Coturnix japonica OX=93934 GN=ANOS1 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 1.488e-33
Identity = 147/616 (23.86%), Postives = 255/616 (41.40%), Query Frame = 3
Query:  114 YQD-LTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIE-----SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIP---SQPENLTSKLI-NPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            +QD  + A  Q Y  C K     KES D     C+     C+   P     CL+ C+FLK  L +  G CP+    +     +C   C++D EC + + KCC  GC + C  P  +Y   +P  P + +      S D+E +W S++   I    P+ +++Q R        E  A  WQT+  T+    +L++    + YQFR+AAV+  G RGF  PS  F    + PS P +   +        + G ++V I W   +E   P+  Y V W   Y       + I A  +  +     +   VLE L+PN+ Y VE+     W G   L S   +L  ST        E+   +       +   +   R     + +  P Y++ +  + I    +    + ++V    + C           H  T+ +E     +  N + +++L F+C+Y + +     KS  K   +       +F  P C+             A+ + ++P   ++PENL++  I    + T   SW+  IS  V H+ +  + +++TW     E  + S+           +S  S  +++  D   + + NL+P  +Y ++ Q
Sbjct:   62 FQDNGSLAWCQNYKQCSKCLEPCKESWDLKRNHCQSF---CEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAA-ACFESCEADSEC-SGVKKCCSNGCGHTCQVPKNLYK-GVPLKPRKELKFIELQSGDLEVKWSSKFNISIE---PVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHF-RSSKDPSAPPAPSNIRIANISANNDGTVNVMITWDLPEEPDIPVHHYKVFWSWTYS-----KYVIPAKKKRRKITDGPQNYVVLEGLQPNSNYNVELQAVTRW-GQIRLKSAKVSLHFSTTQDNRNNNEQTSVEKPPKGVVDPYPTFQRRKPTRFLKIGTPFYQDNQLQVKIYWKKSGINMNQFQVHSLLESCT----------HNDTKGLEKVTELTYENYMILKDLSFSCKYKVTVLPAKSKSRFKAESI-------FFVTPPCSTFKEKTHKHINCAAEEVPVLPKVLAKPENLSASFIVQEGNITGHFSWK--ISKAVLHQPM--TGFQVTWAEVTTESRQNSL----------PNSIISQSQILPADHYVLTVPNLRPSMLYRLEVQ 630          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A4S2LCX3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008155 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 3.489e-111
Identity = 234/752 (31.12%), Postives = 372/752 (49.47%), Query Frame = 3
Query:  117 QDLTFASAQCYALCLKNFLKIKESKD----------------------------QCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNP-------------IKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKIPNSSDI-EFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRH---NDVTVYLSNPIYKNGETSLDIKIN------DNKDL-----------SSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGY--------------FCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPI-----SVMVRHEDIYHS------RYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQXXXXXXXXX-XXESDMSIHYF-----NTGGETIYSMGGSWATRSTMNSVSLSIATLMTTIVI 2093
            ++  F  A+C A CL+ F    E K+                            QC  AC   P+ C   C S E GC  GC  L +++ L  G+CP     NP             +   +CL+ C+SD +C N L+KCC +GC  IC+EP  N+++P LPA L PI+   S  I E +W   Y        P+ FILQTR+C C++   +    WQTLI+T + GA+L+ F+ GK+YQFR+AAV+  G RGFG PS P+P     P+ P+  + L++ + R YS G I V + W   +     ++EY + W+ID+GYVQ  G ++  LT+FT +VP ++T YVL++L+P+T Y+++V    YW+G   L S+P+T+FL T S+            Y   AT  ++S+ L      D T   S       +++L I +       D+ +L           +S Y+++++P++CI+  +N      +S R ++    V+ +++L FNC+Y +Q+  ++ +   K  LL P    G               FC PSC ++  S    P  C+  L      P  L  + +      Y ++W+ PI     + +VR + +  +      +YR+ W PR+ EP+ + MY    G  PIMD  +S+V++++K+   I L NL+ +T+YIV+ Q L  L     E ES  ++ YF     N  G+  +S+G S A  +     +L I   +T + I
Sbjct:   37 EERLFLRARCKAKCLRLFQNPLEQKEFQVRWSPDPKSSVGFSDCFVKDSENCSSQCFSACDQPPDQCMQSCSSEEVGCHIGCTLLLDSVSLRPGQCPLVALANPEVEKASDKSVETSLDHSACLNMCRSDNDCLNPLYKCCSLGCRQICIEPQLNNTVPPLPAALNPIESKASPGIMELDWSGPYARANKVIGPIVFILQTRICICKQLSPAQLTDWQTLIMTHEFGAKLDAFEPGKMYQFRIAAVTPHGTRGFGPPSQPYPIDPVPPNPPSPPRNLTDSMWRFYSNGNIHVLLNWAPPEHSELTVTEYLIDWVIDHGYVQPGGQSLEGLTKFTHTVPAEQTQYVLQELRPSTAYKIQVRAMSYWHGYGPLESQPNTIFLFTQSVMPA---------YHQQATTVRHSNELLQTQPKDETREESVACECGTKSALGIPLQLKKVFYDSSELIAAFAFTPPTPASTYQLNWSPQVCINAKENTAVLSQKSLR-VQGTKRVVFLKDLRFNCRYLVQLSQLTHELSSKDELLWPSVHGGVSQPQDGRLYTAQNCFCTPSCLDVEISRGDSPKNCS--LPDPGPPPPPLNLRAVRVEDMRYRITWKPPIFAELQNRLVRRQQVRSAPLPSVTKYRVLWAPRVEEPVIREMYNDEVGFSPIMDLQQSDVRIVDKNQTWIDLPNLKEKTLYIVRVQTLSALDHQGYERESSPAVLYFVTPQTNRPGKHAHSLGKSTAKATLKVDSTLWIVQSLTMLFI 776          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A4Z2D796 (Anosmin-1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003808 PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 3.390e-109
Identity = 231/689 (33.53%), Postives = 357/689 (51.81%), Query Frame = 3
Query:  147 YALCLKNFLKIKESKDQCTK----ACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLD--------TNPIKQ--------------PSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQL-IPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRW---LKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFN--QDYQGPATNCKNSSILRHNDV----------TVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXP-------------IQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISV-----MVRHEDIYHS--------------RYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQXXXXXXXXXXXESDMSIHYFNT 1991
            ++ C +N      S++QC+     AC   PN C   C +   GC  GC  +K+TLD   G CP + +        ++ ++Q                C+S C+ D +C + L  CC+  C   C  P+YN+ +P  P  L   +   N + ++  W SQY+   N  NP+ FILQ R+C+C+ FDESYA KWQTLI+T + G  L  F+ G++YQFR+AAVS  G RGFG+ +  +P    +PS P   + + + L R+YS+GKIS+ +RW   L+SD    P++EY + W ID+GY+Q+DG +I AL QFTQ++  ++T  +L +LKP+TTY+++V    YW+G  +L S+P+T+FLST S+     ++  N  Q Y  P T    +     +            ++ +    Y + +    ++IN +  +     V + P++CID  DN       ST  ++SK+  + ++NL FNC+Y +QI +      + H  +K              I   G FC P C+NI +SE   P  C      +P  P +L  K+I+  +  Y +SWR   ++     + R+ D   S              +YRI W PR++EP+ +SMY    G  PIMD  + +V+VI+K+   I L  L+P T YIV+ Q L    DG+E ES+    YF T
Sbjct:   74 WSTCFEN------SREQCSSGCFTACDLPPNECSTRCTAQATGCHIGCILIKQTLDNRPGLCPKSFEHLTPNNNQSSSVEQINQKYHNGHNYPTVNQCVSNCQMDNDCKDPLQICCRSDCHQYCTIPVYNELVPPRPTHLNSTVSSTNVNIMKLFWSSQYQNVTNTNNPIVFILQIRICTCKMFDESYATKWQTLIMTHEFGVNLEAFEPGRLYQFRIAAVSIHGTRGFGLGTNAYPVDPIKPSPPGPPRNVIDSLWRLYSSGKISLLLRWQPPLRSD---LPLTEYLIIWSIDHGYLQTDGQSIEALIQFTQTINAERTECILHNLKPSTTYKIQVKAISYWHGYGSLESQPNTIFLSTQSIHPAFHQQSINPVQVYATPNTIQPQTEFTLQSKSSHCECGTGPQSLIVKKVFYDDQKLKALLQINMSVKIDGTTLVHWYPQVCIDS-DNPSLNTIPSTILLKSKDKTVLLDNLCFNCRYGVQIRVYPTILDETHLAVKESVIQGEKQQFNSVIDYSGCFCTPPCSNIVNSEGRLPNNCLSSELELPFPPTHL--KVIHTGNLDYRISWRQQSAIATSDRITRNADKRPSLSSPINNKPNRNSTKYRIMWAPRIHEPVDESMYNDKIGFTPIMDLQQIDVRVIDKNQTWIALKQLKPNTFYIVRVQTLHISHDGIERESNPVSVYFTT 750          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A4E0RJ34 (Anosmin-1 OS=Fasciola hepatica OX=6192 GN=D915_003272 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 2.197e-108
Identity = 224/724 (30.94%), Postives = 349/724 (48.20%), Query Frame = 3
Query:  105 SNAYQDLTFASAQCYALCLKNFLKIKES----------------------------KDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLD----------TNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIP-IKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSL-----THGRLEEIFNQDYQGPATNCKNSSILRHNDVT---VYLSNPIYKNGETSLDIKIN-DNKDLSSLYRVSFTPKICIDPLDNQM--SEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXX-------XXXXXXPIQI-------------EGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSW---------------------RHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQXXXXXXXXXXXESDMSIHYFNTGGET 2003
            SN  ++  +  AQC A CL+ F    E                               +C  AC G P  C   C +   GC  GC  L+E++D   G+CP   D          T   +   C  +C+ D  C ++LHKCC IGC+ +C +P +NDS+P +P  LIP I   +++ +  +W + Y        P+ FILQTR+C+C+  D ++   WQTLI+T Q GA+L+ F+ GK+YQFR+AAVS  G RGFG  +  +P   E PS P+  + +++ + R YS+G ISV + W        PI+EY + W++D+GYVQS GH++  LTQF+Q V PD+  YV+++LKP T+Y+V+V+   YW+G   L S+P+T+FLST S+         +E+ F    +   T  K++     +D       L    Y  G           NK    L  V ++P++CI+  +N +   +QH     + S+  V+++ NL FNC+Y ++I  +  +            H   P+                  FC PSC  +  +E   P  CA      P  P  LT+   + +  +Y + W                     +H  + +     +  ++YR+ W PR+ EP+ + MY    G  PIMD+ +S+V+++ ++   I L +LQ  T YIV+ Q L+T   G + ES     YF T  +T
Sbjct:   33 SNWMEERLYLRAQCKAKCLRLFQSANEQDLFKPTWVQTSAQWSLLSKCFRNNSEHCSSECFTACDGPPKECLSSCSTQGIGCRIGCHHLQESVDPRPGQCPRPADMPKPALKRSPTKLTETMRCGKECRLDSSCSDSLHKCCSIGCNRVCTQPTFNDSVPPMPDSLIPQISEVSNAILALDWSAPYSQLTKICGPIVFILQTRICACKMLDATHLSDWQTLIMTHQFGAKLDAFEPGKMYQFRIAAVSPHGTRGFGPETEAYPSRPEIPSVPSPPRNVTDSMWRFYSSGSISVLLSWQPPIRTDLPITEYVINWVVDHGYVQSGGHSLEGLTQFSQKVAPDRLQYVIQNLKPATSYKVQVIAVSYWHGHGQLKSQPNTIFLSTQSIHPVYTRQSTMEDGFRVSMRSFPTEQKSNCECGPDDPAQKLFRLEKTFYDRGSLMAKFLFTPPNKGTDHL--VEWSPQVCINSKENDILTLKQH---ILVSSRTRVVTLGNLSFNCRYMVKITSVDRQRQSRDRNWFDSSHDSSPLTAISPFDDHDSVSVKRSCFCTPSCLEVEVAEGPAPINCAPTDPGPPLPPAGLTAAQTS-SPLSYRIQWNPPKVDETQSETPTSSTLANRQHTRAALSNQSPLLGTKYRVIWAPRVEEPVNKEMYNDDVGFSPIMDTQQSDVRIVEENQTWIELRDLQSGTFYIVRVQTLITSETGYQRESSPVAVYFVTPVKT 750          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A3R7GSU6 (Anosmin-1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=ANOS1 PE=4 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 1.042e-107
Identity = 212/652 (32.52%), Postives = 336/652 (51.53%), Query Frame = 3
Query:  249 SSEPGCLSGCKFLKETLDLHSGKCPSTLDTNP---------IKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKIPNSSDI-EFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHN---------------------DVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXX--------------XPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPI-----SVMVRHEDIYHS------RYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQXXXXXXXXX-XXESDMSIHYF-----NTGGETIYSMG 2018
            S E GC  GC  L +++ L  G+CP     NP         + Q +CL+ C+SD +C N L+KCC +GC  IC+EP  N+++P LP  L PI+   S  I E +W   Y        P+ FILQTR+C C++   +    WQTLI+T + GA+L+ F+ GK+YQFR+AAVS  G RGFG PS P+P     P+ P+  + L++ + R YS G I V + W+  +     ++EY + W+ID+GYVQ  GH++  LT+FT +VP ++T YVL++L+P+T Y+V+V    YW+G   L S+P+T+FL T S+            Y   AT  ++S+ L H                       + + L    Y +GE             +S Y+++++P++CI+  +N      +S R ++    V+ +++L FNC+Y +Q+  ++ +   K  LL               P   +  FC PSC ++  S    P  C+  L      P  L  + +      Y ++W+ PI     + +VR + +  +      +YR+ W PR+ EP+ + MY    G  PIMD  +S+V++++K+   I L NL+ +T+YIV+ Q L  L     E ES  ++ YF     N  G   +S+G
Sbjct:    1 SEEVGCHIGCSLLLDSVSLRPGQCPLAALANPEVEQASDKSVDQSACLNMCRSDNDCLNPLYKCCSLGCRQICIEPQLNNTVPSLPEALNPIESKASPGIMELDWSGPYARANKVIGPIVFILQTRICICKQLSPAQLTDWQTLIMTHEFGAKLDAFEPGKMYQFRIAAVSPHGTRGFGPPSQPYPIDPVPPNPPSPPRNLTDSMWRFYSNGNIHVLLNWVPPEHSELTVTEYLIDWVIDHGYVQPGGHSLEGLTKFTHTVPAEQTQYVLQELRPSTAYKVQVRAMSYWHGYGPLESQPNTIFLFTQSVMPA---------YHQQATMVRHSNELLHTKPKDETREESVACECGTKSALGIPLQLKKVFYDSGELIAAFAFTPPTP-ASTYQLNWSPQVCINAKENSAVLSQKSLR-VQGTKRVVFLKDLRFNCRYMVQLRQLTHELSSKDELLWPPVHSEVSQPQDGHPYTAQNCFCTPSCLDVEISRGDSPKNCS--LPDPGPPPPPLNLRAVRVEDMRYRITWKPPILAELQNRLVRRQQVRSAPLPSVTKYRVLWAPRIEEPVIREMYNDEVGFSPIMDLQQSDVRIVDKNQTWIDLPNLKEKTLYIVRVQTLSALDHQGYERESSPAVLYFVTPQTNRPGTHAHSLG 639          
BLAST of Anosmin-1 vs. TrEMBL
Match: A0A504YS35 (Anosmin-1 OS=Fasciola gigantica OX=46835 GN=FGIG_03019 PE=4 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 8.201e-107
Identity = 222/724 (30.66%), Postives = 345/724 (47.65%), Query Frame = 3
Query:  105 SNAYQDLTFASAQCYALCLKNFLKIKES----------------------------KDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLD----------TNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIP-IKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSL-----THGRLEEIFNQDYQGPATNCKNSSILRHNDVT---VYLSNPIYKNGETSLDIKIN-DNKDLSSLYRVSFTPKICIDPLDNQM--SEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXX-------XXXXXXPIQI-------------EGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHP---------------------ISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQXXXXXXXXXXXESDMSIHYFNTGGET 2003
            SN  ++  +  AQC A CL+ F    E                               +C  AC G P  C   C +   GC  GC  L+E++D   G+CP   D          T   +   C  +C+ D  C ++LHKCC IGC+ +C +P +NDS+P +P  LIP I   +++ +  +W + Y        P+ FILQTR+C+C+  D +    WQTLI+T Q GA+L+ F+ GK+YQFR+AAVS  G RGFG  +  +P   E PS P+  + +++ + R YS+G ISV + W        PI+EY + W++D+GYVQS GH++  LTQF+Q V PD+  YV+++LKP T+Y+V+V+   YW+G   L S+P+T+FLST S+         +E+ F    +   T  K++     +D       L    Y  G           NK    L  V ++P +CI+  +N +   +QH     + S+   +++ NL FNC+Y ++I  +  +            H   P+                  FC PSC  +  +E   P  C+      P  P  LT+   + +  +Y + W  P                      + +     +  ++YR+ W PR+ EP+ + MY    G  PIMD+ +S+V+++ ++   I L +LQ  T YIV+ Q L+T   G + ES     YF T  +T
Sbjct:   33 SNWMEERLYLRAQCKAKCLRLFQSANEQDLFKPTWIQTSAQWSLLSKCFRNNSEHCSSECFTACDGPPKECISSCSTQGIGCRIGCHHLQESVDPRPGQCPRPADMPKPALKRSPTKLTETMRCGKECRLDSSCSDSLHKCCSIGCNRVCTQPTFNDSVPPMPDSLIPQISEVSNAILALDWSAPYSQLTKICGPIVFILQTRLCACKMLDATQLSDWQTLIMTHQFGAKLDAFEPGKMYQFRIAAVSPHGTRGFGPETEAYPSRPEIPSVPSPPRNVTDSMWRFYSSGSISVLLSWQPPIRTDLPITEYVINWVVDHGYVQSGGHSLEGLTQFSQKVAPDRLQYVIQNLKPATSYKVQVIAVSYWHGHGQLKSQPNTIFLSTQSIHPVYTRQSTMEDRFRVSIRSFPTEQKSNCECGLDDPAQKLFRLEKTFYDRGSLMAKFLFKPPNKGTDHL--VEWSPHVCINSKENDILTLKQH---ILVSSRTRAVTLGNLSFNCRYMVKITSVDGQRQSGDRNWFDSSHDSSPLTAMSPFDDHDLVSVKRSCFCTPSCLEVEVAEGPAPINCSPTDPGPPPPPAGLTAAQTS-SPLSYRIQWNPPKFDETQSETLTSSTLANRQRTRAALSNQSPLLGTKYRVIWAPRVEEPVNKEMYNDDVGFSPIMDTQQSDVRIVEENQTWIELRDLQSGTFYIVRVQTLITSETGYQRESSPVAVYFVTPVKT 750          
BLAST of Anosmin-1 vs. Ensembl Cavefish
Match: anos1a (anosmin-1-like [Source:NCBI gene;Acc:103026549])

HSP 1 Score: 134.035 bits (336), Expect = 2.587e-32
Identity = 141/607 (23.23%), Postives = 253/607 (41.68%), Query Frame = 3
Query:  141 QCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTG---KISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQ--SVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVY-LSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIE---SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEG-YFCVPSCTNIASSEASEPPKCADYLTLIP----SQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMY 1910
            Q +  C K     KES +    +C+    +C+   P     C++ C+FL+  + +  G+CP+          +C+  C+ D EC ++  KCC  GC + C  P  ++  +  +   +L+  ++P +  +E  W S++        P+  +LQ R        E  A +WQ +  TS+    L++   G+ YQFR+AAV+  G RG+  PS  F        +PA     SEL  +  S G    +SV + W    +   P+  Y + W          G  +S   +  +  ++  D T+  LE L+ N +Y +E+    YW G   L S  +TL  +T               Y+       +SS+ + +   V  +  P Y++G+  + +         S YRV + P+ C           H  +R  E   +++N  S+  L F+C Y + I+    K          +Q E   F  PSC ++   ++ +P  C       P    ++ ENL++   ++  + T   SW     V V       + Y++TW     E  K ++           +S  S  +++  + N ++++ LQ  ++Y
Sbjct:   68 QGHKQCAKCLEPCKESWELKDGSCR---ELCEHTFPKRHGECVTSCEFLRSVMVVKQGECPAPERAAGFAA-ACVEGCEEDGEC-SSHKKCCPNGCGHTCQSPRNLFRGAPLKPRKELLFEELP-TGVLEVRWSSKFNV---SAEPVLNVLQRRWNYGIHPSEDGATEWQVVAQTSEERVWLSDVRPGRWYQFRVAAVNVHGTRGYTTPSRHF----RSSKDPAPPPAPSELQVKHLSFGPDRSVSVHVSWAAPADLDVPVHHYKLSWSWSV-----SGAELSTPPKLKRRKTINGDSTSAELEGLRENRSYTLELQAVSYW-GQLPLKSSKTTLRFTT---------------YRSEPQPTVSSSVPQKSQSDVLDVGTPFYQDGQLQVRVYWKKRDPTVSRYRVHWFPEFC----------SHNGSRIQEKLITQDNYASLPGLQFSCTYKVIIQPAGSKGR--------VQAESTVFYTPSCASL-QGKSPKPILCPGEPATAPPKVLARAENLSAAFNVHKGNVTGLFSW----VVAVPQSPQQVTGYQVTWAEVTAESRKNNL----------ANSLISQSQILPPERNILVVSGLQLASLY 607          
BLAST of Anosmin-1 vs. Ensembl Cavefish
Match: ANOS1 (anosmin 1 [Source:HGNC Symbol;Acc:HGNC:6211])

HSP 1 Score: 121.709 bits (304), Expect = 2.508e-28
Identity = 130/578 (22.49%), Postives = 252/578 (43.60%), Query Frame = 3
Query:  225 NMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGK---ISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLST-PSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSL-YRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKC-ADYLTLIPSQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYH--SRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            ++C+   P     CL+ C+FL+       G CP+    +     +C+  C+ D EC     KCC  GC + C  P  +Y  +  +   +L+ ++ P +  +E  W S++   +    P+ +++Q R        E  A  WQ +   ++   +L +    + YQFR+AAV+  G RGF  P   FP     P +P+ +K +S +     S+GK   ++  + W   +E   P+  + V W     +       +    +  ++    K++  LE L  N++Y VE+    YW G   L S  ++L  ST P   H ++     ++ + PA   + +S+L        +  P Y++G+  + +      D S+  + V +T + C     N+ S+  +S     ++ N I++  L F+C+Y + +  +  K   +            F  PSC+ +  ++  +P  C  +    + ++PENLT+    +  + T    WR      + H    H  + +++TW          +   T S    + +S  S  +++  D N +++ +L+P + Y ++ Q
Sbjct:   99 DLCETLFPKKHYECLTSCEFLRSVESAKQGDCPAPERASGFAA-ACVESCEEDAEC-PAHRKCCSNGCGHTCQVPRNLYKGAPLKPRKELVFVEQP-AGPLEVRWSSKFNISVE---PVVYVVQRRWNHGIHPSEDDATPWQDVAQVAEERVQLVDTRPSRWYQFRVAAVNVHGTRGFTAPQQTFPLDPSPPPSPSGLK-VSNI-----SSGKDGFLTARLDWTLPEESDVPVHHFKVFW----SWTVPGKALVPTKKKRRKTTSGAKSSVDLEGLVGNSSYTVELQAVAYW-GQVRLKSPKASLQFSTAPENNHSKISTKLKKE-EFPAGK-RPASMLE-------VGTPFYQDGQLQVRVYWKKRGDSSATRHHVQWTAEHCS---HNETSQPEKSV----TQENYINLPGLLFSCKYRVSVYTLKNKRRSEDDSTT-------FITPSCSTL-RTKTHKPITCPGEGAPKVLAKPENLTASFSTHEGNVTGNFHWR------ISHPQPQHTITGFQVTW----------AEVTTTSRQNSLPNSIISQSQILPPDHNFLVVPSLRPASSYRLEVQ 619          
BLAST of Anosmin-1 vs. Ensembl Cavefish
Match: anos1b (anosmin-1 [Source:NCBI gene;Acc:103026226])

HSP 1 Score: 106.686 bits (265), Expect = 1.788e-23
Identity = 99/414 (23.91%), Postives = 179/414 (43.24%), Query Frame = 3
Query:  264 CLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPI-YNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVE--RPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQS-DGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTL-FLSTPSLTHGRLEEIFNQDYQGPATNCKNS-SILRHNDVTVYLSNPIYKNGETSLDI----KINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQI 1475
            C++  +FL        G CP+          +C+  C SD+EC +   KCC  GC + C  P      +P  P + +         +E  WMS++   I    P+ +ILQ R        E  A  W T+++T +  A L +    + YQFR++AV++ G RGF  PS  F    +   P  P   +  +E    V++ G +SV +RW    E    +  Y V W    G     +G     +T  T       T   L  L+P+T Y V++   V ++G + L S  + L F +  +          ++++       ++S S+LR     +  + P Y + +  + +    ++++++  SS Y +S+ P++C   +  +         T++  + +I+   L F C+Y + +
Sbjct:  109 CVTSAEFLLSLQSQKQGDCPAPQRATGFA-AACVESCSSDREC-SASKKCCSNGCGHTCQPPANLFKGVPLKPRKDMTFIEDQYGQLEVAWMSKFNVSIE---PVLYILQRRWNDGIHPSEDDASTWYTVLMTMEERAVLKDIRPQRWYQFRVSAVNSQGTRGFTTPSKHFFSTRDPLPPETPQKARVENET---VHADGSVSVLLRWDPPAEGDLVVDRYKVTWSARGGLAGGPNGKESGRVTDGT------LTEMQLGGLQPDTRYTVQI-QAVSFSGQKRLKSGRAQLSFTTAAAAAASTGSSPPSREFSNELPISRSSPSVLR-----LEAAAPHYHDNQLQVKVFWKSRVSESQKASSSYLLSWYPEVCGGNVTKR-----EKMATVQGTHFIIT--GLLFACKYKVAV 495          
BLAST of Anosmin-1 vs. Ensembl Medaka
Match: anos1 (anosmin 1 [Source:NCBI gene;Acc:100049494])

HSP 1 Score: 154.451 bits (389), Expect = 6.952e-39
Identity = 153/635 (24.09%), Postives = 272/635 (42.83%), Query Frame = 3
Query:   54 LAIVIFTLNVFISMSRPSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELP-AQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLS-SLYRVSFTPKICIDPLDNQMSEQHRSTRTIE---SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASE---PPKCADYLTLIPSQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            L++ I  ++ F   S+      + +    Q +  C K     KES D     C+   ++C+   P     CL+ C+FLK    +  G CP+    +     +C+  C+ D EC + + KCC  GC + C  P  +Y   +P  P  +L+ ++ P S  +E  W S++   +    P+ +++Q R        E  A +WQT+  T++   +L +    + YQFR+AAV+  G RGF  PS  F      P+ P S   L      +   G ++  + W    E   PI  Y V W     +       + +  +  +++   +    LE L+ N++Y VE+    YW G   L S  S+L  +T          + ++     AT+   S++ +     + +  P Y++G+  + +      D S S Y V + P+ C           H  TR  E   ++ N I++  L F+C+Y + ++++  K   K            F  PSC  I S        P + A     + ++PENLT+   I   + T    W   +S +  H  I  + +++TW   +N   +Q+          + +S  S  +++  D N ++++NL+P T Y ++ Q
Sbjct:   49 LSLHITRISAFFKHSQ-----NNGSLVWCQNHKQCSKCLEPCKESWDLKENQCQ---DLCEPLFPKKHYECLTSCEFLKSVEGVKQGDCPAPEKASGFAA-ACVESCEEDGEC-SAVKKCCSNGCGHTCQLPKNLYK-GVPLKPRKELVFLEHP-SGQLEIHWSSKFNISVE---PVLYVVQRRWNYGIHPSEDDATEWQTVAQTAEERIQLADTRASRWYQFRVAAVNVHGTRGFTAPSKHF-RSSRDPAAPPSAANLHVTNMSLADDGLVTARLNWTLPHEPDIPIHHYKVFW----SWTVPTKSMVPSKKKQRKTINGAQNWLDLEGLQQNSSYSVELQAITYW-GQVRLKSPKSSLHFTTNQNNESAKSMLKSKK---DATSPVGSTLAKRPSGALEVGTPFYQDGQLQVRVYWKKRGDPSVSRYHVQWMPEYC----------NHNETRGPEKSVTQENYINLPGLLFSCKYKVTVQLLKSKRRSKDESTT-------FLTPSCATIRSKTHKHIPCPGEGAAGHPKVLAKPENLTASFSIKDGNITGSFLWG--MSRVAPHHRI--TGFQVTWA-EINTESRQNS---------LPNSIISQSQILPPDPNMLVVSNLRPSTFYRLEVQ 628          
BLAST of Anosmin-1 vs. Ensembl Medaka
Match: anos1 (anosmin 1 [Source:NCBI gene;Acc:100049494])

HSP 1 Score: 153.68 bits (387), Expect = 1.455e-38
Identity = 149/606 (24.59%), Postives = 261/606 (43.07%), Query Frame = 3
Query:  141 QCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELP-AQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLS-SLYRVSFTPKICIDPLDNQMSEQHRSTRTIE---SKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASE---PPKCADYLTLIPSQPENLTSKL-INPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            Q +  C K     KES D     C+   ++C+   P     CL+ C+FLK    +  G CP+    +     +C+  C+ D EC + + KCC  GC + C  P  +Y   +P  P  +L+ ++ P S  +E  W S++   +    P+ +++Q R        E  A +WQT+  T++   +L +    + YQFR+AAV+  G RGF  PS  F      P+ P S   L      +   G ++  + W    E   PI  Y V W     +       + +  +  +++   +    LE L+ N++Y VE+    YW G   L S  S+L  +T          + ++     AT+   S++ +     + +  P Y++G+  + +      D S S Y V + P+ C           H  TR  E   ++ N I++  L F+C+Y + ++++  K   K            F  PSC  I S        P + A     + ++PENLT+   I   + T    W   +S +  H  I  + +++TW   +N   +Q+          + +S  S  +++  D N ++++NL+P T Y ++ Q
Sbjct:   73 QNHKQCSKCLEPCKESWDLKENQCQ---DLCEPLFPKKHYECLTSCEFLKSVEGVKQGDCPAPEKASGFAA-ACVESCEEDGEC-SAVKKCCSNGCGHTCQLPKNLYK-GVPLKPRKELVFLEHP-SGQLEIHWSSKFNISVE---PVLYVVQRRWNYGIHPSEDDATEWQTVAQTAEERIQLADTRASRWYQFRVAAVNVHGTRGFTAPSKHF-RSSRDPAAPPSAANLHVTNMSLADDGLVTARLNWTLPHEPDIPIHHYKVFW----SWTVPTKSMVPSKKKQRKTINGAQNWLDLEGLQQNSSYSVELQAITYW-GQVRLKSPKSSLHFTTNQNNESAKSMLKSKK---DATSPVGSTLAKRPSGALEVGTPFYQDGQLQVRVYWKKRGDPSVSRYHVQWMPEYC----------NHNETRGPEKSVTQENYINLPGLLFSCKYKVTVQLLKSKRRSKDESTT-------FLTPSCATIRSKTHKHIPCPGEGAAGHPKVLAKPENLTASFSIKDGNITGSFLWG--MSRVAPHHRI--TGFQVTWA-EINTESRQNS---------LPNSIISQSQILPPDPNMLVVSNLRPSTFYRLEVQ 628          
BLAST of Anosmin-1 vs. Ensembl Medaka
Match: anos1b (anosmin 1b [Source:NCBI gene;Acc:100049297])

HSP 1 Score: 82.4185 bits (202), Expect = 6.609e-16
Identity = 81/358 (22.63%), Postives = 144/358 (40.22%), Query Frame = 3
Query:  195 QCTKACKGLPNMCDIGCPSS---EPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEP--IYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPST----------PFPEIVERPSNP----ASVKGLSELLTRVYSTG-KISVTIRWLKSDEYVFPISEYAVKWM-IDYGYVQSDGHAISA----LTQFTQSVPPD-------------------KTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLST 1136
            QC + C+ L     +  P +   +  C++  +FL        G CP           +C+  C SD+ C ++  KCC  GC + C  P  +Y   +P  P + +     +   ++  W+S++   +    P+ ++L++R        E +A  W  + +T      L +    + YQFR+AAV++ G+RGF  PS           P P +  R SN     A ++ + ++  R   +G  ++V + W    E    I  Y + WM +         H++ A    L +  Q  P +                   +    ++ L P T Y + V +  YW G + L S  + L  +T
Sbjct:   75 QCLQPCEELWETRTVLPPKACEKQTECMTSREFLASLRSSRQGDCPPPQRATGFAA-ACVESCSSDQHCPSS-RKCCFNGCGHTCQAPANLYK-GVPLKPRREMSFTEDSEGHVKVGWVSKFNVSME---PVVYLLESRWNIGIHPSEDHASPWSAVAMTLSEEVLLTDLRPQRWYQFRVAAVNSQGSRGFTTPSKHYISSKDPSPPEPPMNIRVSNQTLNWAGLQLMPKVTERSSESGTTVAVLLNWEPPSEGDLLIRNYRITWMPLHVHTAHKHTHSLQANAQRLHKNKQKWPTNSHRQEQKKKESNTVLTAGAQNELWVQGLLPGTPYSLSVQSVAYW-GQKRLKSHRAQLVFTT 425          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000069895.1 (SMESG000069895.1)

HSP 1 Score: 1374.76 bits (3557), Expect = 0.000e+0
Identity = 689/690 (99.86%), Postives = 690/690 (100.00%), Query Frame = 3
Query:   27 MYLNKFPVDLAIVIFTLNVFISMSRPSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQXXXXXXXXXXXESDMSIHYFNTGGETIYSMGGSWATRSTMNSVSLSIATLMTTIVIS 2096
            MYLNKFPVDLAIVIFTLNVFISMSRPSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSS+LRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIISLKSFKKHHLLKPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQLLVTLLDGLELESDMSIHYFNTGGETIYSMGGSWATRSTMNSVSLSIATLMTTIVIS
Sbjct:    1 MYLNKFPVDLAIVIFTLNVFISMSRPSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSMLRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIISLKSFKKHHLLKPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQLLVTLLDGLELESDMSIHYFNTGGETIYSMGGSWATRSTMNSVSLSIATLMTTIVIS 690          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000069895.1 (SMESG000069895.1)

HSP 1 Score: 1330.08 bits (3441), Expect = 0.000e+0
Identity = 667/668 (99.85%), Postives = 668/668 (100.00%), Query Frame = 3
Query:   93 MSRPSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQXXXXXXXXXXXESDMSIHYFNTGGETIYSMGGSWATRSTMNSVSLSIATLMTTIVIS 2096
            MSRPSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSS+LRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIISLKSFKKHHLLKPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQLLVTLLDGLELESDMSIHYFNTGGETIYSMGGSWATRSTMNSVSLSIATLMTTIVIS
Sbjct:    1 MSRPSNAYQDLTFASAQCYALCLKNFLKIKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSMLRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIISLKSFKKHHLLKPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQLLVTLLDGLELESDMSIHYFNTGGETIYSMGGSWATRSTMNSVSLSIATLMTTIVIS 668          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000067656.1 (SMESG000067656.1)

HSP 1 Score: 270.781 bits (691), Expect = 4.788e-80
Identity = 186/606 (30.69%), Postives = 309/606 (50.99%), Query Frame = 3
Query:  177 IKESKDQCTKACKGLPNMC-DIGCPSSEPGCLSGCKFLKETLDLHS-GKCP--STLDTNPIKQ--PSCLSKCKSDKECF-NTLHKCCKI-GCSNICVEPIYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSL---THGRLE---------EIFNQDYQGPATNCKNSSILRH---NDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            + ++K  C+K C    +M  D  C  S+ GC+  C+F K+     S  +CP  S+LD   +K     C   CK+  +C  N L  CC +  C  IC++ I    +     + +P K+  S +IEF+W   +K F+N+ +PL FILQTR C C KF++ YA  WQTLI T +    L+ FD G IYQFRLAAV  +G+ GFG  S   P ++ RP  P   + + +   ++    K  V I+W KS +  +   E+ V WM+D+G  Q DG  +S+LTQ+++++P ++    ++ LKP TTY+V+++ KV+W     + S PST++++TP+    T   LE         +I+N  +Q     C  S   +H    D  +   +P  +N +  +D+KI       S Y V   P+ CI+     +S+  +  R    + + + + NL F+C+Y +++   S K     + L        FC P C   +S+   +   C      +PS P+   S L+N  + TY++SW+    +  R   +  ++YRI+W PR  EP+    Y       P+++  +S+VK+++ +    +L NL    +Y+++ Q
Sbjct:   75 LNDTKTGCSKQCIQSCSMVGDCICQPSDIGCMLACQFRKKINKESSPDECPAMSSLDETTMKNLNSQCPKNCKTKSDCHPNQL--CCPVESCDMICLQ-IERRKLNYPKYKPVPTKLNTSVNIEFDWSQTFKPFLNKDSPLIFILQTRSCLCHKFNDKYATPWQTLIRTHKLRVELDTFDKGTIYQFRLAAVQHNGSDGFGPISDNLPTVISRPPPPLPPENVIDYKWQITDENKFRVEIKWSKSVDPFWRSYEFQVSWMVDHGVAQPDGEPLSSLTQYSKTLPGNEDRCTIDSLKPATTYKVQIVVKVFWPSFGPITSIPSTIYIATPNTKDSTEFYLESTKLFIFGIKIYNHLFQNKIKEC--SCPEKHANKKDFKIRSIHPSNRNLQVVIDMKI------FSDYLVEGYPEACINTGSENLSKSFQRFRKTYKRTDQLILNNLRFHCRYSVEVTKTSGKVPNATYHLC-------FCTPPC---SSNNQYQSKYCNKEDISLPS-PKEPRSVLLNLDTMTYKISWKPSHRISPRSRFLGVTKYRISWAPRKFEPVNIEHYLETKDFKPLINLDESDVKIVHSNVTLFLLHNLTKEQVYVIRIQ 658          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000067656.1 (SMESG000067656.1)

HSP 1 Score: 267.7 bits (683), Expect = 3.826e-79
Identity = 180/591 (30.46%), Postives = 301/591 (50.93%), Query Frame = 3
Query:  177 IKESKDQCTKACKGLPNMC-DIGCPSSEPGCLSGCKFLKETLDLHS-GKCP--STLDTNPIKQ--PSCLSKCKSDKECF-NTLHKCCKI-GCSNICVEPIYNDSIPELPAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXXXXXXXXXXXPIQIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKTYELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            + ++K  C+K C    +M  D  C  S+ GC+  C+F K+     S  +CP  S+LD   +K     C   CK+  +C  N L  CC +  C  IC++ I    +     + +P K+  S +IEF+W   +K F+N+ +PL FILQTR C C KF++ YA  WQTLI T +    L+ FD G IYQFRLAAV  +G+ GFG  S   P ++ RP  P   + + +   ++    K  V I+W KS +  +   E+ V WM+D+G  Q DG  +S+LTQ+++++P ++    ++ LKP TTY+V+++ KV+W     + S PST++++TP+       E + +       + K  SI           +P  +N +  +D+KI       S Y V   P+ CI+     +S+  +  R    + + + + NL F+C+Y +++   S K     + L        FC P C   +S+   +   C      +PS P+   S L+N  + TY++SW+    +  R   +  ++YRI+W PR  EP+    Y       P+++  +S+VK+++ +    +L NL    +Y+++ Q
Sbjct:   75 LNDTKTGCSKQCIQSCSMVGDCICQPSDIGCMLACQFRKKINKESSPDECPAMSSLDETTMKNLNSQCPKNCKTKSDCHPNQL--CCPVESCDMICLQ-IERRKLNYPKYKPVPTKLNTSVNIEFDWSQTFKPFLNKDSPLIFILQTRSCLCHKFNDKYATPWQTLIRTHKLRVELDTFDKGTIYQFRLAAVQHNGSDGFGPISDNLPTVISRPPPPLPPENVIDYKWQITDENKFRVEIKWSKSVDPFWRSYEFQVSWMVDHGVAQPDGEPLSSLTQYSKTLPGNEDRCTIDSLKPATTYKVQIVVKVFWPSFGPITSIPSTIYIATPNTKDS--TEFYLEKKHANKKDFKIRSI-----------HPSNRNLQVVIDMKI------FSDYLVEGYPEACINTGSENLSKSFQRFRKTYKRTDQLILNNLRFHCRYSVEVTKTSGKVPNATYHLC-------FCTPPC---SSNNQYQSKYCNKEDISLPS-PKEPRSVLLNLDTMTYKISWKPSHRISPRSRFLGVTKYRISWAPRKFEPVNIEHYLETKDFKPLINLDESDVKIVHSNVTLFLLHNLTKEQVYVIRIQ 632          
BLAST of Anosmin-1 vs. Planmine SMEST
Match: SMESG000010608.1 (SMESG000010608.1)

HSP 1 Score: 240.35 bits (612), Expect = 1.691e-68
Identity = 172/625 (27.52%), Postives = 307/625 (49.12%), Query Frame = 3
Query:  180 KESKDQCTKACK-----GLPNM-CDIGCPSSEPGCLSGCKFLKETLDLHSGKCPSTLDTNPIKQPSCLSKCKSDKECF--NTLHKCCKIGCSNICVEPIYNDSIPELPAQLIPIKI---PNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDESYADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFPEIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVKWMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTKVYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQD---YQGPATNCKNSSILRHNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICID------------PLDNQMSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIIXXX-XXXXXXXXXPIQIEGY-----FCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKT-YELSWRHPISVMVRHE-----DIY---HSRYRITWGPRLNEPIKQSMY--ATYSGIVPIMDSSKSNVKVINKDANSIILTNLQPRTMYIVKAQ 1925
            +E    CT  C+     GL    C   C  +  GCL GC+FL   + +  G CP   + + +       +C  D++C     + KCC + C    V P ++   P++   L P  I    + S  E  W     +F     P+ ++LQ R    R F+ + A  W+TL+IT + G  L +   G  YQFR+A+V+  G  GF   S P  ++ + P++P   + L++   R+ + GKI++ + W++   +  P++EY + W+ D+G+ Q DG ++ ALT F Q+VP ++ +Y +E L  + TY+V+V     W G  AL+S P+T+FL+TP L     E + ++D     G   +C +       D  + +S P Y      +D+ I ++K  + +Y++S+ P +CID            P  + ++E +R  R I +     ++  L F+C+Y +Q++ + ++ S +K      +  E +     FC PSC  +     S+P   +  L  +     N  + ++ P +K  ++ S ++P S +V  E     DI    + R+R+ WGP +++ + +          ++P +D S++  KV+ ++ +SI L NL+  T YIV+ Q
Sbjct:  102 QEFTTSCTTGCEYSGSSGLGGKDCSNQCQPNSSGCLEGCQFLNTAIKMSLGNCPEKFEIDKLLD----RECHLDQQCMIEGDVRKCCNLRC----VVPQFH---PKIGPSLWPPTIMEGKDGSSFEMTWKYDDTSFSEPMLPILYVLQVRTYFNRDFETTKASNWKTLLITFREGVNLQDLQPGMWYQFRVASVTKYGTNGFKSFSPPV-KLAKTPASPGVPRNLTDGAWRIRANGKINIRVHWMEPAAFDIPVTEYKISWVRDHGFTQPDGQSLEALTDFVQTVPGNQRSYDIEGLVADKTYKVQVRAICKW-GSAALISTPNTIFLTTPQLPVRESERLVSKDSSSLSGDQCSCVDGP----QDGRIKISEPYYHKNSLKIDLFITNSKK-NLVYKISYAPNVCIDTESSSLFVNDLQPSPSDINEIYRE-RGITAALPNATLGPLQFSCRYTLQVQPLRIRPSKRKIKKDVNLDDEQFVLTFCFCTPSCLKL----ISQPQYQSTNLRCL-----NRANPILEPPNKILFQRSHKNPESFLVFWEYTEKSDILLLPNVRFRVIWGPSIDDHVDRKFMQPGINQLLLPRIDMSQAETKVLKENVSSIWLENLKKNTFYIVQVQ 698          
The following BLAST results are available for this feature:
BLAST of Anosmin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ANOS17.782e-3824.46anosmin 1 [Source:HGNC Symbol;Acc:HGNC:6211][more]
back to top
BLAST of Anosmin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kal-13.660e-1825.06KALlmann syndrome homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Anosmin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Kal12.705e-1523.72gene:FBgn0039155 transcript:FBtr0084549[more]
back to top
BLAST of Anosmin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
anos1a3.328e-3423.51anosmin 1a [Source:ZFIN;Acc:ZDB-GENE-000201-9][more]
anos1b7.660e-2722.47anosmin 1b [Source:ZFIN;Acc:ZDB-GENE-000201-13][more]
anos1b7.660e-2722.47anosmin 1b [Source:ZFIN;Acc:ZDB-GENE-000201-13][more]
ANOS11.094e-2427.18anosmin-1-like [Source:NCBI gene;Acc:100535716][more]
back to top
BLAST of Anosmin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc41.088e-3723.10proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
psmc47.172e-3722.19proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
psmc42.624e-3623.00proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
psmc43.290e-3622.99proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
psmc41.597e-3522.77proteasome 26S subunit, ATPase 4 [Source:Xenbase;A... [more]
back to top
BLAST of Anosmin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anosmin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P23352|KALM_HUMAN3.737e-3724.46Anosmin-1 OS=Homo sapiens OX=9606 GN=ANOS1 PE=1 SV... [more]
sp|P33005|KALM_CHICK1.763e-3423.92Anosmin-1 OS=Gallus gallus OX=9031 GN=ANOS1 PE=2 S... [more]
sp|Q90369|KALM_COTJA1.488e-3323.86Anosmin-1 OS=Coturnix japonica OX=93934 GN=ANOS1 P... [more]
back to top
BLAST of Anosmin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LCX33.489e-11131.12Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2D7963.390e-10933.53Anosmin-1 OS=Schistosoma japonicum OX=6182 GN=EWB0... [more]
A0A4E0RJ342.197e-10830.94Anosmin-1 OS=Fasciola hepatica OX=6192 GN=D915_003... [more]
A0A3R7GSU61.042e-10732.52Anosmin-1 (Fragment) OS=Clonorchis sinensis OX=799... [more]
A0A504YS358.201e-10730.66Anosmin-1 OS=Fasciola gigantica OX=46835 GN=FGIG_0... [more]
back to top
BLAST of Anosmin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
anos1a2.587e-3223.23anosmin-1-like [Source:NCBI gene;Acc:103026549][more]
ANOS12.508e-2822.49anosmin 1 [Source:HGNC Symbol;Acc:HGNC:6211][more]
anos1b1.788e-2323.91anosmin-1 [Source:NCBI gene;Acc:103026226][more]
back to top
BLAST of Anosmin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anosmin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anosmin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anosmin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
anos16.952e-3924.09anosmin 1 [Source:NCBI gene;Acc:100049494][more]
anos11.455e-3824.59anosmin 1 [Source:NCBI gene;Acc:100049494][more]
anos1b6.609e-1622.63anosmin 1b [Source:NCBI gene;Acc:100049297][more]
back to top
BLAST of Anosmin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069895.10.000e+099.86SMESG000069895.1[more]
SMESG000069895.10.000e+099.85SMESG000069895.1[more]
SMESG000067656.14.788e-8030.69SMESG000067656.1[more]
SMESG000067656.13.826e-7930.46SMESG000067656.1[more]
SMESG000010608.11.691e-6827.52SMESG000010608.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017664 ID=SMED30017664|Name=Anosmin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2188bp
GCTTATTGTTTGTTTGAATTTTTCAAATGTATCTGAATAAATTTCCAGTC
GATTTGGCAATTGTAATTTTCACTTTGAACGTTTTTATTTCGATGTCCCG
ACCATCGAATGCGTATCAGGATTTAACATTCGCGTCTGCTCAATGCTATG
CCTTGTGTCTGAAAAATTTTCTGAAAATCAAAGAATCAAAAGACCAATGT
ACAAAGGCTTGCAAAGGATTGCCGAACATGTGTGACATCGGATGTCCGAG
TTCTGAACCTGGCTGTTTATCTGGATGTAAATTTCTGAAAGAAACCTTAG
ATCTACATTCAGGAAAGTGTCCTTCGACATTAGACACAAATCCAATCAAA
CAACCTTCATGTTTGTCCAAATGCAAATCAGATAAAGAATGTTTTAATAC
CTTGCACAAATGCTGCAAAATCGGATGTAGTAATATCTGTGTAGAACCCA
TTTACAATGACTCTATTCCCGAACTTCCAGCTCAATTAATTCCCATCAAA
ATTCCAAATTCCAGTGATATAGAATTCGAATGGATGTCCCAATATAAAAC
TTTTATCAATGAGAAAAATCCTCTATTTTTTATTCTTCAAACAAGGGTTT
GCTCCTGTAGGAAGTTTGATGAATCATACGCAGATAAATGGCAAACACTA
ATCATTACCAGTCAATCCGGTGCCAGACTCAATGAATTTGATCATGGAAA
AATTTATCAATTTCGACTAGCGGCAGTTTCTGCCGACGGCGCCAGAGGAT
TTGGAGTCCCATCGACTCCTTTTCCAGAAATAGTAGAACGGCCAAGCAAC
CCGGCCTCAGTGAAAGGACTCTCAGAGTTGTTGACACGAGTTTATAGTAC
TGGAAAAATCAGCGTTACGATTCGTTGGCTCAAATCGGATGAATACGTGT
TTCCCATCTCAGAATATGCGGTCAAATGGATGATTGACTATGGCTATGTA
CAATCTGACGGCCATGCCATTTCTGCTTTGACTCAATTCACGCAATCTGT
ACCGCCGGACAAAACGGCTTACGTCTTAGAAGACCTAAAACCCAATACAA
CCTACAGAGTGGAGGTATTAACAAAGGTTTACTGGAATGGTGATGAAGCA
TTGGTATCGGAACCTTCGACCTTATTTCTTTCCACTCCTTCATTGACTCA
CGGAAGGTTAGAAGAAATTTTCAATCAAGATTATCAGGGACCAGCAACAA
ATTGTAAAAACAGCTCCATATTACGTCATAATGATGTCACTGTCTATCTA
TCGAATCCTATATATAAAAACGGCGAAACGAGTTTGGACATAAAAATAAA
TGATAATAAAGATTTATCATCTTTATATCGTGTTAGCTTCACTCCGAAAA
TTTGTATAGATCCTCTAGATAATCAGATGAGTGAACAACATAGAAGTACC
AGGACCATCGAGTCAAAAAACAATGTTATCTCAATTGAAAATCTTTATTT
CAACTGCCAGTATTATATCCAAATAGAAATAATTTCTTTAAAGTCCTTCA
AAAAGCATCATTTGTTGAAGCCGATTCAAATTGAAGGTTATTTCTGTGTG
CCCTCTTGTACGAACATTGCCAGTTCTGAAGCTTCCGAACCTCCGAAATG
TGCTGATTATTTGACCCTTATTCCTTCTCAGCCGGAAAATCTGACTAGTA
AACTAATCAATCCCACGAGTAAAACATACGAATTGTCTTGGAGACATCCA
ATATCAGTTATGGTACGCCATGAAGATATTTACCATTCCAGATACCGGAT
AACATGGGGTCCCCGTCTCAATGAGCCTATCAAACAGAGTATGTATGCTA
CATACAGTGGCATAGTTCCTATAATGGATTCCTCGAAATCCAATGTCAAA
GTTATAAACAAAGATGCCAACTCAATAATCCTAACAAACCTCCAACCAAG
GACAATGTATATAGTCAAGGCTCAACTTTTAGTTACTTTATTAGACGGAT
TAGAGTTGGAATCAGACATGTCAATCCATTATTTCAACACAGGAGGGGAA
ACCATATACTCGATGGGAGGCAGTTGGGCGACACGGAGCACAATGAATTC
TGTCAGTTTGTCAATTGCCACGCTTATGACAACTATTGTGATATCTTTAC
TCTAATGTTTTTTTCTGTTGTTAGCGCCTTTGTCTCAACAAATTGCCGAC
GTCTTTCAAAGAAATAAAAAATATCCTCTGAAAAAAAA
back to top

protein sequence of SMED30017664-orf-1

>SMED30017664-orf-1 ID=SMED30017664-orf-1|Name=SMED30017664-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=693bp
MYLNKFPVDLAIVIFTLNVFISMSRPSNAYQDLTFASAQCYALCLKNFLK
IKESKDQCTKACKGLPNMCDIGCPSSEPGCLSGCKFLKETLDLHSGKCPS
TLDTNPIKQPSCLSKCKSDKECFNTLHKCCKIGCSNICVEPIYNDSIPEL
PAQLIPIKIPNSSDIEFEWMSQYKTFINEKNPLFFILQTRVCSCRKFDES
YADKWQTLIITSQSGARLNEFDHGKIYQFRLAAVSADGARGFGVPSTPFP
EIVERPSNPASVKGLSELLTRVYSTGKISVTIRWLKSDEYVFPISEYAVK
WMIDYGYVQSDGHAISALTQFTQSVPPDKTAYVLEDLKPNTTYRVEVLTK
VYWNGDEALVSEPSTLFLSTPSLTHGRLEEIFNQDYQGPATNCKNSSILR
HNDVTVYLSNPIYKNGETSLDIKINDNKDLSSLYRVSFTPKICIDPLDNQ
MSEQHRSTRTIESKNNVISIENLYFNCQYYIQIEIISLKSFKKHHLLKPI
QIEGYFCVPSCTNIASSEASEPPKCADYLTLIPSQPENLTSKLINPTSKT
YELSWRHPISVMVRHEDIYHSRYRITWGPRLNEPIKQSMYATYSGIVPIM
DSSKSNVKVINKDANSIILTNLQPRTMYIVKAQLLVTLLDGLELESDMSI
HYFNTGGETIYSMGGSWATRSTMNSVSLSIATLMTTIVISLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0003001lateral region of the whole animal
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR036645Elafin-like_sf
IPR042447Anosmin-1
IPR036116FN3_sf
IPR003961FN3_dom
IPR013783Ig-like_fold
IPR008197WAP_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030414peptidase inhibitor activity
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 148..240
e-value: 100.0
score: 2.7
coord: 264..355
e-value: 1.8
score: 17.5
coord: 533..641
e-value: 0.14
score: 21.3
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 274..349
e-value: 3.3E-6
score: 27.3
IPR003961Fibronectin type IIICDDcd00063FN3coord: 256..365
e-value: 5.14582E-6
score: 43.2539
IPR003961Fibronectin type IIICDDcd00063FN3coord: 533..631
e-value: 1.81584E-4
score: 39.0167
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 529..636
e-value: 1.0E-5
score: 27.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 269..370
e-value: 5.0E-8
score: 35.1
IPR036645Elafin-like superfamilyGENE3DG3DSA:4.10.75.10coord: 92..144
e-value: 8.1E-7
score: 30.8
IPR008197WAP-type 'four-disulfide core' domainPFAMPF00095WAPcoord: 94..141
e-value: 5.6E-7
score: 29.8
IPR008197WAP-type 'four-disulfide core' domainPROSITEPS51390WAPcoord: 91..142
score: 11.819
NoneNo IPR availablePANTHERPTHR14131:SF6ANOSMIN 1Acoord: 38..638
NoneNo IPR availableCDDcd00199WAPcoord: 79..142
e-value: 3.44789E-6
score: 42.8223
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..29
score: 0.487
IPR042447Anosmin-1PANTHERPTHR14131KALLMANN SYNDROME 1 PROTEINcoord: 38..638
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 159..349
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 532..633