Fer-1-related

Overview
NameFer-1-related
Smed IDSMED30017663
Length (bp)6375
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fer-1-related (SMED30017663) t-SNE clustered cells

Violin plots show distribution of expression levels for Fer-1-related (SMED30017663) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fer-1-related (SMED30017663) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fer-1-related (SMED30017663) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017663

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017663SMESG000070967.1 Contig42957uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017663SMESG000070967.1 Contig42957newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017663SMESG000070967.1 Contig48307uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017663SMESG000070967.1 Contig48307newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017663SMESG000077057.1 SMESG000070967.1 Contig51096uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017663SMESG000077057.1 SMESG000070967.1 Contig51096newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017663SMESG000070967.1 dd_Smed_v4_4648_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1583.54 bits (4099), Expect = 0.000e+0
Identity = 896/2075 (43.18%), Postives = 1248/2075 (60.14%), Query Frame = 1
Query:  109 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTF-KKPKEPA--AHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            ++ A+NL + +   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E       GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGR+L+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+ + N  L IADRL   +E++ +AL A    E+    V    D+LI   S+P+   D +++P  T LD+YL  +R   L Q+   A+ ++   + +  A+   + ++ +L++L+ EPQNS+PD++IWML G KR  Y R+PAH V++S    +Y G+ CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYEN+   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    +     + PAEKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T +   ++ PTWDQTL+F E+EI G+P  V+E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ +GE+LA+FE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +QL ++ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+EELY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+   K+P  P   A  L SL         P+    EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E ++G  DFC+TF L RG   E  +D     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET +DLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++R+  P Y   D +    K +++ + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MWVD+ P ALG PGPPFNI  R+A+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRF+FPFDY+P+E    + KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:    6 LVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEVDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPL--GDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPM----EKVPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVMDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDIDDKEPLIPIQLADGLSSLAPT-NTASPPSSPHEEEFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVY-RTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2052          
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1580.46 bits (4091), Expect = 0.000e+0
Identity = 896/2089 (42.89%), Postives = 1248/2089 (59.74%), Query Frame = 1
Query:  109 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKS-TKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTF-KKPKEPA--AHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            ++ A+NL + +   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGR+L+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+ + N  L IADRL   +E++ +AL A    E+    V    D+LI   S+P+   D +++P  T LD+YL  +R   L Q+   A+ ++   + +  A+   + ++ +L++L+ EPQNS+PD++IWML G KR  Y R+PAH V++S    +Y G+ CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYEN+   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    +     + PAEKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T +   ++ PTWDQTL+F E+EI G+P  V+E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ +GE+LA+FE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +QL ++ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+EELY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+   K+P  P   A  L SL         P+    EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E ++G  DFC+TF L RG   E  +D     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET +DLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++R+  P Y   D +    K +++ + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MWVD+ P ALG PGPPFNI  R+A+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRF+FPFDY+P+E    + KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:    6 LVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPL--GDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPM----EKVPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVMDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDIDDKEPLIPIQLADGLSSLAPT-NTASPPSSPHEEEFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVY-RTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2066          
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1576.61 bits (4081), Expect = 0.000e+0
Identity = 891/2086 (42.71%), Postives = 1243/2086 (59.59%), Query Frame = 1
Query:  109 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPP-KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            ++ A+NL + +   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGR+L+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+ + N  L IADRL   +E++ +AL A    E+    V    D+LI   S+P+   D +++P  T LD+YL  +R   L Q+   A+ ++   + +  A+   + ++ +L++L+ EPQNS+PD++IWML G KR  Y R+PAH V++S    +Y G+ CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYEN+   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    +     + PAEKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T +   ++ PTWDQTL+F E+EI G+P  V+E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ +GE+LA+FE+         ++ G              D DLP+ PP +  NIY +P  I+P +QRTA+E+L WG+RNMK +QL ++ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+EELY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+           K P +P           +  EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E ++G  DFC+TF L RG   E  +D     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET +DLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++R+  P Y   D +    K +++ + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MWVD+ P ALG PGPPFNI  R+A+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRF+FPFDY+P+E    + KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:    6 LVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPL--GDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPM----EKVPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVMDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDI--------DDKEPLIP-----------IQEEEFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVY-RTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2045          
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1572.76 bits (4071), Expect = 0.000e+0
Identity = 893/2074 (43.06%), Postives = 1237/2074 (59.64%), Query Frame = 1
Query:  154 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTF-KKPKEPA--AHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGR+L+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+ + N  L IADRL   +E++ +AL A    E+    V    D+LI   S+P+   D +++P  T LD+YL  +R   L Q+   A+ ++   + +  A+   + ++ +L++L+ EPQNS+PD++IWML G KR  Y R+PAH V++S    +Y G+ CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYEN+   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    +     + PAEKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T +   ++ PTWDQTL+F E+EI G+P  V+E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ +GE+LA+FE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +QL ++ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+EELY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+   K+P  P   A  L SL         P+    EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E ++G  DFC+TF L RG   E  +D     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET +DLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++R+  P Y   D +    K +++ + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MWVD+ P ALG PGPPFNI  R+A+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRF+FPFDY+P+E    + KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPL--GDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPM----EKVPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVMDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDIDDKEPLIPIQLADGLSSLAPT-NTASPPSSPHEEEFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVY-RTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2065          
BLAST of Fer-1-related vs. Ensembl Human
Match: DYSF (dysferlin [Source:HGNC Symbol;Acc:HGNC:3097])

HSP 1 Score: 1569.29 bits (4062), Expect = 0.000e+0
Identity = 888/2071 (42.88%), Postives = 1232/2071 (59.49%), Query Frame = 1
Query:  154 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGR+L+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+ + N  L IADRL   +E++ +AL A    E+    V    D+LI   S+P+   D +++P  T LD+YL  +R   L Q+   A+ ++   + +  A+   + ++ +L++L+ EPQNS+PD++IWML G KR  Y R+PAH V++S    +Y G+ CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYEN+   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    +     + PAEKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T +   ++ PTWDQTL+F E+EI G+P  V+E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ +GE+LA+FE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +QL ++ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+EELY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+           K P +P           +  EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E ++G  DFC+TF L RG   E  +D     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET +DLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++R+  P Y   D +    K +++ + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MWVD+ P ALG PGPPFNI  R+A+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRF+FPFDY+P+E    + KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPL--GDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPM----EKVPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVMDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDI--------DDKEPLIP-----------IQEEEFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVY-RTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2044          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 394.815 bits (1013), Expect = 8.063e-111
Identity = 378/1546 (24.45%), Postives = 657/1546 (42.50%), Query Frame = 1
Query:  619 KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDAL----IGSFKFDLSMIYEEPKHNYMNKWLLLS-------DPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWN-------EELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPR--EYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATML---RISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQF-VISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDA----FVCQLKSLSVE----PQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLG-KWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVD-FNRPCDEEGWEYAVDPSLGG----YQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIK-KGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYT----IPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFF-DVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTE-EHDRLDDFPAFDPNVDLEIN-TFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPE 5118
            K  GKR  + +   KP  + + ++++EA+ +  G+          +   +     +   P+W  +  +       E     ++ ++   R +R  AL    +G F   LS +   P  + + KW+ L        +P+D      G+LK   ++    +  P+      +E           +G  L   T  +RV+  E L          I+Q       K+    Y++V     + +T+ +      D N       +E+ +P+Q+P++   +   LFD  +      IG   + +  +     E G+LPTFGP FLN +   R   +S    K       + DG  + GR+ + +   +      +A +  ++   +       +  ++      MS   +   + +   +   +S+G++G+  ++    +SS T P    +DG  Y+ +PWG+ +P + V   WE I  R+   N  +++ + L   I +++   N  I          +   +  I S SK +   +P  S    LD+++   R++++ ++     K   EA S+  +  ++DA     + +++S+++E     Q ++P V+I M++  K   + +IP  ++  SD+E   G  CG  + I +  P L++ ++ K   + A L  K+W G+  +   W    +   +    E YE Q   L  KW  ++ +    G  + + ++ L         GW   G W +     ++  K    T   +  F  + R   G W     +Y++   D     +     +GWE  G+W  D F    DE+GW Y+ +    G        EK++H  R+R   R R     +   ++ +       T  NE+WEY+P                          S K G   + +L    +        +        +     R+Y    +  K+QLR YI    +LL   +N  S  + R+ F   S+ T + + S  P W++T++FK V I G    + + PP ++VE+       E+  LG  E  P V +  N   R   QWFP+K    R  G +LA FE+Y   DKDL  L PK  + Y     IP   RP   +  V+ L WGVRN+KK +LL+V  P     IG        +K+V ++PNF  P + F +V+LP      PP+ I + D RAF R+P+VG+  + +  +Y    + + + D  + +   D  +  E +   +  + P     P +P                 +DWWS+YYAS+ QF +   Y E   + +  +++ LE    Y+ F DF  TF   +    + +D EE +  GE K    I  L + +        +D    PT     C++R+YII+A  L  +   G  D Y+K+  GK+  + K  Y     +P FG   +M   +P+ KDL + ++    +  D  IG T IDLENR L+++RAT GL   +   G  QWRD   P  IL+ +C K  +  P+
Sbjct:   83 KSFGKRKLQDT--DKPCTWNVLVRIIEAKDVSTGS---ARVRTIFDGNSKMTRTVTHAIPKWRQNILYTIKNQPLE----KLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIW--------SGAHLIDYTLKIRVFSVEQL----------IRQMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFD-KKGRGKTCIGKATLPMKMIYE-PGETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRG---SQQDGSRFVGRLFIAIDC-VEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFASDPVCIMMSIGSFGSTSNEFRSCNSS-TLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSS--NALDRHILDYRKEKILKLREHFEK---EAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWPTLVDQRNRKREHV-AVLHAKMWFGRTDQLTKWKEHVQPADIRRFMEMYEVQTKGLALKWKDEADIYD--GKWEKTNEVPL-------ENGWNAVGHWIVMNTRHMFVPKLGQHT-VHDKAFEIQKRTEDGTW--KHFKYTDCYADELKPKDLDKHAKGWE-VGSWAQDKFRNNGDEKGWVYSTNGVFFGSGVLTDREEKVHHNFRKRCIKRPR---KHEGYNKELEDFEHFRTTMGNENWEYSP--------------------------SKKEGP--YHDLEDRTDRIRRRRYVREVENKDPDSEDPRFRVYEYQMQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEEDKDLIPLEPKCKHNYKERSEIPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKVKSDHAERWEQLDLVITEEFDQIIRMVRVPTLTTDPMVP-----------------LDWWSRYYASMSQFHRSPGYPESGMEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKGKPPAAINTVVDFVG-PTR----CLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPK 1520          

HSP 2 Score: 146.747 bits (369), Expect = 1.134e-34
Identity = 115/356 (32.30%), Postives = 171/356 (48.03%), Query Frame = 1
Query: 5203 LGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVV---RNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDL----AALPSPA-------KKRAN--------------CKLEILPEFGKNI------------------------EFVNLFDCKRIMGYWPVF----------------DNSTGVPE-LTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTS 6063
            +G + + +AL +L ++ LV EH+E RPLFS      ++G++ M+VDI P+  G    PFNI  RK   YQLR+ V   R    VK        E +SD+YVKA+ING+ +  +TD H+R LDG G FNWRF+  FDY P E  +V   K  F+     EE     +  ++WD +KF  D  LG IE+DL      + SP+       KKR                CK  I     K +                        + VN+F+ + + G+WP+                 D+    P+ + G +E+++ LLT++EA  +PAG  R +PN +P L+ P+R + +  W  S
Sbjct: 1634 MGSQLQTIALFILRQMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRS----FAEPVSDLYVKAFINGMTKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFC-KPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRKSWANSWLVS 1984          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 391.734 bits (1005), Expect = 5.576e-110
Identity = 367/1467 (25.02%), Postives = 629/1467 (42.88%), Query Frame = 1
Query:  856 ETISFEIFNSRKLRSDAL----IGSFKFDLSMIYEEPKHNYMNKWLLLS-------DPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWN-------EELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPR--EYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATML---RISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQF-VISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDA----FVCQLKSLSVE----PQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLG-KWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVD-FNRPCDEEGWEYAVDPSLGG----YQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIK-KGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYT----IPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFF-DVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTE-EHDRLDDFPAFDPNVDLEIN-TFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPE 5118
            E ++ ++   R +R  AL    +G F   LS +   P  + + KW+ L        +P+D      G+LK   ++    +  P+      +E           +G  L   T  +RV+  E L          I+Q       K+    Y++V     + +T+ +      D N       +E+ +P+Q+P++   +   LFD  +      IG   + +  +     E G+LPTFGP FLN +   R   +S    K       + DG  + GR+ + +   +      +A +  ++   +       +  ++      MS   +   + +   +   +S+G++G+  ++    +SS T P    +DG  Y+ +PWG+ +P + V   WE I  R+   N  +++ + L   I +++   N  I          +   +  I S SK +   +P  S    LD+++   R++++ ++     K   EA S+  +  ++DA     + +++S+++E     Q ++P V+I M++  K   + +IP  ++  SD+E   G  CG  + I +  P L++ ++ K   + A L  K+W G+  +   W    +   +    E YE Q   L  KW  ++ +    G  + + ++ L         GW   G W +     ++  K    T   +  F  + R   G W     +Y++   D     +     +GWE  G+W  D F    DE+GW Y+ +    G        EK++H  R+R   R R     +   ++ +       T  NE+WEY+P                          S K G   + +L    +        +        +     R+Y    +  K+QLR YI    +LL   +N  S  + R+ F   S+ T + + S  P W++T++FK V I G    + + PP ++VE+       E+  LG  E  P V +  N   R   QWFP+K    R  G +LA FE+Y   DKDL  L PK  + Y     IP   RP   +  V+ L WGVRN+KK +LL+V  P     IG        +K+V ++PNF  P + F +V+LP      PP+ I + D RAF R+P+VG+  + +  +Y    + + + D  + +   D  +  E +   +  + P     P +P                 +DWWS+YYAS+ QF +   Y E   + +  +++ LE    Y+ F DF  TF   +    + +D EE +  GE K    I  L + +        +D    PT     C++R+YII+A  L  +   G  D Y+K+  GK+  + K  Y     +P FG   +M   +P+ KDL + ++    +  D  IG T IDLENR L+++RAT GL   +   G  QWRD   P  IL+ +C K  +  P+
Sbjct:   26 EKLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIW--------SGAHLIDYTLKIRVFSVEQL----------IRQMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFD-KKGRGKTCIGKATLPMKMIYE-PGETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRG---SQQDGSRFVGRLFIAIDC-VEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFASDPVCIMMSIGSFGSTSNEFRSCNSS-TLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSS--NALDRHILDYRKEKILKLREHFEK---EAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWPTLVDQRNRKREHV-AVLHAKMWFGRTDQLTKWKEHVQPADIRRFMEMYEVQTKGLALKWKDEADIYD--GKWEKTNEVPL-------ENGWNAVGHWIVMNTRHMFVPKLGQHT-VHDKAFEIQKRTEDGTW--KHFKYTDCYADELKPKDLDKHAKGWE-VGSWAQDKFRNNGDEKGWVYSTNGVFFGSGVLTDREEKVHHNFRKRCIKRPR---KHEGYNKELEDFEHFRTTMGNENWEYSP--------------------------SKKEGP--YHDLEDRTDRIRRRRYVREVENKDPDSEDPRFRVYEYQMQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEEDKDLIPLEPKCKHNYKERSEIPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKVKSDHAERWEQLDLVITEEFDQIIRMVRVPTLTTDPMVP-----------------LDWWSRYYASMSQFHRSPGYPESGMEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKGKPPAAINTVVDFVG-PTR----CLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPK 1393          

HSP 2 Score: 146.747 bits (369), Expect = 1.079e-34
Identity = 115/356 (32.30%), Postives = 171/356 (48.03%), Query Frame = 1
Query: 5203 LGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVV---RNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDL----AALPSPA-------KKRAN--------------CKLEILPEFGKNI------------------------EFVNLFDCKRIMGYWPVF----------------DNSTGVPE-LTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTS 6063
            +G + + +AL +L ++ LV EH+E RPLFS      ++G++ M+VDI P+  G    PFNI  RK   YQLR+ V   R    VK        E +SD+YVKA+ING+ +  +TD H+R LDG G FNWRF+  FDY P E  +V   K  F+     EE     +  ++WD +KF  D  LG IE+DL      + SP+       KKR                CK  I     K +                        + VN+F+ + + G+WP+                 D+    P+ + G +E+++ LLT++EA  +PAG  R +PN +P L+ P+R + +  W  S
Sbjct: 1507 MGSQLQTIALFILRQMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRS----FAEPVSDLYVKAFINGMTKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFC-KPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRKSWANSWLVS 1857          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 391.734 bits (1005), Expect = 5.576e-110
Identity = 367/1467 (25.02%), Postives = 629/1467 (42.88%), Query Frame = 1
Query:  856 ETISFEIFNSRKLRSDAL----IGSFKFDLSMIYEEPKHNYMNKWLLLS-------DPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWN-------EELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPR--EYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATML---RISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQF-VISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDA----FVCQLKSLSVE----PQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLG-KWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVD-FNRPCDEEGWEYAVDPSLGG----YQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIK-KGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYT----IPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFF-DVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTE-EHDRLDDFPAFDPNVDLEIN-TFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPE 5118
            E ++ ++   R +R  AL    +G F   LS +   P  + + KW+ L        +P+D      G+LK   ++    +  P+      +E           +G  L   T  +RV+  E L          I+Q       K+    Y++V     + +T+ +      D N       +E+ +P+Q+P++   +   LFD  +      IG   + +  +     E G+LPTFGP FLN +   R   +S    K       + DG  + GR+ + +   +      +A +  ++   +       +  ++      MS   +   + +   +   +S+G++G+  ++    +SS T P    +DG  Y+ +PWG+ +P + V   WE I  R+   N  +++ + L   I +++   N  I          +   +  I S SK +   +P  S    LD+++   R++++ ++     K   EA S+  +  ++DA     + +++S+++E     Q ++P V+I M++  K   + +IP  ++  SD+E   G  CG  + I +  P L++ ++ K   + A L  K+W G+  +   W    +   +    E YE Q   L  KW  ++ +    G  + + ++ L         GW   G W +     ++  K    T   +  F  + R   G W     +Y++   D     +     +GWE  G+W  D F    DE+GW Y+ +    G        EK++H  R+R   R R     +   ++ +       T  NE+WEY+P                          S K G   + +L    +        +        +     R+Y    +  K+QLR YI    +LL   +N  S  + R+ F   S+ T + + S  P W++T++FK V I G    + + PP ++VE+       E+  LG  E  P V +  N   R   QWFP+K    R  G +LA FE+Y   DKDL  L PK  + Y     IP   RP   +  V+ L WGVRN+KK +LL+V  P     IG        +K+V ++PNF  P + F +V+LP      PP+ I + D RAF R+P+VG+  + +  +Y    + + + D  + +   D  +  E +   +  + P     P +P                 +DWWS+YYAS+ QF +   Y E   + +  +++ LE    Y+ F DF  TF   +    + +D EE +  GE K    I  L + +        +D    PT     C++R+YII+A  L  +   G  D Y+K+  GK+  + K  Y     +P FG   +M   +P+ KDL + ++    +  D  IG T IDLENR L+++RAT GL   +   G  QWRD   P  IL+ +C K  +  P+
Sbjct:   26 EKLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIW--------SGAHLIDYTLKIRVFSVEQL----------IRQMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVKFEQEIYLPIQWPTVISEIIFSLFD-KKGRGKTCIGKATLPMKMIYE-PGETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRG---SQQDGSRFVGRLFIAIDC-VEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFASDPVCIMMSIGSFGSTSNEFRSCNSS-TLPAEPNWDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSVGMEALECLEQQIDSASKYLGRINPVSS--NALDRHILDYRKEKILKLREHFEK---EAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWPTLVDQRNRKREHV-AVLHAKMWFGRTDQLTKWKEHVQPADIRRFMEMYEVQTKGLALKWKDEADIYD--GKWEKTNEVPL-------ENGWNAVGHWIVMNTRHMFVPKLGQHT-VHDKAFEIQKRTEDGTW--KHFKYTDCYADELKPKDLDKHAKGWE-VGSWAQDKFRNNGDEKGWVYSTNGVFFGSGVLTDREEKVHHNFRKRCIKRPR---KHEGYNKELEDFEHFRTTMGNENWEYSP--------------------------SKKEGP--YHDLEDRTDRIRRRRYVREVENKDPDSEDPRFRVYEYQMQTGKWQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEEDKDLIPLEPKCKHNYKERSEIPTEFRPQFDKFHVQFLCWGVRNLKKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKVKSDHAERWEQLDLVITEEFDQIIRMVRVPTLTTDPMVP-----------------LDWWSRYYASMSQFHRSPGYPESGMEYVRIFRRPLEQMNGYNNFSDFLDTFPFVKSMKGDFDDPEEKEKAGELKCRLLISKLKKGKPPAAINTVVDFVG-PTR----CLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPK 1393          

HSP 2 Score: 146.747 bits (369), Expect = 1.079e-34
Identity = 115/356 (32.30%), Postives = 171/356 (48.03%), Query Frame = 1
Query: 5203 LGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVV---RNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDL----AALPSPA-------KKRAN--------------CKLEILPEFGKNI------------------------EFVNLFDCKRIMGYWPVF----------------DNSTGVPE-LTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTS 6063
            +G + + +AL +L ++ LV EH+E RPLFS      ++G++ M+VDI P+  G    PFNI  RK   YQLR+ V   R    VK        E +SD+YVKA+ING+ +  +TD H+R LDG G FNWRF+  FDY P E  +V   K  F+     EE     +  ++WD +KF  D  LG IE+DL      + SP+       KKR                CK  I     K +                        + VN+F+ + + G+WP+                 D+    P+ + G +E+++ LLT++EA  +PAG  R +PN +P L+ P+R + +  W  S
Sbjct: 1507 MGSQLQTIALFILRQMNLVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRS----FAEPVSDLYVKAFINGMTKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFC-KPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRKSWANSWLVS 1857          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: ferl-1 (FER-1 Like [Source:UniProtKB/TrEMBL;Acc:O01596])

HSP 1 Score: 105.916 bits (263), Expect = 1.654e-22
Identity = 133/563 (23.62%), Postives = 239/563 (42.45%), Query Frame = 1
Query: 1492 GFLPTFGPCFLNFYGSPR--EYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATML-----RISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDL---IISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDA----FVCQLKSLSVE----PQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKI--KLPKEKINPPTGWEWD--GDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVD-FNRPCDEEGWEYAVDPSL--GGYQP--AEKMYHMSRRRRYVRQR 3099
            G+LPTFGP FLN +   R   +S    K     L   DG  + GR+ + +   +      +A +  ++   +       +  K+  +  F S +++     + +   +   +S+G++G+  ++    +SS T PT    D        WG+ +P + V   WE I  R+   N  +++ + L   I +I+   +  +  ++ A   I + + L   I S SK +     N      LD+++   R++++ ++     K   EA S+  +  ++DA     + Q++S+++E     Q ++P V+I M++  K   + +IP  ++  SD+E   G  CG  + I +  P L++ ++ K   + A L  K+W G+  +   W    +   +      YE Q        TK P +    W D S     K  K K  PP   EW+  G W +      +  K    T   +  F  + R   G W     QY++   D     +     +GW+  G+W  D F    DE+G  Y+ +      G  P   EK++H  R+R   R R
Sbjct:  335 GYLPTFGPAFLNVFDCERVSRFSIFSRKMRGSQL---DGSRFVGRLFIAIDC-VEYMEKANAQIMHLDYSQIMEAESICKNLKW--YNCFCSMSLVNKIDPQFASDPVCIMMSIGSFGSTSNEDKKCNSS-TVPTYPERDEHECCSFAWGNLRPVAEVNAPWEVIDRRIEMSNVLMKMTNMLDSMISEIRHISSGAV--DQIASVGIESLECLEQQIESASKFLRR--INHVNSNALDRHILDYRKEKILKLREHFEK---EAFSIDYSDGEVDAKLLRMLLQIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQWPTLVDQRNRKREHV-AVLHAKMWFGRTDQLTKWKEHVQPADIERFIVLYEVQ--------TKEPTLK---WKDESDIYDGKWVKTKEVPPLENEWNAVGPWIVMNTRQTFVPKLGQHTAH-DKAFEIQKRAETGTW--KHFQYTDCYADELKPKDLDKHVKGWQ-VGSWDQDKFRNNGDEKGCVYSTNGVFIGSGVLPDREEKVHHNFRKRCIERPR 867          
BLAST of Fer-1-related vs. Ensembl Celegans
Match: snt-5 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700])

HSP 1 Score: 64.6994 bits (156), Expect = 3.621e-10
Identity = 44/118 (37.29%), Postives = 66/118 (55.93%), Query Frame = 1
Query:   79 TNEMSGMNVTVINATNLINMELVGKSDPYVLIE--FQGQKKKTKEIG---ENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSI----DVPLRDLAGGKTEVQLTLN 405
            +N+   + + V  A NL  M++ G SDPYV IE  F G++ K+K+      NLNP + E L FD+  + +  T++L ++VMD ++IG D L+G      D P  D   GKT+    LN
Sbjct:  243 SNQEEKLYINVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIPSSQIAETNIL-IQVMDWDRIGKDDLLGCCILGKDSPTAD---GKTQWDNCLN 356          

HSP 2 Score: 58.9214 bits (141), Expect = 2.092e-8
Identity = 31/84 (36.90%), Postives = 51/84 (60.71%), Query Frame = 1
Query: 4717 IYIIKAYDLQPSDPSGLADPYIKIQL---GKERKSSKDEYVPNTLNPEFGR--IFEMKARLPVVKDLCVQILDYDLLGKDDIIG 4953
            I + KAY+L+P D +G +DPY+KI+    GK  KS K       LNP F    +F++ +      ++ +Q++D+D +GKDD++G
Sbjct:  251 INVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIPSSQIAETNILIQVMDWDRIGKDDLLG 334          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273291)

HSP 1 Score: 290.041 bits (741), Expect = 1.451e-83
Identity = 195/607 (32.13%), Postives = 318/607 (52.39%), Query Frame = 1
Query: 4363 KVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYP----LPED--------RNEPMPVIYLDSANLPT-NDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFN----LSQFEETEDSNPNLGPKKERLALHVL---NKLP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNS-----TGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIW 6093
            +++ E +  WW+K+Y S+  +   ++        L+ Y +ELE    +    D+     L  G   +     + D     K   ++ P    + ED        RN   P+     + L +  + V+ ++R+Y+++   ++P D  G +D Y+K+ LG +  S +  + PN  NP FGR+FEM+A LP    L V + D+D + KD++IG+T IDLE+R+ +R RAT GL   Y  SG N W D +LPS IL + C K  I  P Y  N  +++   +F     +S+ EE +          ERL+L VL   +KLP     LV EH+E R L     P +EQGK+++W+++    +  P P  +I       +++RVVV+N   ++  + N+ G+ MSD+YV  W    +++Q TD+HYRS  G+  FNWR VF   Y P+E+ MV+ +K     L++ E ++   +  QVWD D  + D++L  +E++L+ + +P      CK      + K  + +NLF  K I G++P+  N+     +      GK++L I++ T+ EA  +PAG  +D P     L+PP RP +SF   T P K+F+ I+W
Sbjct:   30 ELVEEREFTWWTKFYNSM--YWSAAEMCHEHKHRLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGN-VIEVDGMLFGDETLISKDEELQ----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSP-IDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCK-----PYPKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMA---LEPPYRPDSSFNPLTHPCKSFQHILW 611          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273287)

HSP 1 Score: 288.5 bits (737), Expect = 1.216e-78
Identity = 196/609 (32.18%), Postives = 319/609 (52.38%), Query Frame = 1
Query: 4363 KVIVEEDIDWWSKYYASL--GQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYP----LPED--------RNEPMPVIYLDSANLPT-NDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFN----LSQFEETEDSNPNLGPKKERLALHVL---NKLP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNS-----TGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIW 6093
            +++ E +  WW+K+Y S+     + C ++       L+ Y +ELE    +    D+     L  G   +     + D     K   ++ P    + ED        RN   P+     + L +  + V+ ++R+Y+++   ++P D  G +D Y+K+ LG +  S +  + PN  NP FGR+FEM+A LP    L V + D+D + KD++IG+T IDLE+R+ +R RAT GL   Y  SG N W D +LPS IL + C K  I  P Y  N  +++   +F     +S+ EE +          ERL+L VL   +KLP     LV EH+E R L     P +EQGK+++W+++    +  P P  +I       +++RVVV+N   ++  + N+ G+ MSD+YV  W    +++Q TD+HYRS  G+  FNWR VF   Y P+E+ MV+ +K     L++ E ++   +  QVWD D  + D++L  +E++L+ + +P      CK      + K  + +NLF  K I G++P+  N+     +      GK++L I++ T+ EA  +PAG  +D P     L+PP RP +SF   T P K+F+ I+W
Sbjct:  733 ELVEEREFTWWTKFYNSMYWSAAEMCHEH----KHRLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGN-VIEVDGMLFGDETLISKDEELQ----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSP-IDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCK-----PYPKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMA---LEPPYRPDSSFNPLTHPCKSFQHILW 1314          

HSP 2 Score: 68.9366 bits (167), Expect = 5.639e-11
Identity = 64/288 (22.22%), Postives = 111/288 (38.54%), Query Frame = 1
Query: 3433 RAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGR-------------------------CEAFPMVKLQ-ANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPF-----LPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETN-MIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQY 4200
              YI QA+     ++    D + RV+F +Q+  T     ++ P W+  + F  V + G      ++PP +++E ++ ++   ++ +G                          C   P+ KLQ         L+W PI +      E+L + EI  I  + L         P+L     IP  IRP MQ   +EV   G+RN  K  + S         +G  VL +      +  + NF   +    V LP ++ Y P +         F  + I+G   + N+  +
Sbjct:  365 HVYIHQAKVRPGGEKKNICDSHLRVLFADQACETYTSPGTLSPIWNAVITFNWVSLPGGIGLYLKNPPLLSLEFYNSERSLPEDLVGMGSVAMSVISEDRASDSNWEDAGVFGCSKNPLRKLQRLKYLTPPPLKWVPIARKGTLQAEVLMSAEIIQISMESLTTGQNDKKEPQLAT--GIPMAIRPTMQNFVLEVFFVGLRNYSKSSMSSAGKRKINLMMGDLVLSSGPSTARIRNSINFLVAYASGVVSLPDQQDYWPAIIATDVLLSGFSSESILGAALIPNSSNF 650          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273290)

HSP 1 Score: 288.5 bits (737), Expect = 2.026e-78
Identity = 196/609 (32.18%), Postives = 319/609 (52.38%), Query Frame = 1
Query: 4363 KVIVEEDIDWWSKYYASL--GQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYP----LPED--------RNEPMPVIYLDSANLPT-NDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFN----LSQFEETEDSNPNLGPKKERLALHVL---NKLP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNS-----TGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIW 6093
            +++ E +  WW+K+Y S+     + C ++       L+ Y +ELE    +    D+     L  G   +     + D     K   ++ P    + ED        RN   P+     + L +  + V+ ++R+Y+++   ++P D  G +D Y+K+ LG +  S +  + PN  NP FGR+FEM+A LP    L V + D+D + KD++IG+T IDLE+R+ +R RAT GL   Y  SG N W D +LPS IL + C K  I  P Y  N  +++   +F     +S+ EE +          ERL+L VL   +KLP     LV EH+E R L     P +EQGK+++W+++    +  P P  +I       +++RVVV+N   ++  + N+ G+ MSD+YV  W    +++Q TD+HYRS  G+  FNWR VF   Y P+E+ MV+ +K     L++ E ++   +  QVWD D  + D++L  +E++L+ + +P      CK      + K  + +NLF  K I G++P+  N+     +      GK++L I++ T+ EA  +PAG  +D P     L+PP RP +SF   T P K+F+ I+W
Sbjct:  821 ELVEEREFTWWTKFYNSMYWSAAEMCHEH----KHRLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGN-VIEVDGMLFGDETLISKDEELQ----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSP-IDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCK-----PYPKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMA---LEPPYRPDSSFNPLTHPCKSFQHILW 1402          

HSP 2 Score: 68.9366 bits (167), Expect = 5.313e-11
Identity = 64/288 (22.22%), Postives = 111/288 (38.54%), Query Frame = 1
Query: 3433 RAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGR-------------------------CEAFPMVKLQ-ANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPF-----LPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETN-MIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQY 4200
              YI QA+     ++    D + RV+F +Q+  T     ++ P W+  + F  V + G      ++PP +++E ++ ++   ++ +G                          C   P+ KLQ         L+W PI +      E+L + EI  I  + L         P+L     IP  IRP MQ   +EV   G+RN  K  + S         +G  VL +      +  + NF   +    V LP ++ Y P +         F  + I+G   + N+  +
Sbjct:  453 HVYIHQAKVRPGGEKKNICDSHLRVLFADQACETYTSPGTLSPIWNAVITFNWVSLPGGIGLYLKNPPLLSLEFYNSERSLPEDLVGMGSVAMSVISEDRASDSNWEDAGVFGCSKNPLRKLQRLKYLTPPPLKWVPIARKGTLQAEVLMSAEIIQISMESLTTGQNDKKEPQLAT--GIPMAIRPTMQNFVLEVFFVGLRNYSKSSMSSAGKRKINLMMGDLVLSSGPSTARIRNSINFLVAYASGVVSLPDQQDYWPAIIATDVLLSGFSSESILGAALIPNSSNF 738          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273289)

HSP 1 Score: 288.115 bits (736), Expect = 6.332e-78
Identity = 196/609 (32.18%), Postives = 319/609 (52.38%), Query Frame = 1
Query: 4363 KVIVEEDIDWWSKYYASL--GQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYP----LPED--------RNEPMPVIYLDSANLPT-NDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFN----LSQFEETEDSNPNLGPKKERLALHVL---NKLP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNS-----TGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIW 6093
            +++ E +  WW+K+Y S+     + C ++       L+ Y +ELE    +    D+     L  G   +     + D     K   ++ P    + ED        RN   P+     + L +  + V+ ++R+Y+++   ++P D  G +D Y+K+ LG +  S +  + PN  NP FGR+FEM+A LP    L V + D+D + KD++IG+T IDLE+R+ +R RAT GL   Y  SG N W D +LPS IL + C K  I  P Y  N  +++   +F     +S+ EE +          ERL+L VL   +KLP     LV EH+E R L     P +EQGK+++W+++    +  P P  +I       +++RVVV+N   ++  + N+ G+ MSD+YV  W    +++Q TD+HYRS  G+  FNWR VF   Y P+E+ MV+ +K     L++ E ++   +  QVWD D  + D++L  +E++L+ + +P      CK      + K  + +NLF  K I G++P+  N+     +      GK++L I++ T+ EA  +PAG  +D P     L+PP RP +SF   T P K+F+ I+W
Sbjct: 1029 ELVEEREFTWWTKFYNSMYWSAAEMCHEH----KHRLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGN-VIEVDGMLFGDETLISKDEELQ----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSP-IDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCK-----PYPKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMA---LEPPYRPDSSFNPLTHPCKSFQHILW 1610          

HSP 2 Score: 68.5514 bits (166), Expect = 7.806e-11
Identity = 64/288 (22.22%), Postives = 111/288 (38.54%), Query Frame = 1
Query: 3433 RAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGR-------------------------CEAFPMVKLQ-ANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPF-----LPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETN-MIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQY 4200
              YI QA+     ++    D + RV+F +Q+  T     ++ P W+  + F  V + G      ++PP +++E ++ ++   ++ +G                          C   P+ KLQ         L+W PI +      E+L + EI  I  + L         P+L     IP  IRP MQ   +EV   G+RN  K  + S         +G  VL +      +  + NF   +    V LP ++ Y P +         F  + I+G   + N+  +
Sbjct:  661 HVYIHQAKVRPGGEKKNICDSHLRVLFADQACETYTSPGTLSPIWNAVITFNWVSLPGGIGLYLKNPPLLSLEFYNSERSLPEDLVGMGSVAMSVISEDRASDSNWEDAGVFGCSKNPLRKLQRLKYLTPPPLKWVPIARKGTLQAEVLMSAEIIQISMESLTTGQNDKKEPQLAT--GIPMAIRPTMQNFVLEVFFVGLRNYSKSSMSSAGKRKINLMMGDLVLSSGPSTARIRNSINFLVAYASGVVSLPDQQDYWPAIIATDVLLSGFSSESILGAALIPNSSNF 946          

HSP 3 Score: 62.3882 bits (150), Expect = 6.650e-9
Identity = 85/352 (24.15%), Postives = 135/352 (38.35%), Query Frame = 1
Query:  649 SYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNS------GAKGYLKFCAAILGPG------------DXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMV-VSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQL 1647
             ++  PQ+F I I V +A Q+         ++      K TK   +T +P +N  F F FH +  EL   TI FE+      + + ++G    DL  ++ +  H Y  KW  L  P   N          GYL+   AI+               D       +   + D+IE NLL    +   P+   +R + A          ++G    F   SN      YM+ VSFAG   KT        P WN E+     +PS+  R  + +F  + +     +    + +  +    A NG  P+ GP +L+ Y                     +   Y GR+LMEL +++
Sbjct:    7 CFAGAPQEFLICITVHKAAQVGVTTGELYVRISLDKMTKSTKSFPNTENPFFNEYFVFEFHCTLTELLRLTILFELKKHMTYKKNVVVGELLVDLHSVWNQSNHGYFKKWGRLEAPIGENQTLENAVAPHGYLQLDLAIVSQHSPVSYALGSEEQDTQNLNKWTVDHDFDDIEKNLLTNVNI-FAPSN--IRYFVA---------FYRGY---FIKQSN------YMIQVSFAGFNGKTPVVKNTTTPVWNYEINFAWMYPSVAQRFLILIFAHEHLQWK-CVAEFELCLEEI----AFNG-TPSLGPTYLHLYDP------------------VNPMIYVGRLLMELRSEM 313          
BLAST of Fer-1-related vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273285)

HSP 1 Score: 268.855 bits (686), Expect = 2.042e-73
Identity = 185/585 (31.62%), Postives = 304/585 (51.97%), Query Frame = 1
Query: 4363 KVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYP----LPED--------RNEPMPVIYLDSANLPT-NDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFN----LSQFEETEDSNPNLGPKKERLALHVL---NKLP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNS-----TGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPP 6027
            +++ E +  WW+K+Y S+  +   ++        L+ Y +ELE    +    D+     L  G   +     + D     K   ++ P    + ED        RN   P+     + L +  + V+ ++R+Y+++   ++P D  G +D Y+K+ LG +  S +  + PN  NP FGR+FEM+A LP    L V + D+D + KD++IG+T IDLE+R+ +R RAT GL   Y  SG N W D +LPS IL + C K  I  P Y  N  +++   +F     +S+ EE +          ERL+L VL   +KLP     LV EH+E R L     P +EQGK+++W+++    +  P P  +I       +++RVVV+N   ++  + N+ G+ MSD+YV  W    +++Q TD+HYRS  G+  FNWR VF   Y P+E+ MV+ +K     L++ E ++   +  QVWD D  + D++L  +E++L+ + +P      CK      + K  + +NLF  K I G++P+  N+     +      GK++L I++ T+ EA  +PAG  +D P     L+PP
Sbjct:  486 ELVEEREFTWWTKFYNSM--YWSAAEMCHEHKHRLVIYYEELEKQAQFGYLQDWAVPVQLVHGVKFKKHGPPKEDIYATLKLQLKLTPCQCPVLEDPGGGGDMVRNMSNPIHPRHQSTLQSLGETVKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYYYGN-VIEVDGMLFGDETLISKDEELQ----------ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSP-IDITPVPPADFEVRVVVKNLVGIQAGDKNIFGKLMSDVYVIGWCEDEDKRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL--LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCK-----PYPKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGKMQLSIEVCTDVEAVNRPAGRGQDPPMA---LEPP 1045          

HSP 2 Score: 68.9366 bits (167), Expect = 5.326e-11
Identity = 64/288 (22.22%), Postives = 111/288 (38.54%), Query Frame = 1
Query: 3433 RAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGR-------------------------CEAFPMVKLQ-ANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPF-----LPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETN-MIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQY 4200
              YI QA+     ++    D + RV+F +Q+  T     ++ P W+  + F  V + G      ++PP +++E ++ ++   ++ +G                          C   P+ KLQ         L+W PI +      E+L + EI  I  + L         P+L     IP  IRP MQ   +EV   G+RN  K  + S         +G  VL +      +  + NF   +    V LP ++ Y P +         F  + I+G   + N+  +
Sbjct:  118 HVYIHQAKVRPGGEKKNICDSHLRVLFADQACETYTSPGTLSPIWNAVITFNWVSLPGGIGLYLKNPPLLSLEFYNSERSLPEDLVGMGSVAMSVISEDRASDSNWEDAGVFGCSKNPLRKLQRLKYLTPPPLKWVPIARKGTLQAEVLMSAEIIQISMESLTTGQNDKKEPQLAT--GIPMAIRPTMQNFVLEVFFVGLRNYSKSSMSSAGKRKINLMMGDLVLSSGPSTARIRNSINFLVAYASGVVSLPDQQDYWPAIIATDVLLSGFSSESILGAALIPNSSNF 403          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: myof (myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138])

HSP 1 Score: 1584.31 bits (4101), Expect = 0.000e+0
Identity = 907/2045 (44.35%), Postives = 1260/2045 (61.61%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEV--QLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTD-SAGAEEDETDNAEIGNSGS-----GPQIKIKKVGKRT-TRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN---------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDL---IISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDN-EDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNL-GAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLI---GDKDLPFLPPKLGN-IYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDL-EINTFKKPKEPAA---HKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLEN-DCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPE---FGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + V V +A +L   +L G  DP   + F+ +KKKT+ I   +NP W+E L FDL G  L  +  + V V D E +G DKL+GS  V L+DLA  + +      L L+D+N +   G +++ V Y+PP  A                +DQ D + G +  E +  ++ ++GS      P    +K+  R+  R + + KPQDFQIR++V+E RQL G NI PV KV    +  +T+++   N+P ++  FFFN ++  +ELFDE ISF ++N+   R+D L+G FK D+  IY+E  H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     +  + D++E+NLL PAGV LR  T  L+V++AED+P MD S  Q +K+AF    NK+ LVDP++   FAGK+L T     N +P+WN++L + ++FPSMC+R+KL ++DWDR++ ND +GT ++D++ + S   E+         GFLPTFGPC++N YGS RE+S LPD ++ LNLGKG+G AYRGR+L+EL+T+L+   D   SV  I+ + +  V K+ RRRKY L   F SATM++     I+FEVS+GNYGNK+D T    +S TQ + AVFDG++YY+LPWGDTKP   V   WE+IS RL S+N  L I++ L  NI  +K A+ +   +    +  +   + L   I SL  P  E  PN    T LD  +K +R++ L+ ++  A ++  EAT V++ +T ++ ++ +L+ L+ EPQNSMPD+ IWML G KR  Y RIPAH V++S   E   G+ CG  Q + M  P+         L IP ++R+ +WLG   EE+ ++    EG   V AE YENQA +LGKW T + L++R  +SD +GKIKL  E   PP GWEW+GDW + PE +L  + +A  TEF+++++  E RFPGG W  AT  Y++  G+   GP EI  P GW W   WT D NR  DE GWEY +    D     +   EKMYH       V +R+      KK    K   K  T + E WEY+ +   KFH  +R  D  RRRRW RKM  + + GAS  F L GA   + +  EK   +  S K+     P +   +D+ + Y LR Y++QARNL A DQ+ FSDPY  V F + SQTTE    ++ PTWDQTL+FK VEI+GDP  + ++ P + +E+FD DQ+G+DE LGR    P+VKL +       L W P+   +  AGE+L A E+ L     D +LP +PPK G+ +Y +P G+RP++Q TA+EVL WG+RNMK +QL  V SP    E GG  ++T +IKN+ K PNF    LF  VLLPKEE+Y PP+ +K+ DHR FGRKP+VG   + + +++RC                DP V + E+    K    AA   H   ++ D  +   +  +   +E +DWWSK+YASLGQ +KC  YL+  +DTL  Y+ ELE  +++ G  DFC TF L RG N+  ++D     VGEFKG+F +YPLP+D     P        LP +   EC++RIY+++  DLQP D +G  DPYIKI LGK+    +D Y+P TLNP FGR+FE+   LP  KDL + + D+DLL +D+ +GET IDLENR+LS F + CGL QTY  SG NQWRD   PS IL+       +  P   +N + L    ++++LS FE  ++ + +LGP  ER+ALHVL    LV EH+E R L+S+ QP + QGK++MWVDI P +LG PGPPF+I  RKAKKY LRV+V NT DV LDE ++ GE MSDIYVK W+ G+EE KQ+TDVHYRSLDG+GNFNWRFVF FDY+P+E    ++KKEHFWSLDK+E R    +T Q+WDNDKFS DD+LG +E+DL  L SP+K    C L +LP+     K+ ++ +LFD K + G+WP +    G  EL GK+EL ++++ E+EA  +PAG  RD+PN NP LDPP RP TSFFWFT+P KT KFI+W+  K
Sbjct:    2 LRVAVESAADLPKKKL-GSPDPIASLVFRDEKKKTRSINNEVNPVWNETLQFDLKGVPLDSSSYIDVIVKDYETLGKDKLIGSAKVSLKDLASSQVKSLPVKNLTLVDENGKSIGGTISMTVGYEPPAGAGANP------------LDQQDGNVGGDTAEGEAGDVPDAGSRGAFTSPGEPGQKLQLRSRNRNNLANKPQDFQIRVRVIEGRQLPGNNIKPVVKVHVCGETHRTRIRKG-NNPYFDEIFFFNINMLPSELFDEVISFRVYNASSFRADCLMGEFKLDIGYIYDEQAHCIMKKWILLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKKEQDSDKDDVESNLLLPAGVALRWVTLKLKVFRAEDIPQMDDSITQSLKEAFGGEGNKKNLVDPFVEAWFAGKKLCTQIIEKNANPEWNQQLNLQVKFPSMCERIKLTVYDWDRLTRNDTVGTTYLDLTKIASSGGESEGDTGESEMGFLPTFGPCYINLYGSLREFSGLPDPYDDLNLGKGEGAAYRGRILVELSTKLDGKAD--KSVEEISSDDILVVQKYQRRRKYCLCAVFHSATMIQEPGEPIQFEVSIGNYGNKMDLTCKPLASTTQYSCAVFDGNNYYYLPWGDTKPVVAVTSFWEDISHRLDSLNILLYISNHLQTNISALKFAVQSKATDARLVEIWLKLINQLMEDISSLKIPDLEGKPNL---TSLDIQIKKLRDKALEGIMEGAKRLFEEATDVNKCLTIIEGWLEKLRQLAEEPQNSMPDINIWMLRGEKRIAYTRIPAHQVLFSSYCEQACGQYCGKTQTVFMQYPM----DSKNGLKIPVKIRVNMWLGLATEEKNFN-QYAEGMFNVFAELYENQAQVLGKWGT-TGLLNRSKFSDVTGKIKLKHEYFMPPVGWEWEGDWSVDPEKALLTEADAGHTEFVDEVYENETRFPGGEWKLATETYTDVNGEKVLGPKEIECPSGWTWEDNWTFDVNRAVDERGWEYGITIPPDEKPKSWVACEKMYH-------VHRRRRMIRPRKKIPGAKTADKKDTGNAEGWEYSSLIGWKFHRQQRSSDTFRRRRWRRKMAPAGRVGASAIFKLEGALGVDMESEEKGTKADSSVKQFGANTPMISCTFDRSNAYHLRVYVYQARNLTALDQDSFSDPYVHVSFLHHSQTTETIQSNLNPTWDQTLIFKNVEIYGDPQSLVQNSPVVVMEIFDRDQVGKDEMLGRSTCVPLVKLASGMDGSPKLLWEPVTHKNASAGEILVAAELILKTKGNDTELPLVPPKRGDSLYMVPQGVRPVVQLTAIEVLAWGLRNMKMYQLAPVTSPCLVVECGGERVQTAVIKNMKKCPNFQGNVLFLKVLLPKEEMYTPPIVLKVIDHRPFGRKPVVGQCTITSLEEFRC----------------DPYVTVSEVAMSSKVSLMAASPGHLSVNIDDSRQQLLEAQREKEKETVDWWSKFYASLGQSEKCRPYLDKGYDTLEVYEHELENVKEFMGLTDFCKTFKLQRGKNEIDDEDPNV--VGEFKGSFMVYPLPDDPTVLAPPRQF--RELPDSVSQECVVRIYVVQGIDLQPKDNNGKCDPYIKISLGKKSVDDRDNYMPLTLNPVFGRMFEITCFLPQDKDLKIAVYDFDLLSRDEKVGETVIDLENRFLSHFGSNCGLAQTYCISGPNQWRDQLKPSQILEHHARWKGLSPPRSEDNGNTLSFNGQLYSLSDFEANKEIHEHLGPPSERIALHVLRTQGLVPEHVETRTLYSSFQPTLPQGKLQMWVDIFPKSLGAPGPPFDISPRKAKKYFLRVIVWNTTDVVLDEKSITGENMSDIYVKGWMQGMEEDKQKTDVHYRSLDGDGNFNWRFVFGFDYLPTEQLCHISKKEHFWSLDKSEFRIPPKLTVQIWDNDKFSLDDYLGAVELDLHHLISPSKSSEKCSLSMLPDGPAHPKSDQYKSLFDQKSVRGWWPCYMEKDGKKELGGKVELTLEIVNEKEADERPAGKGRDEPNMNPKLDPPKRPETSFFWFTNPCKTCKFIVWRRFK 1994          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 1546.18 bits (4002), Expect = 0.000e+0
Identity = 898/2090 (42.97%), Postives = 1258/2090 (60.19%), Query Frame = 1
Query:  118 ATNLINMELVGK-SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXID-------QTDSAGAEEDET----DNAEIGNSGSGPQIK-------------------IKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSN-KELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAV----GSMRAEN--GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWD--PNQSPQTELDKYLKIVREQELKQMITEAMKIRN-EATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKS-TKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG------------------------------DKDLPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLD---DFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            ATNL N+E   + SDP   I F+G KKKTK I  N+NP W+E   +DL G  L     L V V D EK+G ++ +G   V LRD L         T++L+D  +  T   + L+V Y PP       Q   Q +   T ++         D+ G ++ E+    + AE      GPQ +                   +KK  +++ +   S K QD Q+R++++E RQL G NI PV KV    Q K+T++K   N+P ++ +FF NF    ++LFDE I   +F+S+ LR D++IG FK D+ M+Y E +H  + KWLLL+DP+D ++GA+GYLK    +L  GDE P       EE ++IE NLLRPAG+ LR ATF LRVY+AEDLP MD +    +K      +N K LVDP + V+FAGK + +       +P WN+ L +P++FPSMC+++++++ DWDR S ND IGT  + +S +    G +  ++  GFLPTFGPCF+N YGSPRE++   D  EALNLGKG+G AYRGRVL+EL T+L++  D  +    IN + L  V KF+R+RK+ L  AF SAT+L+  D  ++FEVS+GNYGNK D+T    +S TQ + AVFDG HYY+LPWG+ KP  VV   WE+I  R+ ++N  L I DRL  N+E++++ L A   ++E  Q V+   DD+I   S+ +PE D  P  +P   LDK L+ +R+  ++Q++  A+ +++   T +S  +   + +  +L+ LS EPQNS+PD+IIWML G +R  Y RIPAH V++S    Y G+ CG LQ + M  P     +D     IPAQLR+K+W G   + + ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +G++KLPKE   P +GW W G+WFISPE ++ +D +A    FLE++F  ++R PGG W      Y++  G+     +EI  P GW W    W+ D  R  D++GWEY +    D     + P+EKMYH +RRRR++R R     +  ++ +  +  +    + E WEYA +F  KFH  ++K D+ RRRRW R+M+   K G +  F L        D +             ++ P +   +D    Y LR Y++QAR+LLA D++ FSD Y+ V F +QSQ T     ++ PTWDQTL+F EVEI GD +    SPP I VEL+D D  G DEF+GRC   P +   A+  R   L W+PI+K    AG++LAAFE+         ++ G                              D DLP+ PP+   N+Y +P GI+P++QRTA+E+L WG+RN+K FQL SV SPS + E GG+V+++ +I+N+ KNPNF    LF DV LPKEELYMPP+ IK+ D+R FGRKP+VG   + + +++     + E D  +   +  A  P  D+ ++     KEP    +P   D F              +DWWSK+YAS+G+  KC  YLE   D L  Y +ELE +E ++ F DFC TF L RG      +D     VGEFKG+F+IYPLP+D + P+P        LP N I EC++RIYII+A+ LQP D +G  DPY+KI LGK+     D Y+P TL P FG++FE+   LP+ KDL + + DYD++ KD+ IGET IDLENR+LSR  A CGLPQ+Y  SGINQWRD   PS +L   C +     P Y + D +      + ++  +E +  NP+LGP  ERLAL VL +  LV EH+E RPL+S LQP IEQG+++MWVD+ P +LGPPGPPFNI  RKAKK+ LR ++ NT DV LD+ ++ GE+MSDIYVK W++G EE KQ+TDVHYRSL GEGNFNWRF+FPF Y+P+E    ++KKEHFWSLDK E +    +T Q+WDNDKFS DDFLG++EMDL  + SPAK    C LE+L +     + V+LF+ K + G+WP   +      L GK+E+ ++++ E+E   +PAG  RD+PN NPHL+ P RP TSF WF+SP+KTF+FI+W+  K
Sbjct:    9 ATNLRNVEKGERHSDPLASITFRGTKKKTKVIKNNVNPVWNEGFEWDLKGVPLDSGAELHVVVKDHEKMGRNRFLGECRVALRDVLNSPNLAATFTVSLVDTKRNSTGATITLQVSYIPPPGMTPIFQPPPQPEAQHTPVELDTVTVFSLDTMGEDDTESMLMMEVAEEPEPVPGPQGQDIGAPTAPPKKAPPNFNQGLKKKKRQSNKSPLSDKAQDLQVRLRIIEGRQLPGVNIKPVVKVTVGGQTKRTRIKKG-NNPFFDETFFLNFFEKPSDLFDEPIFITVFDSKSLRKDSVIGEFKLDVGMVYNEHRHAILRKWLLLADPDDLSAGARGYLKVSMFVLAAGDEPPMDKKEGVEEKEDIEANLLRPAGLTLRGATFTLRVYRAEDLPQMDDALIDDVKHFLGFDTNRKNLVDPLVEVNFAGKTISSKILEKCANPQWNQCLTLPIRFPSMCEKMRIRILDWDRASHNDVIGTAHLCMSKISAPGGDIEVDDSIGFLPTFGPCFVNMYGSPREFTAFSDPHEALNLGKGEGVAYRGRVLLELITKLSDQVDQRSE--DINSDDLLVVEKFMRKRKFSLFAAFYSATLLQDVDDAVQFEVSIGNYGNKFDNTCLPLASTTQFSRAVFDGCHYYYLPWGNVKPVVVVSSEWEDIGPRIEALNMLLSIVDRLESNLEQVQLELKARSDDQEVEQRVVQLLDDVIADCSEELPELDKWPCVTP---LDKALRNLRKINMQQIVQAALALKHGPETELSAVLEQAEDWTMRLRYLSEEPQNSLPDIIIWMLQGDRRVAYHRIPAHQVLFSYG--YCGKHCGQLQTVFMKCP----QEDGGCSKIPAQLRIKVWFGLTADVKSFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGRVKLPKESFKPSSGWSWAGEWFISPEKTMLYDADAGHISFLEEVFENQLRLPGGQWIGMPEGYTDVNGEKAVPKDEIECPPGWVWEDIEWSEDLKRAVDDQGWEYGITLPPDRRPKSWVPSEKMYHTNRRRRWIRLR----RRDMQKMEALRKQRPDESEREGWEYASLFGWKFHLKQKKTDLFRRRRWRRRMEPLEKTGPAAIFALECSLSSFTDEKNDD--KSVTTTFGVSRPTISCFFDSGTLYHLRCYLYQARDLLAMDKDSFSDAYAVVSFLHQSQKTVTVRNTLNPTWDQTLIFYEVEIFGDHLVTERSPPNIVVELYDQDTYGADEFMGRCVCQPSM---ASSPR---LAWYPIQKAGNSAGDLLAAFELIRRDKPAVHHIPGQEGDIIPPSHIMDELVLPGFLSENQQQWPEDSDLPYPPPQREPNVYMVPQGIKPVLQRTAIEILAWGLRNLKSFQLASVTSPSLQVECGGSVVQSCVIRNIKKNPNFDVNILFIDVRLPKEELYMPPLVIKVIDNRQFGRKPVVGQCSVHSLNEFYFQPESLERDSTEEEFEVIAHTPRDDVLVDI--DDKEPL---IPGQQDEF--------------MDWWSKFYASMGERTKCGSYLEKGFDMLQVYDRELEKTEGFEQFADFCQTFKLYRGRTQNDSEDPSV--VGEFKGSFKIYPLPDDPSMPVPTRQF--RKLPPNGIEECLVRIYIIQAFGLQPKDANGKCDPYVKITLGKKSVDDHDNYIPCTLEPVFGKMFELTCCLPLEKDLKITLYDYDMVTKDEKIGETIIDLENRFLSRHGARCGLPQSYCLSGINQWRDQLKPSQLLHRLCERRNYKLPVY-KQDRIYFRGHEYTVADLDEGKPLNPHLGPVMERLALLVLRRHGLVPEHVETRPLYSPLQPDIEQGRLQMWVDLFPKSLGPPGPPFNITPRKAKKFFLRCIIWNTRDVILDDVSVTGEKMSDIYVKGWMHGHEENKQKTDVHYRSLGGEGNFNWRFLFPFHYLPAEQLCTIDKKEHFWSLDKVETKLPPKLTIQIWDNDKFSFDDFLGSLEMDLNHMLSPAKSPEKCGLEMLTQ--SQDKLVSLFEQKTVKGWWPCVCDKEDKKILAGKVEMSLEIVCEQEQDERPAGLGRDEPNMNPHLEEPQRPETSFLWFSSPYKTFRFIVWRRFK 2045          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 1537.7 bits (3980), Expect = 0.000e+0
Identity = 896/2107 (42.52%), Postives = 1258/2107 (59.71%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXID-------QTDSAGAEEDET----DNAEIGNSGSGPQIK-------------------IKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSN-KELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFI---DISAVG--------------SMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWD--PNQSPQTELDKYLKIVREQELKQMITEAMKIRN-EATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKS-TKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG------------------------------DKDLPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLD---DFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + V ++ A N++  +    SD Y  + ++G KKKTK I  N+NP W+E   +DL G  L     L V V D EK+G ++ +G   V LRD L         T++L+D  +  T   + L+V Y PP       Q   Q +   T ++         D+ G ++ E+    + AE      GPQ +                   +KK  +++ +   S K QD Q+R++++E RQL G NI PV KV    Q K+T++K   N+P ++ +FF NF    ++LFDE I   +F+S+ LR D++IG FK D+ M+Y E +H  + KWLLL+DP+D ++GA+GYLK    +L  GDE P       EE ++IE NLLRPAG+ LR ATF LRVY+AEDLP MD +    +K      +N K LVDP + V+FAGK + +       +P WN+ L +P++FPSMC+++++++ DWDR S ND IGT  +    ISA G              +M    GFLPTFGPCF+N YGSPRE++   D  EALNLGKG+G AYRGRVL+EL T+L++  D  +    IN + L  V KF+R+RK+ L  AF SAT+L+  D  ++FEVS+GNYGNK D+T    +S TQ + AVFDG HYY+LPWG+ KP  VV   WE+I  R+ ++N  L I DRL  N+E++++ L A   ++E  Q V+   DD+I   S+ +PE D  P  +P   LDK L+ +R+  ++Q++  A+ +++   T +S  +   + +  +L+ LS EPQNS+PD+IIWML G +R  Y RIPAH V++S    Y G+ CG LQ + M  P     +D     IPAQLR+K+W G   + + ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +G++KLPKE   P +GW W G+WFISPE ++ +D +A    FLE++F  ++R PGG W      Y++  G+     +EI  P GW W    W+ D  R  D++GWEY +    D     + P+EKMYH +RRRR++R R     +  ++ +  +  +    + E WEYA +F  KFH  ++K D+ RRRRW R+M+   K G +  F L        D +             ++ P +   +D    Y LR Y++QAR+LLA D++ FSD Y+ V F +QSQ T     ++ PTWDQTL+F EVEI GD +    SPP I VEL+D D  G DEF+GRC   P +   A+  R   L W+PI+K    AG++LAAFE+         ++ G                              D DLP+ PP+   N+Y +P GI+P++QRTA+E+L WG+RN+K FQL SV SPS + E GG+V+++ +I+N+ KNPNF    LF DV LPKEELYMPP+ IK+ D+R FGRKP+VG   + + +++     + E D  +   +  A  P  D+ ++     KEP    +P   D F              +DWWSK+YAS+G+  KC  YLE   D L  Y +ELE +E ++ F DFC TF L RG      +D     VGEFKG+F+IYPLP+D + P+P        LP N I EC++RIYII+A+ LQP D +G  DPY+KI LGK+     D Y+P TL P FG++FE+   LP+ KDL + + DYD++ KD+ IGET IDLENR+LSR  A CGLPQ+Y  SGINQWRD   PS +L   C +     P Y + D +      + ++  +E +  NP+LGP  ERLAL VL +  LV EH+E RPL+S LQP IEQG+++MWVD+ P +LGPPGPPFNI  RKAKK+ LR ++ NT DV LD+ ++ GE+MSDIYVK W++G EE KQ+TDVHYRSL GEGNFNWRF+FPF Y+P+E    ++KKEHFWSLDK E +    +T Q+WDNDKFS DDFLG++EMDL  + SPAK    C LE+L +     + V+LF+ K + G+WP   +      L GK+E+ ++++ E+E   +PAG  RD+PN NPHL+ P RP TSF WF+SP+KTF+FI+W+  K
Sbjct:    2 LRVFILCAQNVLTHD-EDISDAYCTVTYEGTKKKTKVIKNNVNPVWNEGFEWDLKGVPLDSGAELHVVVKDHEKMGRNRFLGECRVALRDVLNSPNLAATFTVSLVDTKRNSTGATITLQVSYIPPPGMTPIFQPPPQPEAQHTPVELDTVTVFSLDTMGEDDTESMLMMEVAEEPEPVPGPQGQDIGAPTAPPKKAPPNFNQGLKKKKRQSNKSPLSDKAQDLQVRLRIIEGRQLPGVNIKPVVKVTVGGQTKRTRIKKG-NNPFFDETFFLNFFEKPSDLFDEPIFITVFDSKSLRKDSVIGEFKLDVGMVYNEHRHAILRKWLLLADPDDLSAGARGYLKVSMFVLAAGDEPPMDKKEGVEEKEDIEANLLRPAGLTLRGATFTLRVYRAEDLPQMDDALIDDVKHFLGFDTNRKNLVDPLVEVNFAGKTISSKILEKCANPQWNQCLTLPIRFPSMCEKMRIRILDWDRASHNDVIGTAHLCMSKISAPGGDIEDEFPARTLHDTMDDSIGFLPTFGPCFVNMYGSPREFTAFSDPHEALNLGKGEGVAYRGRVLLELITKLSDQVDQRSE--DINSDDLLVVEKFMRKRKFSLFAAFYSATLLQDVDDAVQFEVSIGNYGNKFDNTCLPLASTTQFSRAVFDGCHYYYLPWGNVKPVVVVSSEWEDIGPRIEALNMLLSIVDRLESNLEQVQLELKARSDDQEVEQRVVQLLDDVIADCSEELPELDKWPCVTP---LDKALRNLRKINMQQIVQAALALKHGPETELSAVLEQAEDWTMRLRYLSEEPQNSLPDIIIWMLQGDRRVAYHRIPAHQVLFSYG--YCGKHCGQLQTVFMKCP----QEDGGCSKIPAQLRIKVWFGLTADVKSFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGRVKLPKESFKPSSGWSWAGEWFISPEKTMLYDADAGHISFLEEVFENQLRLPGGQWIGMPEGYTDVNGEKAVPKDEIECPPGWVWEDIEWSEDLKRAVDDQGWEYGITLPPDRRPKSWVPSEKMYHTNRRRRWIRLR----RRDMQKMEALRKQRPDESEREGWEYASLFGWKFHLKQKKTDLFRRRRWRRRMEPLEKTGPAAIFALECSLSSFTDEKNDD--KSVTTTFGVSRPTISCFFDSGTLYHLRCYLYQARDLLAMDKDSFSDAYAVVSFLHQSQKTVTVRNTLNPTWDQTLIFYEVEIFGDHLVTERSPPNIVVELYDQDTYGADEFMGRCVCQPSM---ASSPR---LAWYPIQKAGNSAGDLLAAFELIRRDKPAVHHIPGQEGDIIPPSHIMDELVLPGFLSENQQQWPEDSDLPYPPPQREPNVYMVPQGIKPVLQRTAIEILAWGLRNLKSFQLASVTSPSLQVECGGSVVQSCVIRNIKKNPNFDVNILFIDVRLPKEELYMPPLVIKVIDNRQFGRKPVVGQCSVHSLNEFYFQPESLERDSTEEEFEVIAHTPRDDVLVDI--DDKEPL---IPGQQDEF--------------MDWWSKFYASMGERTKCGSYLEKGFDMLQVYDRELEKTEGFEQFADFCQTFKLYRGRTQNDSEDPSV--VGEFKGSFKIYPLPDDPSMPVPTRQF--RKLPPNGIEECLVRIYIIQAFGLQPKDANGKCDPYVKITLGKKSVDDHDNYIPCTLEPVFGKMFELTCCLPLEKDLKITLYDYDMVTKDEKIGETIIDLENRFLSRHGARCGLPQSYCLSGINQWRDQLKPSQLLHRLCERRNYKLPVY-KQDRIYFRGHEYTVADLDEGKPLNPHLGPVMERLALLVLRRHGLVPEHVETRPLYSPLQPDIEQGRLQMWVDLFPKSLGPPGPPFNITPRKAKKFFLRCIIWNTRDVILDDVSVTGEKMSDIYVKGWMHGHEENKQKTDVHYRSLGGEGNFNWRFLFPFHYLPAEQLCTIDKKEHFWSLDKVETKLPPKLTIQIWDNDKFSFDDFLGSLEMDLNHMLSPAKSPEKCGLEMLTQ--SQDKLVSLFEQKTVKGWWPCVCDKEDKKILAGKVEMSLEIVCEQEQDERPAGLGRDEPNMNPHLEEPQRPETSFLWFSSPYKTFRFIVWRRFK 2054          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: myofl (myoferlin like [Source:ZFIN;Acc:ZDB-GENE-111116-2])

HSP 1 Score: 1409.05 bits (3646), Expect = 0.000e+0
Identity = 859/2051 (41.88%), Postives = 1198/2051 (58.41%), Query Frame = 1
Query:  106 TVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLN--LLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQ----IKIKKVGKRTTRK---SYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVS-ANDAIGTHFIDISAVGS----------------------MRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQ----FVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDN-EDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYL---IGDKDLPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDL-EINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEED-IDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDC-LKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKK-EHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
             V+ +   I  + +G  DP   I F+G+KKKTK I + LNP W+E + FDL G+ L  +  + V V D E IG DK +GS+ + L++LA G+T    + N  L+++ K+     +NL + Y+PP          +  +       +  +A ++ED  D A+ G  G  P      K  K   RTTRK   + + KPQDFQIRI+V+E RQL G NI PV KV    Q  +T+++   N+P ++  F +N ++  +ELFDE+  F I  +  L+                    H  M KWLLL DP+D  SGA+GYLK    I+G GDE P       EE D+IE+NLL PAGV LR AT  L++Y+AED+P MD +  Q +K  F  + +K+ LVDP++ V+FAGK++ T     N +P+WN+ + + ++      RL + +  +  VS +ND IGT +++++ + S                        AE GFLP FGPC++N YGSPRE++ LPD +E LN GKG+G AYRGRVL+EL+TQLN+  D    V  ++ + +    K+ RRRKY L   F SA ML+     I+FEVS+GNYGNKLD T    +S TQ + AVFDG+HYY+LPW D+KP  ++   WE+IS RL S+N  L I+DRL  NI  +K A+ A + +   A+     V    DDL  S   P  E  PN    T LD  +K +R++ +  +   A+++R EA  V   + D++ ++ +L+ +S EPQNSMPDVIIWML G KR  Y RIPA+ V+++ + E   G+ CG  Q I M  P+      +K L IP QLR+ +WLG    E+ ++    EG   V AE YENQA + GKW +   L+SR  +SD +GK+KL +E+  PP     + +  IS    L  + +A  +EF ++++  E RFPGG W  A   Y++  G+    P EI  P GW W   W  D NR  DE+GWEY V    D     +  AEKMYH+ RR+R VR R+  +  P  EK             + WEY+ +   KFH  ER  D  RRRRW RKM  S + GAS  FNL       DD + ++    SAK      P ++ ++DK   Y LR Y++QARNLL  D++ FSDPY  V F + S+TTEI    + PTWDQTL+F ++EI+GDP  ++ +PP + +E++D DQ+G+DE +GRC   P+VKL   +     L WFPI    R AGEML A E+ L     D +LP +PP+   N+Y +P GIRP++Q TA+E+L WG+RNMK +QL +V SPS   E GG +++T  IKN+ KNPNF    LF  VLLPK+E+Y PP+ +K+ DHR FGRKP+VG   + + +++RC                DP +D  E+    K    AA     + D+  G + P+    EED +DWWSK+YAS+ + +KC  YL+  +DTL  Y  ELE   ++ G  DFC+TF L RG  ++ E+D     VGEFKG+FR+YPL +D N   P        LP +   EC++RI+II+  DLQP D +G+ DPYIKI LG++    +D Y PNTLNP+FGR+FE+   +P  KDL + + DYDLL  D+ +GET IDLENR LSRF + CG+P++Y  SG+NQWRD   PS ILQ       I  P+  ++   L    + + L + E  +  +P+LGP KER+ LHVL +  LV EH+E R L+S+ QP + QGK++MWV+I P  LG PGP  +I  R+ K+Y LR VV NT +V LDET++ GE MSDIYVK  +        T ++   L G G F         +  ++  M ++K+ EHFWSLDKTE R    +T Q+WDNDKFS DD+LGT+E+DL  L  PAK    C L +L + GKN+   +LF  K + G+WP      G   L GK+E+ ++++ E+EA  +PAG  RD+PN NP L+ PNRP TSF WFT+P KT KFI+W+  K
Sbjct:    4 VVVESAKGIPKKTIGVPDPIAGIIFRGEKKKTKAIDKELNPVWNEIIEFDLKGSPLDSSSFIEVVVKDYETIGKDKFIGSVKISLKELAAGQTRSLASKNTPLINEKKQEIGATINLTIAYEPPASTVPNLNDQNTGEANTKDTGEEKAADSDEDAGDVADSGAPGVSPTGQPGKKDSKKVVRTTRKRQKALANKPQDFQIRIRVIEGRQLPGNNIKPVAKVSVCGQTHRTRIRRG-NNPFFDEIFSYNVNMLPSELFDESFWFMIMFAVSLKG-------------------HAIMRKWLLLGDPDDAVSGARGYLKVSMFIVGTGDEPPVEKREANEEQDDIESNLLLPAGVALRWATLSLKIYRAEDMPQMDDAFAQTVKHIFGGTDDKKNLVDPFVEVNFAGKKVCTKIIEKNANPEWNQLIHLQVK----VGRLMITMLHFLDVSFSNDVIGTTYLNLTKIASSGGEIEETPSENGLPSSFNVDTTEAEVGFLPAFGPCYINLYGSPREFTGLPDPYEDLNYGKGEGVAYRGRVLIELSTQLNDKTD--KKVEDLSNDNILVAQKYQRRRKYSLCAVFHSACMLQEPGEPIQFEVSIGNYGNKLDSTCKPLASTTQYSCAVFDGNHYYYLPWADSKPVVILTSFWEDISHRLDSVNIILYISDRLQSNIISLKTAILAKVSDARLAEIWLKLVTQVIDDLS-SYQLPDMEGKPNL---TALDIQIKNLRDKTMTSVKEAAIRMREEAVDVRATMPDIEDWLDRLQQISEEPQNSMPDVIIWMLRGEKRVAYARIPANQVLYTTHSEQAIGKYCGRTQTIFMQYPM----DKNKGLKIPVQLRVNMWLGLSAHEKKFNTFA-EGTFSVYAEMYENQAQVFGKWGSTG-LVSRHKFSDVTGKVKLKQERFMPP---RINDNCKIS---ILLTEADAGHSEFTDEVYQNETRFPGGEWKSAAEPYTDVNGEKAQSPEEIECPTGWIWEDGWNFDSNRAVDEKGWEYGVTIPPDDKPRSWVAAEKMYHIHRRKRLVRSRRKTSEAPTIEKKDI---------GDGWEYSSLIGWKFHRKERSSDTFRRRRWRRKMAPSERVGASAIFNLEGALGIDDDEKGSK--KDSAKLFGANTPTVFCRFDKSFSYHLRVYVYQARNLLPMDKDSFSDPYVHVSFLHASKTTEIIKSCLNPTWDQTLIFNDIEIYGDPQTIAYNPPNVVLEIYDSDQMGKDEAMGRCTCPPVVKLNPANPLIPKLFWFPISLKGRSAGEMLVAAELLLKEKANDANLPLVPPRRSENLYMVPQGIRPVVQLTAIEILAWGLRNMKAYQLAAVSSPSLVVECGGQIIQTATIKNIKKNPNFPGSVLFLKVLLPKDEMYTPPIVVKVIDHRPFGRKPVVGQCTINSLEEFRC----------------DPYIDTTEVAMSAKVAMMAAAPRDVVIDM--GDRIPSPSKQEEDTVDWWSKFYASINELEKCGPYLQKGYDTLTVYNTELEAVPEFRGLTDFCNTFKLQRGKLEDEEEDPSV--VGEFKGSFRVYPLSDDPNISDPPRQF--RELPESCPQECLVRIHIIRCLDLQPKDNNGMCDPYIKISLGRKTIDDRDHYKPNTLNPDFGRVFELNCYIPQDKDLKISVYDYDLLSSDEKVGETVIDLENRLLSRFGSHCGIPKSYCVSGVNQWRDQLKPSQILQNLARMRGILAPQISDDGSFLAFGGREYRLDELEANKSIHPHLGPPKERICLHVLRRQGLVPEHVETRTLYSSYQPTLSQGKIQMWVEIFPKNLGIPGPLCDITPRRPKQYFLRAVVWNTTEVILDETSITGENMSDIYVKGNL------YSTAIYSFFLSGFGAFLTTL-----FTVAQQLMHLSKQFEHFWSLDKTEFRIPPKLTIQIWDNDKFSLDDYLGTVELDLLHLIPPAKTPEKCSLSMLTQTGKNLTPSSLFSQKSVRGWWPCAMEENGKKVLAGKVEMTLEVVEEKEADERPAGKGRDEPNMNPKLESPNRPDTSFLWFTNPCKTMKFIVWRKYK 1968          
BLAST of Fer-1-related vs. Ensembl Zebrafish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 376/996 (37.75%), Postives = 554/996 (55.62%), Query Frame = 1
Query: 3388 PRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRS----VLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPP-------KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEED-------------------------IDWWSKYYASLGQFDKCSKYLELMH-----------------------------------DTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXS-----VGEFKGTFRIYPLPED---RNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNK---LP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLL-GERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWP-VFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            P + + Y     +QLR +++QAR+L AAD  G SDP++R+ F   SQ TE+ N+++CPTWDQ LVF  VE++G+   + + PP I +E++D D +G+ +F+GR  A P+ K+             L+++ I +G+  AGEMLAAFE+  IG      LPP         G I  +P GIRP++ +  +EVL WG+R++K+  L  V  P  + E  G  +++++I+N  KNPNFST   +F+V LP+ EL  PP+NI++ D RAFGR  +VG++ +      R          ++++ A +     E+    +P EPA  K+ ++  +        KV + +D                         +DWWSKY+AS+    +  K  E                                      +    Y +ELE+  +Y+ F+D+  TF L RG   +  D ++N +     +G+FKG+  IY +  D   R+           N+P ND +  ++RIY+++A DL P+D +G ADPYI I+LGK     K+ Y+   LNP FG+ F+++A LP+   L V I D+DL+G DD+IGET IDLENR+ S+ RATCG+  TY   G N WRD   PS IL + C   +I  P+Y     +K+ ++V+  +   E ED N       E LAL VLN    +P     LV EH+E RPL +  +PGIEQG++EMWVD+ P  +  PGP  +I  RK KK++LRV+V NT +V L++ ++  GE+ SDI+V+ W+ G +E KQ+TDVHY SL GEGNFNWRF++PFDY+ +E  +V++KKE  +S D+TE +    +  QVWD D FS DDFLG IE+DL   P  AK    C +E++    + +  VN+F  KRI G+WP V  +     E+TGK+E E+ LLT EEA   P G  R++P     L+ PNRP T+F WF  P K  + ++    K
Sbjct:  761 PPISLMYTMKQIFQLRVHMYQARSLFAADSTGLSDPFARIFFSTHSQVTEVLNETLCPTWDQLLVFDHVELYGEAGELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQIYRGNCTAGEMLAAFELLQIGPGGKADLPPIDGPTDIDRGPILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTT---LRKFIYRPADKSVNNWSAME-----EVVIHTEP-EPAVKKIETVVKLDSASDAVVKVDMPDDEKGGKGKKKRKKGEEVEEEELDESMLDWWSKYFASIETLKEAMKAQEAEAEEKEDFESGDGKKKRGKKSKTIPGEAVPEKKKQKIEEFKVYNRELEY--EYNQFEDWLHTFNLHRGKCSDDADVDQNAADEDRLIGKFKGSLCIYKVSSDDMSRDMGFDSNMGMFQNIPHNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKSEIKDKENYISKQLNPVFGKSFDVEATLPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGISSTYAIHGYNVWRDPLKPSHILAKLCKDGKIDAPQYGPGGRVKVTNRVY--TGPTEVEDENGLKKQTDEHLALAVLNHWEDIPRIGCKLVPEHMETRPLLNPDKPGIEQGRIEMWVDMFPKDMSAPGPALDISPRKPKKFELRVIVWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLQAEEKIVISKKESMFSWDETEYKIPARLNLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMVTNENE-MPMVNIFKQKRIKGWWPFVARDENDELEITGKVEAELQLLTGEEAEKSPVGEGRNEPEP---LEKPNRPDTAFLWFMMPLKAIRHLVCNQYK 1739          

HSP 2 Score: 365.54 bits (937), Expect = 8.682e-102
Identity = 246/742 (33.15%), Postives = 401/742 (54.04%), Query Frame = 1
Query:  583 IGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSA-SVTPINEEILTRVSKFL--RRRKYRLHVAFMSATML--RISDTTIEFEVSMGNYGNKLD-------------------DTVPASS-------------SCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSK--PIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEA--TSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMS 2676
            + N  S P IKI+    R         P DFQ+ + V+EARQL G N+ PV  V+  +  K T +K STN P +N  F F+FH+    +FD+ +   + +S+ L RS  L+GSFK D+  IY +P H + +KW  L DPED  +G KGY+K   A++  GD   +   + + + D+IE+NLL P  V  + + A F L++Y+AE LP M++S    +K+AF    NK+LVDPY+ V FAG++ KTS + ++  P WNE++    QFP +C R+KLQ+ D D+V+ + AIGTHFID+  + +   + GFLPT GP ++N YGS R Y+ L D+++ LN G G+G ++R R+L+ L  ++ +T+     S T +  E +  +S     +  ++ L  +F+ ATM+  +I D  I FEV++GNYG++LD                   + +  SS             S T P   V    +Y+ LP+ + KPC  +   W++   RL++ N   ++AD+L + +  ++  +       E+   +    ++L  S S    +   D NQ+ +T+LDK    +  QE++ M  +A  +R++   ++V   I     F+ +L+ LS EPQ+S+PD+ IWM++ +KR  Y R+P+ D+++S  E+  G+ CG +Q I   +P   +        + A+  L +WLG  +        Q++  L  L   +E   ++ G     SP +S
Sbjct:   47 VSNKRSKPDIKIEPSAGR---------PMDFQVSVTVIEARQLVGLNMDPVVCVEIGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKNLLRSGTLVGSFKLDVGTIYTQPDHQFFHKWATLCDPEDITAGLKGYVKCDIAVVAKGDTIKTPHKANENDEDDIESNLLLPEDVPAERQWARFYLKIYRAEGLPKMNTSIMANVKKAFI-GENKDLVDPYVQVLFAGQKGKTSIQKSSYEPIWNEQIVFTEQFPPLCRRMKLQIRDSDKVN-DVAIGTHFIDLRKIAN-DGDKGFLPTLGPAWVNMYGSTRSYT-LMDEYQDLNEGLGEGVSFRARLLISLAVEILDTSSPEVMSSTEVQVEGIPNISDNATGKVEEFFLFGSFLEATMIDRKIGDKPINFEVTIGNYGSELDTPTKPKSKKKKGDGDDEESELIHGSSDEEVDDGGDVTSVSTTPPMKPVITDRNYFHLPYFERKPCIYIYSWWQDQRRRLYNANVLDKMADKLEEGLNDVQEIIKTEKAYPERR--LRGVLEELSNSCSTFVSLANNDQNQAGRTKLDKERVKLCMQEVESMGQQAKTMRSQVKKSNVKDRIKLAQNFLHKLRFLSDEPQHSVPDIYIWMISNNKRIAYARVPSKDILYSSVEEECGKDCGKVQTIFFKLPGK-KSFGPAGWTVQAKTELYLWLGLNR--------QRKDYLCGLPNGFEENKAVKGPGVQSSPPIS 764          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: ctnnal1 (catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5815188])

HSP 1 Score: 1609.35 bits (4166), Expect = 0.000e+0
Identity = 926/2050 (45.17%), Postives = 1259/2050 (61.41%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQ--LTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP--------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAF-TNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVG--------SMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNL-GA--XXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKD---LPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHD--------RLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIV----EEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDC-LKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + V V +A N+   +L GK DP V I F+G+KKKTK +   LNP W+E L FDL G  L  +  L V V D E IG DK +G+I V L++ + G+        L L  +  +P    ++L + Y+PP  A                I Q D    EE++ D  + G + S P        QI  + V  + TR+  S KPQDFQIRI+V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++  EL DE++ F +FNS  +R+D+LIG FK D+  IY+EP H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     ++ E D++E+NLL PAGV LR  TF L++Y+AED+P MD +  Q +K+ F  +S  K LVDP++ VSFAGK++ T+    N +P+WN+ + + ++FPSMC+ +KL ++DWDR++ NDA+GT  + +S +         +   E GFLPTFGPC+LN YGSPREY+  PD ++ LN GKG+G AYRGRVL+ELTT+L+  N     +  I+ + +  V K+ RRRKY L   F SATM++     I+FEVS+GNYGNK D T    +S TQ +  +FDG++YY+LPW  TKP   +  +WE+IS RL  +N  + + DRL  NI  +K A+ A +P+   A+  +   D LI    +P+P  +  ++  T LDK    +R+  LK +   A+K+R EAT V   +T+++ ++ +L+ LS EPQNSMPDVIIWM+   KR  Y R+PAH V++S  +E+  G+ CG  Q + +  P+       K L IP +LR+ IWLG  + E+ ++    EG   V AE YENQA LLGKW T   L+ R  +SD +G IKL +E   PP GWEW+ DW + PE SL  + +A  TEF +++F  E R+PGG W  A   +++  G+    P+++  P GW W    W  D NR  DE GWEY +    D     +  AEKMYH +RRRR VR+RK         K      +      E WEYA +   KFH   R  D  RRRRW RKM  S + GA+  F L GA   +   D+ +K      +        P +   +DK + Y LR YI+QAR L   D++ FSDPY+ V F ++S+TTE    ++ PTWDQTL+F  ++I+GDP  V+++PP + +E+FD+DQ+G+DEFLGR    PMVKL         L W+P+   ++  G++L A E+ +I +KD   LP LP +    IY +P GIRP++Q TA+E+LTWG+RNMK +QL SV SPS   E GG ++ET +IKN+ K PNF +  LF  VLLPK+E+Y+PP+ IKI DHR FGRKP+VG   ++  +++RC     +H+        RL   P  D  +++E     KP   A   L S+         PT V +    EE +DWWSKYYAS G+ +KC +Y++  + TL  YK ELE   ++ G  DFC TF L RG  ++ +D      VGEFKG+FRIYPLP+D N P P        LP  +  ECI+RIYI++  DLQP D +GL DPYIKI L K+    +D Y+PNTLNP FGR++E+   LP  KDL + + DYD L +D+ +GET IDLENR+LSRF + CGLPQTY  SGINQWRD   P+ ILQ F        P + +N   L   SK + L +FE     + +LGP  ERLAL+VL    LV EH+E R L+ST QP I QGK+EMWVD+ P +LGPPGPPFNI  RKAKKY LRV+V NT DV LDE ++ GE MSDIYVK WI G EE KQ+TDVHYRSLDGEGNFNWRFVFPF+Y+P+E   +V+KKEHFWSLDKTE +    +  Q+WDNDKFS DD+LG +E+DL     PAK    C   +L +  K+ +  +LF+ K + G+WP      G   L GK+E+ +++L E++A  +PAG  RD+PN NP LDPPNRP TSF WFT+P KT KFIIW+  K
Sbjct:    2 LKVIVESAANIPKTKL-GKPDPIVTIIFKGEKKKTKPVDNELNPIWNELLEFDLKGIPLDYSASLEVIVKDFETIGKDKFIGTIVVSLKEFSAGQVRSLPFKGLALQSEKGQPIGSTIDLMISYEPPPSAISNPTDPGGTT-----IIQGDGENDEEEDRDIVDAGFNPSVPGAPGQTDTQIARRLVKGKKTRRILSNKPQDFQIRIRVIEGRQLPGNNIKPVVKVSVGGQTHRTRIKRG-NNPYFDEIFFYNVNMTPLELLDESVIFRLFNSGSIRADSLIGEFKLDVGYIYDEPGHAVMRKWVLLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKRDREMEDDDVESNLLLPAGVALRWVTFFLKIYRAEDIPQMDDAFAQTVKEIFGADSDKKNLVDPFVEVSFAGKKVCTNRIEKNANPEWNQAVNLQIKFPSMCENIKLTVYDWDRLTKNDAVGTTCLSLSKIAASGGEIEATTEKEVGFLPTFGPCYLNLYGSPREYTGFPDPYDDLNFGKGEGVAYRGRVLVELTTKLD--NSSIKKIEDISSDDILVVEKYQRRRKYCLCAVFHSATMIQDIGEAIQFEVSIGNYGNKFDSTCKPLASTTQYSRPIFDGNYYYYLPWSFTKPVVTLTSYWEDISHRLDIVNILIAMTDRLQSNISTLKSAIQAKLPDVRLAEIWMRLIDQLIEDTMRPMPSLE-GKANVTVLDKQRDKLRQTSLKYIQEAAIKMRGEATDVKATLTEIEDWLDRLQQLSEEPQNSMPDVIIWMIRAEKRLAYARVPAHQVLFSKTSEEACGKYCGKTQTVFLQYPL----DKTKGLKIPTELRVNIWLGLSEVEKKFNSYS-EGTFSVYAEMYENQALLLGKWGTTG-LLKRHKFSDVTGSIKLKRESFLPPKGWEWEDDWKVDPERSLLTEADAGHTEFTDEIFENEARYPGGEWKKADETFTDANGEKSASPSDLSCPFGWIWDDDGWMRDINRAVDENGWEYGLTIPPDSKPKSWVAAEKMYHTNRRRRLVRKRKKDPKVSTTSKAALTPQE-----QEGWEYAALIGWKFHITPRSSDTFRRRRWRRKMAPSDQHGAAAIFKLEGALGTDMTEDEEKKGSEKQTATNVFGANTPIVSCTFDKFYTYHLRCYIYQARGLTPLDKDSFSDPYAHVSFLHRSKTTETIRSTLNPTWDQTLIFNTIDIYGDPHAVAQNPPNVVIEIFDYDQVGKDEFLGRSVCMPMVKLNPEVDIAPKLLWYPVMNSNKHCGDLLLAAEL-IIREKDGSNLPILPSQRAPQIYMVPQGIRPVVQLTAIEILTWGLRNMKSYQLASVTSPSLIVECGGEIVETAVIKNLKKTPNFYSSVLFMKVLLPKDEMYVPPIIIKIVDHRPFGRKPVVGQCTIECLEEFRCDPYLTKHEDAPELRVARLTSSPLRDVVIEVEDT---KPLL-ANQLLSSMSTAIGKMASPTTVHLQEKEEEVVDWWSKYYASTGETEKCGQYIQKGYTTLKVYKCELENVSEFRGLTDFCDTFKLYRGKAEDSDDPSV---VGEFKGSFRIYPLPDDPNIPYPPRQF--LELPGTESQECIVRIYIVRGIDLQPKDNNGLCDPYIKITLNKKVIEDRDHYIPNTLNPLFGRMYELSCFLPQEKDLKISVYDYDTLTRDEKVGETTIDLENRFLSRFGSHCGLPQTYCISGINQWRDQLTPTQILQNFARLKSSPPPVFSDNGTRLTFSSKDYTLEEFENNRKIHQHLGPPNERLALYVLRTQGLVPEHVETRTLYSTFQPNISQGKLEMWVDVFPKSLGPPGPPFNITPRKAKKYVLRVIVWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFEYLPAEQLCIVSKKEHFWSLDKTEFKLPPKLILQIWDNDKFSLDDYLGFVELDLHRTTIPAKVPEKCSFNLLDQ-DKHSKVASLFEQKSMKGWWPCHAEKDGKRILAGKIEMTLEVLNEKDAEERPAGKGRDEPNMNPKLDPPNRPDTSFLWFTNPCKTMKFIIWRRFK 2019          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: ctnnal1 (catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5815188])

HSP 1 Score: 1553.11 bits (4020), Expect = 0.000e+0
Identity = 904/2038 (44.36%), Postives = 1234/2038 (60.55%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQ--LTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP--------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIY----EEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAF-TNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVG---------------------SMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNL-GA--XXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKD---LPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHD--------RLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDC-LKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPN 6030
            + V V +A N+   +L GK DP V I F+G+KKKTK +   LNP W+E L FDL G  L  +  L V V D E IG DK +G+I V L++ + G+        L L  +  +P    ++L + Y+PP  A                I Q D    EE++ D  + G + S P        QI  + V  + TR+  S KPQDFQIRI+V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++  EL DE++ F +FNS  +R+D+LIG FK   +  +        H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     ++ E D++E+NLL PAGV LR  TF L++Y+AED+P MD +  Q +K+ F  +S  K LVDP++ VSFAGK++ T+    N +P+WN+ + + ++FPSMC+ +KL ++DWDR++ NDA+GT  + +S +                      +   E GFLPTFGPC+LN YGSPREY+  PD ++ LN GKG+G AYRGRVL+ELTT+L+  N     +  I+ + +  V K+ RRRKY L   F SATM++     I+FEVS+GNYGNK D T    +S TQ +  +FDG++YY+LPW  TKP   +  +WE+IS RL  +N  + + DRL  NI  +K A+ A +P+   A+  +   D LI    +P+P  +  ++  T LDK    +R+  LK +   A+K+R EAT V   +T+++ ++ +L+ LS EPQNSMPDVIIWM+   KR  Y R+PAH V++S  +E+  G+ CG  Q + +  P+       K L IP +LR+ IWLG  + E+ ++    EG   V AE YENQA LLGKW T   L+ R  +SD +G IKL +E   PP GWEW+ DW + PE SL  + +A  TEF +++F  E R+PGG W  A   +++  G+    P+++  P GW W    W  D NR  DE GWEY +    D     +  AEKMYH +RRRR VR+RK         K      +      E WEYA +   KFH   R  D  RRRRW RKM  S + GA+  F L GA   +   D+ +K      +        P +   +DK + Y LR YI+QAR L   D++ FSDPY+ V F ++S+TTE    ++ PTWDQTL+F  ++I+GDP  V+++PP + +E+FD+DQ+G+DEFLGR    PMVKL         L W+P+   ++  G++L A E+ +I +KD   LP LP +    IY +P GIRP++Q TA+E+LTWG+RNMK +QL SV SPS   E GG ++ET +IKN+ K PNF +  LF  VLLPK+E+Y+PP+ IKI DHR FGRKP+VG   ++  +++RC     +H+        RL   P  D  +++E     KP   A   L S+         PT V  EE +DWWSKYYAS G+ +KC +Y++  + TL  YK ELE   ++ G  DFC TF L RG  ++ +D      VGEFKG+FRIYPLP+D N P P        LP  +  ECI+RIYI++  DLQP D +GL DPYIKI L K+    +D Y+PNTLNP FGR++E+   LP  KDL + + DYD L +D+ +GET IDLENR+LSRF + CGLPQTY  SGINQWRD   P+ ILQ F        P + +N   L   SK + L +FE     + +LGP  ERLAL+VL    LV EH+E R L+ST QP I QGK+EMWVD+ P +LGPPGPPFNI  RKAKKY LRV+V NT DV LDE ++ GE MSDIYVK WI G EE KQ+TDVHYRSLDGEGNFNWRFVFPF+Y+P+E   +V+KKEHFWSLDKTE +    +  Q+WDNDKFS DD+LG +E+DL     PAK    C   +L +  K+ +  +LF+ K + G+WP      G   L GK+E+ +++L E++A  +PAG  RD+PN NP LDPPN
Sbjct:    2 LKVIVESAANIPKTKL-GKPDPIVTIIFKGEKKKTKPVDNELNPIWNELLEFDLKGIPLDYSASLEVIVKDFETIGKDKFIGTIVVSLKEFSAGQVRSLPFKGLALQSEKGQPIGSTIDLMISYEPPPSAISNPTDPGGTT-----IIQGDGENDEEEDRDIVDAGFNPSVPGAPGQTDTQIARRLVKGKKTRRILSNKPQDFQIRIRVIEGRQLPGNNIKPVVKVSVGGQTHRTRIKRG-NNPYFDEIFFYNVNMTPLELLDESVIFRLFNSGSIRADSLIGEFKILQANTFCSNSHVAGHAVMRKWVLLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKRDREMEDDDVESNLLLPAGVALRWVTFFLKIYRAEDIPQMDDAFAQTVKEIFGADSDKKNLVDPFVEVSFAGKKVCTNRIEKNANPEWNQAVNLQIKFPSMCENIKLTVYDWDRLTKNDAVGTTCLSLSKIAASGGEIEEYDSTGTGSSSLEATTEKEVGFLPTFGPCYLNLYGSPREYTGFPDPYDDLNFGKGEGVAYRGRVLVELTTKLD--NSSIKKIEDISSDDILVVEKYQRRRKYCLCAVFHSATMIQDIGEAIQFEVSIGNYGNKFDSTCKPLASTTQYSRPIFDGNYYYYLPWSFTKPVVTLTSYWEDISHRLDIVNILIAMTDRLQSNISTLKSAIQAKLPDVRLAEIWMRLIDQLIEDTMRPMPSLE-GKANVTVLDKQRDKLRQTSLKYIQEAAIKMRGEATDVKATLTEIEDWLDRLQQLSEEPQNSMPDVIIWMIRAEKRLAYARVPAHQVLFSKTSEEACGKYCGKTQTVFLQYPL----DKTKGLKIPTELRVNIWLGLSEVEKKFNSYS-EGTFSVYAEMYENQALLLGKWGTTG-LLKRHKFSDVTGSIKLKRESFLPPKGWEWEDDWKVDPERSLLTEADAGHTEFTDEIFENEARYPGGEWKKADETFTDANGEKSASPSDLSCPFGWIWDDDGWMRDINRAVDENGWEYGLTIPPDSKPKSWVAAEKMYHTNRRRRLVRKRKKDPKVSTTSKAALTPQE-----QEGWEYAALIGWKFHITPRSSDTFRRRRWRRKMAPSDQHGAAAIFKLEGALGTDMTEDEEKKGSEKQTATNVFGANTPIVSCTFDKFYTYHLRCYIYQARGLTPLDKDSFSDPYAHVSFLHRSKTTETIRSTLNPTWDQTLIFNTIDIYGDPHAVAQNPPNVVIEIFDYDQVGKDEFLGRSVCMPMVKLNPEVDIAPKLLWYPVMNSNKHCGDLLLAAEL-IIREKDGSNLPILPSQRAPQIYMVPQGIRPVVQLTAIEILTWGLRNMKSYQLASVTSPSLIVECGGEIVETAVIKNLKKTPNFYSSVLFMKVLLPKDEMYVPPIIIKIVDHRPFGRKPVVGQCTIECLEEFRCDPYLTKHEDAPELRVARLTSSPLRDVVIEVEDT---KPLL-ANQLLSSMSTAIGKMASPTTVHEEEVVDWWSKYYASTGETEKCGQYIQKGYTTLKVYKCELENVSEFRGLTDFCDTFKLYRGKAEDSDDPSV---VGEFKGSFRIYPLPDDPNIPYPPRQF--LELPGTESQECIVRIYIVRGIDLQPKDNNGLCDPYIKITLNKKVIEDRDHYIPNTLNPLFGRMYELSCFLPQEKDLKISVYDYDTLTRDEKVGETTIDLENRFLSRFGSHCGLPQTYCISGINQWRDQLTPTQILQNFARLKSSPPPVFSDNGTRLTFSSKDYTLEEFENNRKIHQHLGPPNERLALYVLRTQGLVPEHVETRTLYSTFQPNISQGKLEMWVDVFPKSLGPPGPPFNITPRKAKKYVLRVIVWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFEYLPAEQLCIVSKKEHFWSLDKTEFKLPPKLILQIWDNDKFSLDDYLGFVELDLHRTTIPAKVPEKCSFNLLDQ-DKHSKVASLFEQKSMKGWWPCHAEKDGKRILAGKIEMTLEVLNEKDAEERPAGKGRDEPNMNPKLDPPN 2007          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: ctnnal1 (catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5815188])

HSP 1 Score: 1538.47 bits (3982), Expect = 0.000e+0
Identity = 901/2054 (43.87%), Postives = 1226/2054 (59.69%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNL-LDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP-----------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAF-TNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVG---------------------SMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNL-GA--XXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKD---LPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDI-DWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDC-LKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + V V +A N+   +L GK DP V I F+G+KKKTK +   LNP W+E L FDL G  L  +  L V V D E IG DK +G+I V L++ + G+        L L   K    GV                                   A  E DE ++ +I ++G  P           QI  + V  + TR+  S KPQDFQIRI+V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++  EL DE+I      +    S++ +               H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     ++ E D++E+NLL PAGV LR  TF L++Y+AED+P MD +  Q +K+ F  +S  K LVDP++ VSFAGK++ T+    N +P+WN+ + + ++FPSMC+ +KL ++DWDR++ NDA+GT  + +S +                      +   E GFLPTFGPC+LN YGSPREY+  PD ++ LN GKG+G AYRGRVL+ELTT+L+  N     +  I+ + +  V K+ RRRKY L   F SATM++     I+FEVS+GNYGNK D T    +S TQ +  +FDG++YY+LPW  TKP   +  +WE+IS RL  +N  + + DRL  NI  +K A+ A +P+   A+  +   D LI    +P+P  +  ++  T LDK    +R+  LK +   A+K+R EAT V   +T+++ ++ +L+ LS EPQNSMPDVIIWM+   KR  Y R+PAH V++S  +E+  G+ CG  Q + +  P+       K L IP +LR+ IWLG  + E+ ++    EG   V AE YENQA LLGKW T   L+ R  +SD +G IKL +E   PP GWEW+ DW + PE SL  + +A  TEF +++F  E R+PGG W  A   +++  G+    P+++  P GW W    W  D NR  DE GWEY +    D     +  AEKMYH +RRRR VR+RK         K      +      E WEYA +   KFH   R  D  RRRRW RKM  S + GA+  F L GA   +   D+ +K      +        P +   +DK + Y LR YI+QAR L   D++ FSDPY+ V F ++S+TTE    ++ PTWDQTL+F  ++I+GDP  V+++PP + +E+FD+DQ+G+DEFLGR    PMVKL         L W+P+   ++  G++L A E+ +I +KD   LP LP +    IY +P GIRP++Q TA+E+LTWG+RNMK +QL SV SPS   E GG ++ET +IKN+ K PNF +  LF  VLLPK+E+Y+PP+ IKI DHR FGRKP+VG   ++  +++RC     +H+   D P        E+   +    P    +  + D      KP     EE++ DWWSKYYAS G+ +KC +Y++  + TL  YK ELE   ++ G  DFC TF L RG  ++ +D      VGEFKG+FRIYPLP+D N P P        LP  +  ECI+RIYI++  DLQP D +GL DPYIKI L K+    +D Y+PNTLNP FGR++E+   LP  KDL + + DYD L +D+ +GET IDLENR+LSRF + CGLPQTY  SGINQWRD   P+ ILQ F        P + +N   L   SK + L +FE     + +LGP  ERLAL+VL    LV EH+E R L+ST QP I QGK+EMWVD+ P +LGPPGPPFNI  RKAKKY LRV+V NT DV LDE ++ GE MSDIYVK WI G EE KQ+TDVHYRSLDGEGNFNWRFVFPF+Y+P+E   +V+KKEHFWSLDKTE +    +  Q+WDNDKFS DD+LG +E+DL     PAK    C   +L +  K+ +  +LF+ K + G+WP      G   L GK+E+ +++L E++A  +PAG  RD+PN NP LDPPNRP TSF WFT+P KT KFIIW+  K
Sbjct:    2 LKVIVESAANIPKTKL-GKPDPIVTIIFKGEKKKTKPVDNELNPIWNELLEFDLKGIPLDYSASLEVIVKDFETIGKDKFIGTIVVSLKEFSAGQVRSLPFKGLALQSEKGQPIGVSCF-------------------------------CANLENDEEEDRDIVDAGFNPSVPGAPGQTDTQIARRLVKGKKTRRILSNKPQDFQIRIRVIEGRQLPGNNIKPVVKVSVGGQTHRTRIKRG-NNPYFDEIFFYNVNMTPLELLDESI----LQANTFCSNSHVAG-------------HAVMRKWVLLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKRDREMEDDDVESNLLLPAGVALRWVTFFLKIYRAEDIPQMDDAFAQTVKEIFGADSDKKNLVDPFVEVSFAGKKVCTNRIEKNANPEWNQAVNLQIKFPSMCENIKLTVYDWDRLTKNDAVGTTCLSLSKIAASGGEIEEYDSTGTGSSSLEATTEKEVGFLPTFGPCYLNLYGSPREYTGFPDPYDDLNFGKGEGVAYRGRVLVELTTKLD--NSSIKKIEDISSDDILVVEKYQRRRKYCLCAVFHSATMIQDIGEAIQFEVSIGNYGNKFDSTCKPLASTTQYSRPIFDGNYYYYLPWSFTKPVVTLTSYWEDISHRLDIVNILIAMTDRLQSNISTLKSAIQAKLPDVRLAEIWMRLIDQLIEDTMRPMPSLE-GKANVTVLDKQRDKLRQTSLKYIQEAAIKMRGEATDVKATLTEIEDWLDRLQQLSEEPQNSMPDVIIWMIRAEKRLAYARVPAHQVLFSKTSEEACGKYCGKTQTVFLQYPL----DKTKGLKIPTELRVNIWLGLSEVEKKFNSYS-EGTFSVYAEMYENQALLLGKWGTTG-LLKRHKFSDVTGSIKLKRESFLPPKGWEWEDDWKVDPERSLLTEADAGHTEFTDEIFENEARYPGGEWKKADETFTDANGEKSASPSDLSCPFGWIWDDDGWMRDINRAVDENGWEYGLTIPPDSKPKSWVAAEKMYHTNRRRRLVRKRKKDPKVSTTSKAALTPQE-----QEGWEYAALIGWKFHITPRSSDTFRRRRWRRKMAPSDQHGAAAIFKLEGALGTDMTEDEEKKGSEKQTATNVFGANTPIVSCTFDKFYTYHLRCYIYQARGLTPLDKDSFSDPYAHVSFLHRSKTTETIRSTLNPTWDQTLIFNTIDIYGDPHAVAQNPPNVVIEIFDYDQVGKDEFLGRSVCMPMVKLNPEVDIAPKLLWYPVMNSNKHCGDLLLAAEL-IIREKDGSNLPILPSQRAPQIYMVPQGIRPVVQLTAIEILTWGLRNMKSYQLASVTSPSLIVECGGEIVETAVIKNLKKTPNFYSSVLFMKVLLPKDEMYVPPIIIKIVDHRPFGRKPVVGQCTIECLEEFRCDPYLTKHE---DAP--------ELRVARLTSSPLRDVVIEVEDT-----KPLLANQEEEVVDWWSKYYASTGETEKCGQYIQKGYTTLKVYKCELENVSEFRGLTDFCDTFKLYRGKAEDSDDPSV---VGEFKGSFRIYPLPDDPNIPYPPRQF--LELPGTESQECIVRIYIVRGIDLQPKDNNGLCDPYIKITLNKKVIEDRDHYIPNTLNPLFGRMYELSCFLPQEKDLKISVYDYDTLTRDEKVGETTIDLENRFLSRFGSHCGLPQTYCISGINQWRDQLTPTQILQNFARLKSSPPPVFSDNGTRLTFSSKDYTLEEFENNRKIHQHLGPPNERLALYVLRTQGLVPEHVETRTLYSTFQPNISQGKLEMWVDVFPKSLGPPGPPFNITPRKAKKYVLRVIVWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFEYLPAEQLCIVSKKEHFWSLDKTEFKLPPKLILQIWDNDKFSLDDYLGFVELDLHRTTIPAKVPEKCSFNLLDQ-DKHSKVASLFEQKSMKGWWPCHAEKDGKRILAGKIEMTLEVLNEKDAEERPAGKGRDEPNMNPKLDPPNRPDTSFLWFTNPCKTMKFIIWRRFK 1968          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: ctnnal1 (catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5815188])

HSP 1 Score: 1536.16 bits (3976), Expect = 0.000e+0
Identity = 901/2045 (44.06%), Postives = 1226/2045 (59.95%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP--------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAF-TNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVG----------------SMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNL-GA--XXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKD---LPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDI-DWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDC-LKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + V V +A N+   +L GK DP V I F+G+KKKTK +   LNP W+E L FDL G  L  +  L V V D E IG DK        +    G     Q T++L+   + P + + N                        GT I Q D    EE++ D  + G + S P        QI  + V  + TR+  S KPQDFQIRI+V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++  EL DE+I      +    S++ +               H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     ++ E D++E+NLL PAGV LR  TF L++Y+AED+P MD +  Q +K+ F  +S  K LVDP++ VSFAGK++ T+    N +P+WN+ + + ++FPSMC+ +KL ++DWDR++ NDA+GT  + +S +                 +   E GFLPTFGPC+LN YGSPREY+  PD ++ LN GKG+G AYRGRVL+ELTT+L+  N     +  I+ + +  V K+ RRRKY L   F SATM++     I+FEVS+GNYGNK D T    +S TQ +  +FDG++YY+LPW  TKP   +  +WE+IS RL  +N  + + DRL  NI  +K A+ A +P+   A+  +   D LI    +P+P  +  ++  T LDK    +R+  LK +   A+K+R EAT V   +T+++ ++ +L+ LS EPQNSMPDVIIWM+   KR  Y R+PAH V++S  +E+  G+ CG  Q + +  P+       K L IP +LR+ IWLG  + E+ ++    EG   V AE YENQA LLGKW T   L+ R  +SD +G IKL +E   PP GWEW+ DW + PE SL  + +A  TEF +++F  E R+PGG W  A   +++  G+    P+++  P GW W    W  D NR  DE GWEY +    D     +  AEKMYH +RRRR VR+RK         K      +      E WEYA +   KFH   R  D  RRRRW RKM  S + GA+  F L GA   +   D+ +K      +        P +   +DK + Y LR YI+QAR L   D++ FSDPY+ V F ++S+TTE    ++ PTWDQTL+F  ++I+GDP  V+++PP + +E+FD+DQ+G+DEFLGR    PMVKL         L W+P+   ++  G++L A E+ +I +KD   LP LP +    IY +P GIRP++Q TA+E+LTWG+RNMK +QL SV SPS   E GG ++ET +IKN+ K PNF +  LF  VLLPK+E+Y+PP+ IKI DHR FGRKP+VG   ++  +++RC     +H+   D P        E+   +    P    +  + D      KP     EE++ DWWSKYYAS G+ +KC +Y++  + TL  YK ELE   ++ G  DFC TF L RG  ++ +D      VGEFKG+FRIYPLP+D N P P        LP  +  ECI+RIYI++  DLQP D +GL DPYIKI L K+    +D Y+PNTLNP FGR++E+   LP  KDL + + DYD L +D+ +GET IDLENR+LSRF + CGLPQTY  SGINQWRD   P+ ILQ F        P + +N   L   SK + L +FE     + +LGP  ERLAL+VL    LV EH+E R L+ST QP I QGK+EMWVD+ P +LGPPGPPFNI  RKAKKY LRV+V NT DV LDE ++ GE MSDIYVK WI G EE KQ+TDVHYRSLDGEGNFNWRFVFPF+Y+P+E   +V+KKEHFWSLDKTE +    +  Q+WDNDKFS DD+LG +E+DL     PAK    C   +L +  K+ +  +LF+ K + G+WP      G   L GK+E+ +++L E++A  +PAG  RD+PN NP LDPPNRP TSF WFT+P KT KFIIW+  K
Sbjct:    2 LKVIVESAANIPKTKL-GKPDPIVTIIFKGEKKKTKPVDNELNPIWNELLEFDLKGIPLDYSASLEVIVKDFETIGKDKY-------VMICLGFSFSTQSTIDLMISYEPPPSAISN-------------------PTDPGGTTIIQGDGENDEEEDRDIVDAGFNPSVPGAPGQTDTQIARRLVKGKKTRRILSNKPQDFQIRIRVIEGRQLPGNNIKPVVKVSVGGQTHRTRIKRG-NNPYFDEIFFYNVNMTPLELLDESI----LQANTFCSNSHVAG-------------HAVMRKWVLLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKRDREMEDDDVESNLLLPAGVALRWVTFFLKIYRAEDIPQMDDAFAQTVKEIFGADSDKKNLVDPFVEVSFAGKKVCTNRIEKNANPEWNQAVNLQIKFPSMCENIKLTVYDWDRLTKNDAVGTTCLSLSKIAASGGEIEGNGKGAAYPTTEKEVGFLPTFGPCYLNLYGSPREYTGFPDPYDDLNFGKGEGVAYRGRVLVELTTKLD--NSSIKKIEDISSDDILVVEKYQRRRKYCLCAVFHSATMIQDIGEAIQFEVSIGNYGNKFDSTCKPLASTTQYSRPIFDGNYYYYLPWSFTKPVVTLTSYWEDISHRLDIVNILIAMTDRLQSNISTLKSAIQAKLPDVRLAEIWMRLIDQLIEDTMRPMPSLE-GKANVTVLDKQRDKLRQTSLKYIQEAAIKMRGEATDVKATLTEIEDWLDRLQQLSEEPQNSMPDVIIWMIRAEKRLAYARVPAHQVLFSKTSEEACGKYCGKTQTVFLQYPL----DKTKGLKIPTELRVNIWLGLSEVEKKFNSYS-EGTFSVYAEMYENQALLLGKWGTTG-LLKRHKFSDVTGSIKLKRESFLPPKGWEWEDDWKVDPERSLLTEADAGHTEFTDEIFENEARYPGGEWKKADETFTDANGEKSASPSDLSCPFGWIWDDDGWMRDINRAVDENGWEYGLTIPPDSKPKSWVAAEKMYHTNRRRRLVRKRKKDPKVSTTSKAALTPQE-----QEGWEYAALIGWKFHITPRSSDTFRRRRWRRKMAPSDQHGAAAIFKLEGALGTDMTEDEEKKGSEKQTATNVFGANTPIVSCTFDKFYTYHLRCYIYQARGLTPLDKDSFSDPYAHVSFLHRSKTTETIRSTLNPTWDQTLIFNTIDIYGDPHAVAQNPPNVVIEIFDYDQVGKDEFLGRSVCMPMVKLNPEVDIAPKLLWYPVMNSNKHCGDLLLAAEL-IIREKDGSNLPILPSQRAPQIYMVPQGIRPVVQLTAIEILTWGLRNMKSYQLASVTSPSLIVECGGEIVETAVIKNLKKTPNFYSSVLFMKVLLPKDEMYVPPIIIKIVDHRPFGRKPVVGQCTIECLEEFRCDPYLTKHE---DAP--------ELRVARLTSSPLRDVVIEVEDT-----KPLLANQEEEVVDWWSKYYASTGETEKCGQYIQKGYTTLKVYKCELENVSEFRGLTDFCDTFKLYRGKAEDSDDPSV---VGEFKGSFRIYPLPDDPNIPYPPRQF--LELPGTESQECIVRIYIVRGIDLQPKDNNGLCDPYIKITLNKKVIEDRDHYIPNTLNPLFGRMYELSCFLPQEKDLKISVYDYDTLTRDEKVGETTIDLENRFLSRFGSHCGLPQTYCISGINQWRDQLTPTQILQNFARLKSSPPPVFSDNGTRLTFSSKDYTLEEFENNRKIHQHLGPPNERLALYVLRTQGLVPEHVETRTLYSTFQPNISQGKLEMWVDVFPKSLGPPGPPFNITPRKAKKYVLRVIVWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFEYLPAEQLCIVSKKEHFWSLDKTEFKLPPKLILQIWDNDKFSLDDYLGFVELDLHRTTIPAKVPEKCSFNLLDQ-DKHSKVASLFEQKSMKGWWPCHAEKDGKRILAGKIEMTLEVLNEKDAEERPAGKGRDEPNMNPKLDPPNRPDTSFLWFTNPCKTMKFIIWRRFK 1964          
BLAST of Fer-1-related vs. Ensembl Xenopus
Match: ctnnal1 (catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5815188])

HSP 1 Score: 1532.69 bits (3967), Expect = 0.000e+0
Identity = 901/2050 (43.95%), Postives = 1226/2050 (59.80%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP--------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAF-TNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVG---------------------SMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNL-GA--XXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKD---LPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDI-DWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDC-LKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + V V +A N+   +L GK DP V I F+G+KKKTK +   LNP W+E L FDL G  L  +  L V V D E IG DK        +    G     Q T++L+   + P + + N                        GT I Q D    EE++ D  + G + S P        QI  + V  + TR+  S KPQDFQIRI+V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++  EL DE+I      +    S++ +               H  M KW+LL+DP+D +SGAKGYLK    ++G GDE P     ++ E D++E+NLL PAGV LR  TF L++Y+AED+P MD +  Q +K+ F  +S  K LVDP++ VSFAGK++ T+    N +P+WN+ + + ++FPSMC+ +KL ++DWDR++ NDA+GT  + +S +                      +   E GFLPTFGPC+LN YGSPREY+  PD ++ LN GKG+G AYRGRVL+ELTT+L+  N     +  I+ + +  V K+ RRRKY L   F SATM++     I+FEVS+GNYGNK D T    +S TQ +  +FDG++YY+LPW  TKP   +  +WE+IS RL  +N  + + DRL  NI  +K A+ A +P+   A+  +   D LI    +P+P  +  ++  T LDK    +R+  LK +   A+K+R EAT V   +T+++ ++ +L+ LS EPQNSMPDVIIWM+   KR  Y R+PAH V++S  +E+  G+ CG  Q + +  P+       K L IP +LR+ IWLG  + E+ ++    EG   V AE YENQA LLGKW T   L+ R  +SD +G IKL +E   PP GWEW+ DW + PE SL  + +A  TEF +++F  E R+PGG W  A   +++  G+    P+++  P GW W    W  D NR  DE GWEY +    D     +  AEKMYH +RRRR VR+RK         K      +      E WEYA +   KFH   R  D  RRRRW RKM  S + GA+  F L GA   +   D+ +K      +        P +   +DK + Y LR YI+QAR L   D++ FSDPY+ V F ++S+TTE    ++ PTWDQTL+F  ++I+GDP  V+++PP + +E+FD+DQ+G+DEFLGR    PMVKL         L W+P+   ++  G++L A E+ +I +KD   LP LP +    IY +P GIRP++Q TA+E+LTWG+RNMK +QL SV SPS   E GG ++ET +IKN+ K PNF +  LF  VLLPK+E+Y+PP+ IKI DHR FGRKP+VG   ++  +++RC     +H+   D P        E+   +    P    +  + D      KP     EE++ DWWSKYYAS G+ +KC +Y++  + TL  YK ELE   ++ G  DFC TF L RG  ++ +D      VGEFKG+FRIYPLP+D N P P        LP  +  ECI+RIYI++  DLQP D +GL DPYIKI L K+    +D Y+PNTLNP FGR++E+   LP  KDL + + DYD L +D+ +GET IDLENR+LSRF + CGLPQTY  SGINQWRD   P+ ILQ F        P + +N   L   SK + L +FE     + +LGP  ERLAL+VL    LV EH+E R L+ST QP I QGK+EMWVD+ P +LGPPGPPFNI  RKAKKY LRV+V NT DV LDE ++ GE MSDIYVK WI G EE KQ+TDVHYRSLDGEGNFNWRFVFPF+Y+P+E   +V+KKEHFWSLDKTE +    +  Q+WDNDKFS DD+LG +E+DL     PAK    C   +L +  K+ +  +LF+ K + G+WP      G   L GK+E+ +++L E++A  +PAG  RD+PN NP LDPPNRP TSF WFT+P KT KFIIW+  K
Sbjct:    2 LKVIVESAANIPKTKL-GKPDPIVTIIFKGEKKKTKPVDNELNPIWNELLEFDLKGIPLDYSASLEVIVKDFETIGKDKY-------VMICLGFSFSTQSTIDLMISYEPPPSAISN-------------------PTDPGGTTIIQGDGENDEEEDRDIVDAGFNPSVPGAPGQTDTQIARRLVKGKKTRRILSNKPQDFQIRIRVIEGRQLPGNNIKPVVKVSVGGQTHRTRIKRG-NNPYFDEIFFYNVNMTPLELLDESI----LQANTFCSNSHVAG-------------HAVMRKWVLLNDPDDSSSGAKGYLKVSMFVVGTGDEPPVEKRDREMEDDDVESNLLLPAGVALRWVTFFLKIYRAEDIPQMDDAFAQTVKEIFGADSDKKNLVDPFVEVSFAGKKVCTNRIEKNANPEWNQAVNLQIKFPSMCENIKLTVYDWDRLTKNDAVGTTCLSLSKIAASGGEIEEYDSTGTGSSSLEATTEKEVGFLPTFGPCYLNLYGSPREYTGFPDPYDDLNFGKGEGVAYRGRVLVELTTKLD--NSSIKKIEDISSDDILVVEKYQRRRKYCLCAVFHSATMIQDIGEAIQFEVSIGNYGNKFDSTCKPLASTTQYSRPIFDGNYYYYLPWSFTKPVVTLTSYWEDISHRLDIVNILIAMTDRLQSNISTLKSAIQAKLPDVRLAEIWMRLIDQLIEDTMRPMPSLE-GKANVTVLDKQRDKLRQTSLKYIQEAAIKMRGEATDVKATLTEIEDWLDRLQQLSEEPQNSMPDVIIWMIRAEKRLAYARVPAHQVLFSKTSEEACGKYCGKTQTVFLQYPL----DKTKGLKIPTELRVNIWLGLSEVEKKFNSYS-EGTFSVYAEMYENQALLLGKWGTTG-LLKRHKFSDVTGSIKLKRESFLPPKGWEWEDDWKVDPERSLLTEADAGHTEFTDEIFENEARYPGGEWKKADETFTDANGEKSASPSDLSCPFGWIWDDDGWMRDINRAVDENGWEYGLTIPPDSKPKSWVAAEKMYHTNRRRRLVRKRKKDPKVSTTSKAALTPQE-----QEGWEYAALIGWKFHITPRSSDTFRRRRWRRKMAPSDQHGAAAIFKLEGALGTDMTEDEEKKGSEKQTATNVFGANTPIVSCTFDKFYTYHLRCYIYQARGLTPLDKDSFSDPYAHVSFLHRSKTTETIRSTLNPTWDQTLIFNTIDIYGDPHAVAQNPPNVVIEIFDYDQVGKDEFLGRSVCMPMVKLNPEVDIAPKLLWYPVMNSNKHCGDLLLAAEL-IIREKDGSNLPILPSQRAPQIYMVPQGIRPVVQLTAIEILTWGLRNMKSYQLASVTSPSLIVECGGEIVETAVIKNLKKTPNFYSSVLFMKVLLPKDEMYVPPIIIKIVDHRPFGRKPVVGQCTIECLEEFRCDPYLTKHE---DAP--------ELRVARLTSSPLRDVVIEVEDT-----KPLLANQEEEVVDWWSKYYASTGETEKCGQYIQKGYTTLKVYKCELENVSEFRGLTDFCDTFKLYRGKAEDSDDPSV---VGEFKGSFRIYPLPDDPNIPYPPRQF--LELPGTESQECIVRIYIVRGIDLQPKDNNGLCDPYIKITLNKKVIEDRDHYIPNTLNPLFGRMYELSCFLPQEKDLKISVYDYDTLTRDEKVGETTIDLENRFLSRFGSHCGLPQTYCISGINQWRDQLTPTQILQNFARLKSSPPPVFSDNGTRLTFSSKDYTLEEFENNRKIHQHLGPPNERLALYVLRTQGLVPEHVETRTLYSTFQPNISQGKLEMWVDVFPKSLGPPGPPFNITPRKAKKYVLRVIVWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFEYLPAEQLCIVSKKEHFWSLDKTEFKLPPKLILQIWDNDKFSLDDYLGFVELDLHRTTIPAKVPEKCSFNLLDQ-DKHSKVASLFEQKSMKGWWPCHAEKDGKRILAGKIEMTLEVLNEKDAEERPAGKGRDEPNMNPKLDPPNRPDTSFLWFTNPCKTMKFIIWRRFK 1969          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1579.3 bits (4088), Expect = 0.000e+0
Identity = 894/2074 (43.11%), Postives = 1233/2074 (59.45%), Query Frame = 1
Query:  109 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            +  A+NL N++   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L++++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E       GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGRVL+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+   N  LR+ADRL  N+E++ +AL A    E+    V    D+L+   S+P+   D ++ P  T LD+YL  +R + L Q+   A+ ++   + +S A+   + ++  L++L+ EPQNS+PD+IIWML G KR  Y R+PAH+V++S     Y GR CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    D     + P EKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T ++  ++ PTWDQTL+F E+EI G+P  ++E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ AGE+LAAFE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +Q+ S+ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+E+LY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+           K P +P           V  EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E + G  DFC+TF L RG   E  DD     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET IDLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++RI  P Y   D +    K + + + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MW+DI P  LG PGPPFNI  RKA+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRFVFPFDY+P+E    V KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:    6 LARASNLPNVKKDRRSDPVASLIFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEVDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQPL--CDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM----EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGMVDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFELIQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDI--------DDKEPLIP-----------VQEEEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVY-RTDRVTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2033          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1578.53 bits (4086), Expect = 0.000e+0
Identity = 897/2077 (43.19%), Postives = 1237/2077 (59.56%), Query Frame = 1
Query:  109 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPP-KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTF-KKPKEPA--AHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            +  A+NL N++   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L++++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E       GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGRVL+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+   N  LR+ADRL  N+E++ +AL A    E+    V    D+L+   S+P+   D ++ P  T LD+YL  +R + L Q+   A+ ++   + +S A+   + ++  L++L+ EPQNS+PD+IIWML G KR  Y R+PAH+V++S     Y GR CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    D     + P EKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T ++  ++ PTWDQTL+F E+EI G+P  ++E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ AGE+LAAFE+         ++ G              D DLP+ PP +  NIY +P  I+P +QRTA+E+L WG+RNMK +Q+ S+ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+E+LY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+   K+P  P      L SL         P+    EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E + G  DFC+TF L RG   E  DD     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET IDLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++RI  P Y   D +    K + + + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MW+DI P  LG PGPPFNI  RKA+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRFVFPFDY+P+E    V KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:    6 LARASNLPNVKKDRRSDPVASLIFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEVDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQPL--CDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM----EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGMVDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFELIQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDIDDKEPLIPVQLTDGLSSLGPT-NLTPSPSSPHEEEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVY-RTDRVTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2054          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1573.53 bits (4073), Expect = 0.000e+0
Identity = 897/2091 (42.90%), Postives = 1237/2091 (59.16%), Query Frame = 1
Query:  109 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTF-KKPKEPA--AHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            +  A+NL N++   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L++++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGRVL+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+   N  LR+ADRL  N+E++ +AL A    E+    V    D+L+   S+P+   D ++ P  T LD+YL  +R + L Q+   A+ ++   + +S A+   + ++  L++L+ EPQNS+PD+IIWML G KR  Y R+PAH+V++S     Y GR CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    D     + P EKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T ++  ++ PTWDQTL+F E+EI G+P  ++E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ AGE+LAAFE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +Q+ S+ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+E+LY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+   K+P  P      L SL         P+    EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E + G  DFC+TF L RG   E  DD     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET IDLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++RI  P Y   D +    K + + + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MW+DI P  LG PGPPFNI  RKA+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRFVFPFDY+P+E    V KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:    6 LARASNLPNVKKDRRSDPVASLIFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEEEPAGVLKSPQATDLDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQPL--CDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM----EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGMVDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFELIQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDIDDKEPLIPVQLTDGLSSLGPT-NLTPSPSSPHEEEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVY-RTDRVTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2068          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1573.14 bits (4072), Expect = 0.000e+0
Identity = 894/2088 (42.82%), Postives = 1233/2088 (59.05%), Query Frame = 1
Query:  109 VINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            +  A+NL N++   +SDP   + F+G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L++++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGRVL+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+   N  LR+ADRL  N+E++ +AL A    E+    V    D+L+   S+P+   D ++ P  T LD+YL  +R + L Q+   A+ ++   + +S A+   + ++  L++L+ EPQNS+PD+IIWML G KR  Y R+PAH+V++S     Y GR CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    D     + P EKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T ++  ++ PTWDQTL+F E+EI G+P  ++E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ AGE+LAAFE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +Q+ S+ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+E+LY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+           K P +P           V  EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E + G  DFC+TF L RG   E  DD     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET IDLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++RI  P Y   D +    K + + + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MW+DI P  LG PGPPFNI  RKA+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRFVFPFDY+P+E    V KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:    6 LARASNLPNVKKDRRSDPVASLIFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEEEPAGVLKSPQATDLDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQPL--CDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM----EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGMVDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFELIQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDI--------DDKEPLIP-----------VQEEEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVY-RTDRVTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2047          
BLAST of Fer-1-related vs. Ensembl Mouse
Match: Dysf (dysferlin [Source:MGI Symbol;Acc:MGI:1349385])

HSP 1 Score: 1566.98 bits (4056), Expect = 0.000e+0
Identity = 890/2073 (42.93%), Postives = 1222/2073 (58.95%), Query Frame = 1
Query:  154 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPP-KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L++++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGRVL+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+   N  LR+ADRL  N+E++ +AL A    E+    V    D+L+   S+P+   D ++ P  T LD+YL  +R + L Q+   A+ ++   + +S A+   + ++  L++L+ EPQNS+PD+IIWML G KR  Y R+PAH+V++S     Y GR CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    D     + P EKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T ++  ++ PTWDQTL+F E+EI G+P  ++E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ AGE+LAAFE+         ++ G              D DLP+ PP +  NIY +P  I+P +QRTA+E+L WG+RNMK +Q+ S+ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+E+LY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+           K P +P           V  EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E + G  DFC+TF L RG   E  DD     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET IDLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++RI  P Y   D +    K + + + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MW+DI P  LG PGPPFNI  RKA+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRFVFPFDY+P+E    V KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEEEPAGVLKSPQATDLDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQPL--CDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM----EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGMVDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFELIQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDI--------DDKEPLIP-----------VQEEEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVY-RTDRVTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2046          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|O75923|DYSF_HUMAN (Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1)

HSP 1 Score: 1569.29 bits (4062), Expect = 0.000e+0
Identity = 888/2071 (42.88%), Postives = 1232/2071 (59.49%), Query Frame = 1
Query:  154 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXX--IDQTDSAGAEEDETDNAEIGN---------SGSGPQIKIKKVGKR---------------TTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L     L V V D E +G ++ +G   VPLR+ LA           LLD  K+PT   L L+V Y P   A       +  + + T   +D     G EED  D    G+          G G     +K+  R               T+RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T++    NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGR+L+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+IS R+ + N  L IADRL   +E++ +AL A    E+    V    D+LI   S+P+   D +++P  T LD+YL  +R   L Q+   A+ ++   + +  A+   + ++ +L++L+ EPQNS+PD++IWML G KR  Y R+PAH V++S    +Y G+ CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYEN+   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    +     + PAEKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T +   ++ PTWDQTL+F E+EI G+P  V+E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ +GE+LA+FE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +QL ++ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+EELY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+           K P +P           +  EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E ++G  DFC+TF L RG   E  +D     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET +DLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++R+  P Y   D +    K +++ + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MWVD+ P ALG PGPPFNI  R+A+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRF+FPFDY+P+E    + KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPL--GDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPM----EKVPGARMPVQIRVKLWFGLSVDEKEFNQF-AEGKLSVFAETYENETKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPERKPKHWVPAEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVMDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNFDICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDI--------DDKEPLIP-----------IQEEEFIDWWSKFFASIGEREKCGSYLEKDFDTLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVY-RTDRVMFQDKEYSIEEIEAGRIPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRSLGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2044          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|Q9NZM1|MYOF_HUMAN (Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1)

HSP 1 Score: 1565.44 bits (4052), Expect = 0.000e+0
Identity = 896/2062 (43.45%), Postives = 1256/2062 (60.91%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEV--QLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGP-------QIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFT-NSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDIS----------------------AVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWS-DNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEW-CGTWTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNL----GAXXXXXXXXXKTQVXXXXXXXX-XXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGD--KDLPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPA----FDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPE-YLENDCLKI--CSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGK----NIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + V V +A+N+   +  GK DP V + F+ +KKKTK++   LNP W+E L FDL G  L  +  LG+ V D E IG +KL+G+  V L+DL G ++       ++LL++  + T   ++L + Y PP         G      G      +    +ED  DNA  G    GP       Q+  +    + +R+  S KPQDFQIR++V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N +++ +EL DE IS  ++NS  LR+D L+G FK D+  +Y+EP H  M KWLLL+DPED +SG+KGY+K    +LG GDE P     +  +SD++E+NLL PAG+ LR  TF+L++Y+AED+P MD +  Q +K+ F  N+  K LVDP++ VSFAGK++ T+    N +P+WN+ + + ++FPS+C+++KL ++DWDR++ ND +GT ++ +S                       V +   E GF+PTFGPC+LN YGSPREY+  PD ++ LN GKG+G AYRGR+L+EL T L +T      + PI+ + L  V K+ RRRKY L   F SATML+     I+FEVS+GNYGNK D T    +S TQ + AVFDG++YY+LPW  TKP   +  +WE+IS RL ++N  L +A+RL  NIE +K  +   IP  + A+  +   D++I      +P  +  ++  T LD  ++ +R + L Q+   A+++R+EAT V   + +++ ++ +L  L+ EPQNSMPD+IIWM+ G KR  Y RIPAH V++S   E+  G+ CG  Q I +  P     + +    +P +LR+ IWLG    E+ ++    EG   V AE YENQA + GKW T S L+ R  +SD +GKIKL +E   PP GWEW+G+W + PE SL  + +A  TEF ++++  E R+PGG+W PA   Y++  GD    P+E+  P GWEW    W+ D NR  DE+GWEY +    D     +  AEKMYH     R  R  +       +       +    +D E WEYA +   KFH  +R  D  RRRRW RKM  S   GA+  F L    GA+  E  D +  +    SA        P +   +D+++ Y LR Y++QARNLLA D++ FSDPY+ + F ++S+TTEI + ++ PTWDQT++F EVEI+G+P  V ++PPK+ +ELFD+DQ+G+DEFLGR    P+VKL +       L W P+  G +  G++L   E+ L G    +LP LPP+   N+Y +P GIRP++Q TA+E+L WG+RNMK FQ+ S+ SPS   E GG  +E+ +IKN+ K PNF +  LF  V LPKEELYMPP+ IK+ DHR FGRKP+VG   ++  D++RC     + D +    A      P  D+ I   +  K   A KL                  EE +DWWSK+YAS G+ +KC +Y++  +  L  Y  ELE   +++G  DF  TF L RG +DE ED      VGEFKG+FRIYPLP+D + P P        LP +   EC +RIYI++  +LQP D +GL DPYIKI LGK+    +D Y+PNTLNP FGR++E+   LP  KDL + + DYD   +D+ +GET IDLENR+LSRF + CG+P+ Y  SG+N WRD   P+ +LQ        GFP+  L  D  +I    + ++L +FE  +  + +LG  +ERLALH+L    LV EH+E R L ST QP I QGK++MWVD+ P +LGPPGPPFNI  RKAKKY LRV++ NT DV LDE ++ GE MSDIYVK WI G EE KQ+TDVHYRSLDGEGNFNWRFVFPFDY+P+E   +V KKEHFWS+D+TE R    +  Q+WDNDKFS DD+LG +E+DL     PAK    C+L+++P+         +  +LF+ K + G+WP +    G   + GK+E+ +++L E+EA  +PAG  RD+PN NP LD PNRP TSF WFT+P KT KFI+W+  K
Sbjct:    2 LRVIVESASNIPKTKF-GKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSAPHPNDLSGPSVPGMGG---DGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQLSGNNIRPVVKVHVCGQTHRTRIKRG-NNPFFDELFFYNVNMTPSELMDEIISIRVYNSHSLRADCLMGEFKIDVGFVYDEPGHAVMRKWLLLNDPEDTSSGSKGYMKVSMFVLGTGDEPPPERRDRDNDSDDVESNLLLPAGIALRWVTFLLKIYRAEDIPQMDDAFSQTVKEIFGGNADKKNLVDPFVEVSFAGKKVCTNIIEKNANPEWNQVVNLQIKFPSVCEKIKLTIYDWDRLTKNDVVGTTYLHLSKIAASGGEVEDFSSSGTGAASYTVNTGETEVGFVPTFGPCYLNLYGSPREYTGFPDPYDELNTGKGEGVAYRGRILVELATFLEKTPP-DKKLEPISNDDLLVVEKYQRRRKYSLSAVFHSATMLQDVGEAIQFEVSIGNYGNKFDTTCKPLASTTQYSRAVFDGNYYYYLPWAHTKPVVTLTSYWEDISHRLDAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIEDTRYTLPLTE-GKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEIEDWLDKLMQLTEEPQNSMPDIIIWMIRGEKRLAYARIPAHQVLYSTSGENASGKYCGKTQTIFLKYP----QEKNNGPKVPVELRVNIWLGLSAVEKKFNSFA-EGTFTVFAEMYENQALMFGKWGT-SGLVGRHKFSDVTGKIKLKREFFLPPKGWEWEGEWIVDPERSLLTEADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAWSYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHT---HRRRRLVRKRKKDLTQTASSTARAMEELQDQEGWEYASLIGWKFHWKQRSSDTFRRRRWRRKMAPSETHGAAAIFKLEGALGADTTEDGDEKSLEKQKHSATTVFGANTPIVSCNFDRVYIYHLRCYVYQARNLLALDKDSFSDPYAHICFLHRSKTTEIIHSTLNPTWDQTIIFDEVEIYGEPQTVLQNPPKVIMELFDNDQVGKDEFLGRSIFSPVVKLNSEMDITPKLLWHPVMNGDKACGDVLVTAELILRGKDGSNLPILPPQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNFQMASITSPSLVVECGGERVESVVIKNLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIERLDRFRCDPYAGKEDIVPQLKASLLSAPPCRDIVIE-MEDTKPLLASKLTEKE--------------EEIVDWWSKFYASSGEHEKCGQYIQKGYSKLKIYNCELENVAEFEGLTDFSDTFKLYRGKSDENEDPSV---VGEFKGSFRIYPLPDDPSVPAPPRQF--RELPDSVPQECTVRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYELSCYLPQEKDLKISVYDYDTFTRDEKVGETIIDLENRFLSRFGSHCGIPEEYCVSGVNTWRDQLRPTQLLQNVARFK--GFPQPILSEDGSRIRYGGRDYSLDEFEANKILHQHLGAPEERLALHILRTQGLVPEHVETRTLHSTFQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDVILDEKSITGEEMSDIYVKGWIPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQLCIVAKKEHFWSIDQTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDMIPDLKAMNPLKAKTASLFEQKSMKGWWPCYAEKDGARVMAGKVEMTLEILNEKEADERPAGKGRDEPNMNPKLDLPNRPETSFLWFTNPCKTMKFIVWRRFK 2025          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|A6QQP7|DYSF_BOVIN (Dysferlin OS=Bos taurus OX=9913 GN=DYSF PE=2 SV=1)

HSP 1 Score: 1563.13 bits (4046), Expect = 0.000e+0
Identity = 891/2079 (42.86%), Postives = 1240/2079 (59.64%), Query Frame = 1
Query:  154 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXX--XXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNS-----------GSGPQIKIKKV-----------GKRTT----RKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPP-KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTF-KKPKEPA--AHKLPSLP--DIFKGKKKPTKVIVEED-IDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            SD Y    F G KK+TK I  N+NP W+E   +DL G  L     L V V D E +G ++ +G  ++PLR+ LA           LLD  K+PT   L L+V Y P   A          +       +D     G EED  D    G+            G G     KK            G++ +     K  S KPQDFQIR++V++ RQL G NI PV KV    Q K+T++    NSP +N + FFN   S AELF+E I   + +SR LR+DALIG F+ D+  IY EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE+NLLRP GV LR A F L+V++AEDLP MD +    ++Q F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGR+L+ L T+L E ++    V  ++ + + RV K+LRRRKY L  AF SATML+  D  ++FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPWG+ KP  V+  +WE+I  R+ + N  LRIAD+L   +E++ +AL A   +E+    V    D+LI   S+P+   D  + P  T LD+YL  +R + L Q+   A  ++   + +  A+   + ++ +L++L+ EPQNS+PD++IWML G KR  Y R+PAH+V++S     Y G+ CG LQ I +  P+    +      +P Q+R+++W G   +E+ ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +G+IKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    D     + PAEKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D       S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T +   ++ PTWDQTL+F E+EI G+P  ++E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ AGE+LA+FE+         ++ G              D DLP+ PP +  NIY +P  I+P++QRTA+E+L WG+RNMK +QL SV SPS   E GG  +++ +IKN+ KNPNF    LF +V+LP+EELY PP+ +K+ D+R FGR+P+VG   +++ + + C   +EE        DD     P  D+ I+   K+P  P   A  L  L   ++        K+++EE+ IDWWSK++AS+G+ +KC  YLE   DTL  Y   LE  + ++G  DFC+TF L RG   E  +D     +GEFKG F+IYPLPED   P+P        L +    EC++R+YII+A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL V + DYDLL KD+ IGET IDLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++R+  P Y   D +    K + + + E     NP+LGP +ERLALHVL +  L+ EH+E RPL+S LQP IEQGK++MWVD+ P ALG PGPPFNI  R+A+++ LR ++ NT DV LD+ ++ GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRFVFPFDY+P+E    V+KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C  + L +      FV+LF+ K + G+WP          L GKLE+ ++++TE E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNNVNPVWNEGFEWDLKGIPLDQGSELLVVVKDHETMGRNRFLGEANIPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTPLPGAVPTFPPLTPLEPSPTLPDMDTVADTGGEEDTEDQGLTGDEAEPFLDQSGALGPGAPSTPKKQPSHPPPYHPGGGRKRSAPAPSKPLSDKPQDFQIRVQVIKGRQLPGVNIKPVVKVTAAGQTKRTRIHKG-NSPVFNETLFFNVFDSPAELFNEPIFITVVDSRSLRTDALIGEFRLDVGSIYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLERKDPSEDKEDIESNLLRPIGVALRGAHFCLKVFRAEDLPQMDDAVMDNVRQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQSITLPAMFPSMCEKMRIRVVDWDRLTHNDIVATTYLSMSKISASGGEIEEEPAGVVKPPPATELDDHLGFLPTFGPCYINLYGSPREFTGFPDPYAELNTGKGEGVAYRGRLLLSLETKLVERSE--QKVEALSADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAVQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDIRHRVEAQNQLLRIADQLEAGLEQVHLALKAQCSDEDVDSLVAQLMDELIAGCSQPL--GDVQEMPSATHLDQYLYQLRTRHLSQITEAAQALKLGHSELPAALEQAEDWLLRLRALADEPQNSLPDIVIWMLQGDKRVAYQRVPAHEVLFSRRGTSYCGKNCGKLQTIFLKYPM----EGVPRARMPVQIRVRLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDITGRIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDTDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPRHWVPAEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVVDDRSEDSVSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLPAMDKDSFSDPYAVVSFLHQSQKTVVAKNTLNPTWDQTLIFYEIEIFGEPSSIAEQPPSIVVELYDHDTYGVDEFMGRCICQPSLE------RTPRLAWFPLTRGSQPAGELLASFELIQREKPAIHHIPGFEVQDTTGILEESEDTDLPYPPPQREANIYMVPQNIKPVLQRTAIEILAWGLRNMKSYQLASVSSPSLVVECGGQSVQSCVIKNLRKNPNFDICTLFMEVMLPREELYCPPIVVKVIDNRQFGRRPVVGQCTIRSLEGFLCDPYSEESPSPQGGPDDVSLLSPGEDVLIDIDDKEPLIPIQFADGLSGLAPTNMASSPSSLHKILLEEEFIDWWSKFFASIGESEKCGSYLEKDFDTLKVYDTSLENVKAFEGLSDFCNTFKLYRGKTQEETEDPSV--IGEFKGLFKIYPLPEDPAIPLPPRQFH--QLASQGPQECLVRVYIIRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDSYIPCTLEPVFGKMFELTCTLPLEKDLKVTLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVY-RTDRVVFQDKEYTVEEIEAGRVPNPHLGPVEERLALHVLQQQGLIPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPPFNITPRRARRFFLRCIIWNTKDVILDDLSITGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCTVSKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNHMPKPAKTAEKCSADQLEDTFHPERFVSLFEQKTVKGWWPCVAEEGEKKILAGKLEMTLEIVTESEHEERPAGHGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2071          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|Q9ESD7|DYSF_MOUSE (Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3)

HSP 1 Score: 1559.27 bits (4036), Expect = 0.000e+0
Identity = 890/2081 (42.77%), Postives = 1222/2081 (58.72%), Query Frame = 1
Query:  154 SDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRD-LAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXX--XXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSG------------SGPQIKI--------------KKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN--------------------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGS--------HYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQ-TELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEI---------YLIG--------------DKDLPFLPPKL-GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            SD Y    F G KK+TK I  ++NP W+E   +DL G  L  +  L V V D E +G ++ +G   +PL++ LA           LLD  ++PT   L L+V Y P                      +D     G EED  D    G+               GP                  +K      RK  S KPQDFQIR++V+E RQL G NI PV KV    Q K+T+++   NSP +N + FFN   S  ELFDE I   + +SR LR+DAL+G F+ D+  +Y EP+H Y+ KWLLLSDP+D ++GA+GYLK    +LGPGDEAP       E+ ++IE NLLRP GV LR A F L++++AEDLP MD +    +KQ F   SNK+ LVDP++ VSFAGK L +       +P WN+ + +P  FPSMC+++++++ DWDR++ ND + T ++ +S + +   E                     GFLPTFGPC++N YGSPRE++  PD +  LN GKG+G AYRGRVL+ L T+L E ++      P ++  + RV K+LRRRKY L  AF SATML+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG         HYY+LPWG+ KP  V+  +WE+IS R+   N  LR+ADRL  N+E++ +AL A    E+    V    D+L+   S+P+   D ++ P  T LD+YL  +R + L Q+   A+ ++   + +S A+   + ++  L++L+ EPQNS+PD+IIWML G KR  Y R+PAH+V++S     Y GR CG LQ I +  P+    +      +P Q+R+K+W G   +E+ ++    EGKL V AETYENQ   +L+G W T    ++ P +SD +GKIKLPK+   P  GW W GDWF+ PE +L  D +A    F+E++F  + R PGG W   +  Y++  G+     ++I  P GW+W    W+ D NR  DE+GWEY++    D     + P EKMY+        R+      +   + +  K  +    + E WEYA +F  KFH + RK D  RRRRW R+M+   K G +  F L        D +     S S     +  P +   +D  ++Y LR Y++QAR+L A D++ FSDPY+ V F +QSQ T ++  ++ PTWDQTL+F E+EI G+P  ++E PP I VEL+DHD  G DEF+GRC   P ++      R   L WFP+ +GS+ AGE+LAAFE+         ++ G              D DLP+ PP+   NIY +P  I+P +QRTA+E+L WG+RNMK +Q+ S+ SPS   E GG  +++ +I+N+ KNPNF    LF +V+LP+E+LY PP+ +K+ D+R FGR+P+VG   +++ + + C   + E        DD     P  D+ I+           K P +P           V  EE IDWWSK++AS+G+ +KC  YLE   DTL  Y  +LE  E + G  DFC+TF L RG   E  DD     +GEFKG F+IYPLPED   PMP        L      EC++RIYI++A+ LQP DP+G  DPYIKI +GK+  S +D Y+P TL P FG++FE+   LP+ KDL + + DYDLL KD+ IGET IDLENR LS+F A CGLPQTY  SG NQWRD   PS +L  FC ++RI  P Y   D +    K + + + E     NP+LGP +ERLALHVL +  LV EH+E RPL+S LQP IEQGK++MW+DI P  LG PGPPFNI  RKA+++ LR ++ NT DV LD+ +L GE+MSDIYVK W+ G EE KQ+TDVHYRSL GEGNFNWRFVFPFDY+P+E    V KK+ FW LDKTE +    V FQ+WDNDKFS DDFLG++++DL  +P PAK    C L+ L +      FV+LF+ K + G+WP          L GKLE+ ++++ E E   +PAG  RD+PN NP L+ P RP TSF WFTSP+KT KFI+W+  +
Sbjct:   20 SDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQSSELLVVVKDHETMGRNRFLGEAKIPLQEVLATPSLSASFNAPLLDAKQQPTGASLVLQVSYTPPPGAVPLFPPPASLAPSPTLPDMDLVPDTGGEEDTEDQGLTGDEAEPFLDQSAAVGPGGPTTPRKPPSHPPPHYPGAKRKRSSAPPRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIQKG-NSPLFNETLFFNVFDSPLELFDEPIFITVVDSRSLRTDALLGEFRMDVGTVYREPRHAYLRKWLLLSDPDDFSAGARGYLKASLCVLGPGDEAPLDKKDPSEDKEDIEGNLLRPTGVALRGAHFCLKLFRAEDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRVMDWDRLTHNDTVATTYLGMSKISATGGEIEEEPAGVLKSPQATDLDDNLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRVLLSLETKLVEHSEQKVEDLPADD--ILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGNYGNKFDTTCLPLASTTQYSRAVFDGGSLPLPVGCHYYYLPWGNVKPVVVLSSYWEDISHRIEIQNQLLRVADRLEANLEQVHLALKAQCSSEDVDALVAQLTDELLADCSQPL--CDIHEIPSATHLDQYLLRLRTRHLSQIKEAALALKLGHSELSTALEQAEDWLLHLRALAEEPQNSLPDIIIWMLQGDKRVAYQRVPAHEVLFSRRGPSYCGRNCGKLQTIFLKYPM----EGMPGARMPVQIRIKLWFGLSVDEKEFNQF-AEGKLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGKIKLPKDSFRPSAGWAWAGDWFVCPEKTLLHDADAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPVEKMYYT----HRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGMVDDKSEDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYLYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVVEKNTLNPTWDQTLIFYEIEIFGEPASIAEHPPCIVVELYDHDTYGADEFMGRCICQPSLE------RMPRLAWFPLTRGSQPAGELLAAFELIQREKPAIHHIPGFEMHETSRILDETEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMKSYQMASISSPSLVVECGGQTVQSCVIRNLRKNPNFDVCTLFMEVMLPREDLYCPPIVVKVIDNRQFGRRPVVGQCTIRSLENFLCDPYSAESPSPQGGPDDVSLLSPGEDVLIDI--------DDKEPLIP-----------VQEEEFIDWWSKFFASVGEREKCGSYLEKDFDTLKVYDTQLENVEAFGGLSDFCNTFKLYRGRTQEETDDPSV--IGEFKGLFKIYPLPEDPAIPMPPRQFH--QLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIPCTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVSGPNQWRDQLRPSQLLHLFCQQHRIKAPVY-RTDRVTFQDKDYTIEEIEAGRLPNPHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWIDIFPKVLGRPGPPFNITPRKARRFFLRCIIWNTKDVILDDLSLTGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNFNWRFVFPFDYLPAEQVCAVAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQLDLNRMPKPAKTAEKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVTEEGEKKMLAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFR 2054          
BLAST of Fer-1-related vs. UniProt/SwissProt
Match: sp|Q69ZN7|MYOF_MOUSE (Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2)

HSP 1 Score: 1548.87 bits (4009), Expect = 0.000e+0
Identity = 885/2044 (43.30%), Postives = 1239/2044 (60.62%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEV--QLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAE--IGNSG--SGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFT-NSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSM---------RAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLI--ISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWS-DNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEW-CGTWTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNL-GAXXXXXXXXXKTQ----VXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKD---LPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKI--CSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGK----NIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + V V +ATN+   +  GK DP V + F+ +KKKTK++   LNP W+E L FDL G  L  +  L + V D E IG +KL+G+  V L+DL G +         +LL++  + T   ++L + Y PP         G+     G   ++        D         G SG  S  Q+  +    +++R+  S KPQDFQIR++V+E RQL G NI PV KV    Q  +T++K   N+P ++  FF+N HI+ +EL DE IS  ++NS  LR+D L+G FK D+  +Y+EP H  M KWLLL+DPED +SGAKGY+K    +LG GDE P     +  +SD++E+NLL PAG+ LR  TF+L++Y+AED+P MD +  Q +K+ F  N+  K LVDP++ VSFAGK++ T+    N +P+WN+ + + ++FPSMC+++KL ++DWDR++ ND +GT ++ +S + +            E GF+PTFGPC+LN YGSPREY+  PD ++ LN GKG+G AYRGR+ +EL T L E       + PI+ + L  V K+ RRRKY L   F SATML+     I+FEVS+GNYGNK D T    +S TQ + AVFDG++YY+LPW  TKP   +  +WE+IS RL ++N  L +A+RL  NIE +K  +   IP  + A+  +   D++I     + P+ E   N    T LD  ++ +R + L Q+   A+++R+EAT V   + +++ ++ +L  L+ EPQNSMPD+IIWM+ G KR  Y RIPAH V++S    +  G+ CG  Q I +  P     +      +P +LR+ IWLG    E+ ++    EG   V AE YENQA + GKW T S L+ R  +SD +GKIKL +E   PP GWEW+GDW + PE SL  + +A  TEF ++++  E R+PGG W  A   Y++  GD    P+E+  P GWEW    W  D NR  DE+GWEY +    D     +  AEKMYH     R  R  +       +       +    ED E WEYA +   KFH  +R  D  RRRRW RKM  S   GA+  F L GA   +  +  + +        +        P +   +D+++ Y LR YI+QARNL+A D++ FSDPY+ V F ++S+TTEI + ++ PTWDQT++F EVEI G+P  V ++PP + +ELFD+DQ+G+DEFLGR    P+VKL +       L W P+  G +  G++L   E+ ++ +KD   LP LP +   N+Y +P GIRP++Q TA+E+L WG+RNMK +Q+ SV SPS   E GG  +E+ +IK++ K PNF +  LF  V LPKEELYMPP+ IK+ DHR FGRKP+VG   + + D++RC     + D +           L+ +    P  P    +  + D             EE +DWWSK+YAS G+ +KC +Y++  +  L  Y  ELE   D++G  DF  TF L RG +DE ED      VGEFKG+FRIYPLP+D + P P        LP +   EC +RIYI++   LQP D +GL DPYIKI LGK+    +D Y+PNTLNP FGR++E+   LP  KDL + + DYD   +D+ +GET IDLENR+LSRF + CG+P+ Y  SG+N WRD   P+ +LQ   A+ +   P  L  D  +I    + ++L +FE  +  + +LG  +ERLALH+L    LV EH+E R L ST QP I QGK++MWVD+ P +LGPPGPPFNI  RKAKKY LRV++ NT DV LDE ++ GE MSDIYVK WI+G EE KQ+TDVHYRSLDGEGNFNWRFVFPFDY+P+E   +V KKEHFWS+D+TE R    +  Q+WDNDKFS DD+LG +E+DL     PAK    C L+++P+         +  +LF+ + + G+WP + +  G   + GK+E+ +++L E EA  +PAG  R +PN NP LDPPNRP TSF WFT+P KT +FI+W+  K
Sbjct:    2 LRVIVESATNIPKTKF-GKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDSSSSLVIVVKDFETIGQNKLIGTATVSLKDLIGDQNRSLPYKQTSLLNEKGQDTGATIDLVIGYTPPSAPHPNDPSGTSVPGMGEEEEEDQGDEDRVDGIVRGPGPKGPSGTVSEAQLARRITKGKSSRRMLSNKPQDFQIRVRVIEGRQLCGNNIRPVVKVHICGQTHRTRIKRG-NNPFFDELFFYNVHITPSELMDEIISIRVYNSHSLRADCLMGEFKIDVGFVYDEPGHAVMRKWLLLNDPEDTSSGAKGYMKVSMFVLGTGDEPPPEKRDRDNDSDDVESNLLLPAGIALRWVTFMLKIYRAEDIPQMDDAFSQTVKEIFGGNADKKNLVDPFVEVSFAGKKVCTNIIERNANPEWNQVVNLQIKFPSMCEKIKLTVYDWDRLTKNDVVGTTYLYLSKIAASGGEVEATTGETEVGFVPTFGPCYLNLYGSPREYTGFPDPYDELNSGKGEGVAYRGRIFVELNTFL-EKKPPEKKLEPISSDDLLVVEKYQRRRKYSLSAVFHSATMLQDVGEAIQFEVSIGNYGNKFDATCKPLASTTQYSRAVFDGNYYYYLPWAHTKPVVTLTSYWEDISHRLDAVNTLLVMAERLQSNIEAVKSGIQGKIPANQLAEVWLKLIDEVIEDTRYTLPVTEGKANV---TVLDTQIRKLRSRFLSQIHEAALRMRSEATDVKSTLLEIEEWLDKLMQLTEEPQNSMPDIIIWMIRGEKRLAYARIPAHQVLYSTSGGNASGKYCGKTQTILLKYP----QEKTNGPKVPVELRVNIWLGLSAVEKKFNSFA-EGTFTVFAEMYENQALVFGKWGT-SGLVGRHKFSDVTGKIKLKREFFLPPKGWEWEGDWVVDPERSLLTEADAGHTEFTDEVYQNENRYPGGEWKQAEDTYTDANGDKAASPSEMTCPPGWEWEDDAWIYDINRAVDEKGWEYGITIPPDNKPKSWVAAEKMYHT---HRRRRLVRKRKKDLTQTASSTARAMEELEDREGWEYASLIGWKFHWKQRSSDTFRRRRWRRKMAPSETHGAAAIFKLEGALGADTTEDGEEKGPEKQKHSATTVFGANTPIVSCNFDRVYIYHLRCYIYQARNLMALDKDSFSDPYAHVSFLHRSKTTEIIHSTLNPTWDQTIIFDEVEIFGEPQTVLQNPPNVTIELFDNDQVGKDEFLGRSICSPLVKLNSETDITPKLLWHPVMNGDKACGDVLVTAEL-ILRNKDGSNLPILPSQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNYQMASVTSPSLVVECGGERVESVVIKSLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIDHLDRFRCDPYAGKEDIVPQ---------LKASLMSAP--PCREVVIEIEDTKPLLASKLSEKEEEIVDWWSKFYASSGEHEKCGQYIQKGYSKLKIYDCELEDVADFEGLTDFSDTFKLYRGKSDENEDPSV---VGEFKGSFRIYPLPDDPSVPAPPRQF--RELPDSVPQECTVRIYIVQGLQLQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYELSCYLPQEKDLKISVYDYDTFTRDEKVGETTIDLENRFLSRFGSHCGIPEQYCVSGVNTWRDQLRPTQLLQN-VARFKGFPPPVLSEDGSRIRYGGRDYHLDEFEANKILHQHLGAPEERLALHILRTQGLVPEHVETRTLHSTFQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDVILDEKSITGEDMSDIYVKGWISGSEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQLCIVAKKEHFWSIDQTEFRVPPRLIIQIWDNDKFSLDDYLGFLELDLHRTIIPAKTSEKCSLDMIPDLKAMDPLKAKTASLFEQRSMKGWWPCYADKDGTRVMAGKVEMTLEVLNEREADERPAGKGRSEPNMNPKLDPPNRPETSFLWFTNPCKTMRFIVWRRFK 2012          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A267FV95 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001839g4 PE=4 SV=1)

HSP 1 Score: 2149.4 bits (5568), Expect = 0.000e+0
Identity = 1137/2083 (54.58%), Postives = 1472/2083 (70.67%), Query Frame = 1
Query:   85 EMSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLA-GGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQT------DSAGAEEDETDNAEIGNSGSGPQIKIKK----VGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXX-XXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSM----RAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIP----MNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAF------------DPNVDLEINTFKKPKEPAAHKLPSLP-DIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNS-------TGVPE-LTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            +MS + VTV +A NL N++  G+SDP+ ++E +G K +TK I  +LNP W E +  DL G  L+  D L V V D E IGPDKL+G  ++ L+DL  GGK+E+++   L D NKR     + + + Y  PK         +    +G    QT      D      D+ D    G  G G + + K+      KR TR   STK QDFQIRI++VEARQLQG NISPVC+V C NQ+KQT++K STNSP W  +FFFNF++S A+L +E +   +FNSR+LRSDA+IG+FKFDL M+YEE  H ++NKWLLLSDPED   GAKGYLK CA ILGPGDEA     +S  +E ++IE+NLLRPAGVQLRPATF LRVY+AEDLP MD+  FQG+++ FT +S KELVDPY+V  FAGKE++T TKYTNDHP+WNEEL++ LQFPSMC+R+K Q+FDWDR++ +D IGT++IDI  + +     +   G+LP FGPCF+NFYGSPRE+S+L D++E+LN GKG+G AYRGRVL+EL T+L ET + S     I ++ L +V KFLRRRKYRLH AF SA+M+   D  +EFE+S+GNYGNKLD++VP ++S TQPTNAVFDG HYYFLPWG+TKPC+VVE  WE+I  RL SINF  RI ++L +NIEKI VA+ A +P+EEQAQF I+A DDLI+  +K +PEW+P QSP  ELD  L+ +RE ELK +   A K+R E TSV +A+ +LD+F  Q++++++EPQNS PDV+IWML   KR  Y RIPA++V++S NED+ G+ CG +QN+     +  P +    DD  L IPA +RL +WLG EK+E  WH MQ+EG L VLAETYEN+  ++ KW    P   RP WSDASG++++ KEK+NPP GW+WD DW++SPE+SL++DK+A  +EF ED++V E R PGG W  A ++Y++ +GDP      + LPEGW W   W VDFNRPCDEEGWEY V+ S+GGY P EKM+HM RRRRY+R R LA     +E   +K    +T+  + WEYA  F  KFH ++R +DMVRRRRWHRKM  TKPGA CFFN+                S    K  MAAPRM + YD   K+QLRAY+FQAR+LLA DQ+G SDPY+RV F  +S  TE  ++S+CPTWDQTL+F  VE+  DP  +  +PP + VE+FD DQLGEDEFLGR    PMVKL   D RR VLQW PI KGS+E GE+LAAFE++L  D  +P  PPK G +++ +PDGI+P++QRT +E+L WGVRNM+ FQL+SV SPS EFEIGG+ + +++IKN  +NPNF  P LF DV+LPKE LY+PPMNI++RDHR FGRKP+VG + +K  D+YR   L+EE D + +FPA              P V+ E+ T  K      + L SL  DI +         ++EDIDWWSKYYAS G   KC KY++L +DTL  Y   LEFSE++D F DFCST+   RG N + ++      VGEFKGTFRIYPLPED   P+P+  L+   +P ++ V+CI+R+Y IKA DLQP+DPSGLADPY++I+LGK+R  +KD+Y+PN L+P FG++FE+K  LP+ KDL ++I DYD L  DD+IGET IDLENRYLS+F A  GLPQ+YY  G NQWRD + P  IL +FC KN +  P++   DCL++ +K F L  FE    SNP+ GP  ERLALHVLN LPLVKEH+E RPL+S LQPGIEQGK++ WVDI P   G P  P NI  RK K Y+LR+++ NT DV L+E ++ GE MSDIYVK W+ GI+EKQETDVHYRSLDGEGNFNWRF FP  Y+P+EN MVV KKEH +SLD TE+    ++  Q+WDNDKFS DDFLGT+E++L+++P+P KK   C ++ LP + K+I+ +NLF+CKR  GYWP  ++        TG    + GK+E+E++LLT EEA L+PAG  +D+PNENPHLDPP RP TSF WFTSPWKTFK+I+WKN K+Y++  L+ V+  LL+VLFIYAIPGLTAR+M  +
Sbjct:    2 KMSKLIVTVDSAANLPNVDTFGESDPFCIVEIKGLKGQTKVIDNDLNPVWKEKIELDL-GPPLSPDDKLTVTVKDHETIGPDKLLGMCEIALKDLVKGGKSEMEVNAPLQDANKRAVGATVKVMIVYVGPKGKGTGVHYTTDSSPSGGGGGQTMDAEDDDEEEEAFDQADGGGGGGGGGGKKSRRKRNVGGAAKRKTRAKLSTKLQDFQIRIRIVEARQLQGANISPVCRVTCYNQMKQTRIKKSTNSPYWGETFFFNFNVSPADLMEELVECGVFNSRRLRSDAMIGAFKFDLGMLYEEDGHVFLNKWLLLSDPEDPQGGAKGYLKICAVILGPGDEAPSFKQASSADEDEDIESNLLRPAGVQLRPATFTLRVYRAEDLPKMDTEIFQGVRKIFTGTSTKELVDPYLVFQFAGKEVRTETKYTNDHPEWNEELRMGLQFPSMCERIKFQMFDWDRMTEDDIIGTNYIDIPLISAQGDTDKDSEGYLPMFGPCFVNFYGSPREFSELGDQYESLNEGKGEGVAYRGRVLLELKTELGETPEQSKE--EIGDDQLLKVQKFLRRRKYRLHAAFSSASMISEVDAPVEFEISIGNYGNKLDESVPPTASTTQPTNAVFDGVHYYFLPWGNTKPCTVVESQWEDIGFRLHSINFLHRILEKLDENIEKIHVAIKAKLPDEEQAQFTIAAIDDLIVMCNKDLPEWEPGQSPANELDLNLQSLRENELKNIRRAASKLREECTSVEEAVNELDSFRNQIRAIAIEPQNSFPDVVIWMLCADKRIAYYRIPAYEVLFSKNEDFCGKFCGKVQNVQFKQFLKSPTV--KSDDPKLQIPALVRLMVWLGHEKDENEWHKMQREGNLSVLAETYENEWFII-KWMKNGP--GRPAWSDASGRVEILKEKLNPPPGWKWDKDWYVSPELSLFYDKDAGHSEFTEDVYVNETRLPGGAWQDAKVKYTDVKGDPYSDMQSVKLPEGWRWKDEWKVDFNRPCDEEGWEYTVEASMGGYVPVEKMFHMCRRRRYIRARVLAQAAAVEENQPRKGPAEITDPEQCWEYAIGFGQKFHTNKRPVDMVRRRRWHRKMVPTKPGAPCFFNM--------------TESSGDNKALMAAPRMVLLYDNSRKWQLRAYVFQARDLLAGDQSGLSDPYARVCFHTRSGVTETIDQSLCPTWDQTLIFDNVEMFSDPYSIEANPPPVVVEIFDADQLGEDEFLGRALVQPMVKLDPTDPRRPVLQWHPIFKGSKEGGELLAAFELFLSADP-MPPTPPKRGSDLFVVPDGIKPVLQRTGIEILCWGVRNMQSFQLMSVTSPSVEFEIGGHQVISDVIKNTKRNPNFQQPLLFMDVMLPKETLYLPPMNIRVRDHRQFGRKPMVGLHVIKCLDEYRTEPLSEEFDAISNFPALLNAHSNERPVNLAPKVETEVTTKAKA---LVNLLTSLVIDISQ---------LDEDIDWWSKYYASTGDVKKCRKYVDLGYDTLKLYTHSLEFSENFDNFSDFCSTYGFQRGKNLDDDEGNV---VGEFKGTFRIYPLPEDLGLPLPLKQLEKG-IPDSNPVDCIVRVYTIKAIDLQPNDPSGLADPYVEIELGKKRVDNKDKYIPNCLSPVFGQVFELKCILPIDKDLYIRIKDYDFLSSDDVIGETVIDLENRYLSKFNACVGLPQSYYAEGPNQWRDSRKPKEILADFCGKNYLPEPQFEGTDCLRLGAKTFYLDSFEPNRKSNPHYGPDDERLALHVLNCLPLVKEHVETRPLYSPLQPGIEQGKLQCWVDIFPAQFGTPPIPINIEPRKPKDYELRIIIWNTKDVVLEEISITGEAMSDIYVKGWLAGIDEKQETDVHYRSLDGEGNFNWRFKFPMQYLPTENVMVVKKKEHIFSLDATEQFLPPNLVVQIWDNDKFSADDFLGTLELNLSSMPAPKKKSRQCGVDQLPAYNKDIKLINLFECKRAYGYWPCVNDEKPEDERLTGFKHRIAGKIEMELELLTAEEAALRPAGLGQDEPNENPHLDPPKRPETSFLWFTSPWKTFKYIVWKNFKWYIIGALLTVVFGLLLVLFIYAIPGLTARRMVGV 2045          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A210PPE8 (Dysferlin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17269 PE=4 SV=1)

HSP 1 Score: 2028.06 bits (5253), Expect = 0.000e+0
Identity = 1057/2037 (51.89%), Postives = 1409/2037 (69.17%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNK--RPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGS---------GPQIKIKKVGKRTTR-------------KSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXX-XXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAF-TNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASL-LGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCL----ALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKL-PSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEF--GKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            ++V VI ATN+ N+E  G+SDPY  IE++G  KKT+ +   LNP W+E   FDL+G ALT +D L V + D E++G ++L+G + +PLR+L    +E QL+ NL DKN    P++ + N+K+ Y+PP  A  +A   +          Q++  G      D  EIGN            GP +     G+   +             K+ STK  DFQ+R+K++EARQLQG NI PVCKV   NQ KQT+VK STNSP +N SFFFNFH S AELFDE I F++FNSR+LRSDALIGSFK D+ M++ E KH  +NKWLLLSD  D  +GAKGYLK CA ++GPGDEA    ++  K+ESD+IE+NLLRP+GVQLRPATF L+++ AED+P MD +  QG+K+ F      KELVDPY V SFAGKE+ + T Y+NDHPDWN+ L++ LQFPSMC+RLK  + DWDR+  +D +GT ++ I+ + S   E GFLPTFGPC++NFYGS REYSDLP+++E LN GKG G AYRGRVL+ELTT+L    +V+  V  I  E   RV KF+RRRKY+LH +F++ATM+   D  +EFEVS+GNYGNKLDD VP  SS TQPTNAVFDG HY FLPWG TKPC VV+ HWE+IS RL ++N    I D+L  NIE++K+ + A +P  E AQ +IS  + L+    KP+P+  P +    +LD+     R  EL  +   A  +R  AT V +A+ + + F+  +K+L+ EPQNSMPDVI+WM++G KR  Y RIPA+++++S + +Y GR CG LQ+I + +P   +   DK   +PA LR+++WLG   EE+ WH MQ EG+L V AETYEN+ S+ +  WT K PL  RP WSD+ GK+KL KE  +PP GW WD +W+ISPE+S+ FDK+A    ++ED++ C  R PGG+WG AT  +++ +GD C    E  LP GW W   W  D  R  DE+GWEY V+ ++GGY P EK YHM RRRR++R R++     K+++  KK  +      + WEYAP+F++KFH  E  +DMVRRRRWHRKM +  PGASCFF++  ++++ D  E                PRM++ +DK +KYQLRAY++QAR+LLA D++G SDPY+RV    QS  TE  +KS+CPTWDQT++F+E EI GDP  +   PP+I VE++DHD+LG +EFLGR  A PMVKL  +D R  VLQW+ I++G+ + GE+LAAFE++L+G  DLPFLPPK GN++ +P+GIRP+MQRT VEVL WGVRNMKKFQL  V SPS EFE GG+++ + +IKN  KNPNF    LFFDV+LP+EELYMPPMNI++RDHR FGRKP VG + LK  +++RC     A+T++ D         P  D  I+       PA +K  P + DI             E++DWWSKYYAS+G   KC KYL+   D +  +  ELE SE+Y  FDDFC  F L+RG ++E E+      VG+FKG+F++YPLP    EP+P      +NLP +   ECI+R+Y+I    LQP+D SGLADPY++I+LGK++ SS+D+Y+PN++ P FG+ F++K  LPV KDL V+I DYD++  DD+IGET IDLENR+LS+ RATCG+P++YY +G+NQWRD Q P  IL  +C KN +  P +   + +K+ +K ++LS FE    S+P+LG   ERLALHVLN LP+VKEH+E RPL++ +QPGIEQGKV+MWVDI P +LGPPG PFNI  RK   + LR ++ NT DV LDE ++ GE+MSDIYVK WI+GI+EKQETDVHYRSLDGEGNFNWRFVFPF+Y+P+E  MVV KKEHFWSLD+TE+R   +V  Q+WDNDKFS DDFLGT+ ++L+A+P PAKK ++C L  LP+   G  ++ V+LF+ KR+ G+WP F++ TG   LTGK+E+E++L++ +EA  +PAG  +++PN NPHLDPP RP TSF WFTSPWKTFKFIIW+  K
Sbjct:    3 LHVLVIGATNVPNVEKFGESDPYATIEYKGLSKKTEVVKSELNPTWNETFEFDLSGLALTDSDELKVTIKDWERVGRNRLLGQVTIPLRNLIRKGSE-QLSSNLNDKNNVCLPSSQI-NMKLSYKPPAGAAKSAGVAAV-------TSQSEVVG------DMTEIGNEEMEEEEEEEEPGPPVIDPATGQVVPKKKKKRRAPRRGLLKNLSTKATDFQVRVKIIEARQLQGANIQPVCKVTVYNQTKQTRVKKSTNSPYFNESFFFNFHCSPAELFDELIEFQVFNSRRLRSDALIGSFKCDIGMVFIEQKHALINKWLLLSDASDTMAGAKGYLKVCACVIGPGDEAPSFKAAGGKDESDDIESNLLRPSGVQLRPATFTLKLFGAEDIPRMDPNFLQGVKKVFGIGEEQKELVDPYFVFSFAGKEIHSKTMYSNDHPDWNQVLRLGLQFPSMCERLKFSVKDWDRIGNDDPVGTSYLPITLISSA-GEEGFLPTFGPCYVNFYGSTREYSDLPNEYEDLNEGKGIGVAYRGRVLVELTTELGALPEVN--VQDIESEETLRVQKFMRRRKYKLHASFLNATMVSAIDAPVEFEVSIGNYGNKLDDNVPPCSSTTQPTNAVFDGCHYSFLPWGATKPCVVVDSHWEDISFRLEALNLLQGILDKLEANIEQVKIGMKAKLPTPELAQLLISLLEQLVQDCRKPLPQPKPGRHTPNKLDELTLQYRASELANIREMAGTLREHATDVVEALNEAENFLQMIKNLAQEPQNSMPDVILWMISGEKRIAYHRIPANEILYSADPNYIGRNCGKLQSICLQLPG-DKAIKDKKFDVPALLRVRLWLGLHNEEKAWHKMQTEGELAVFAETYENEISIPIVGWTNKGPL-GRPKWSDSQGKVKLKKENFDPPPGWRWDSEWYISPELSMLFDKDAGHKVYMEDVYECHSRLPGGSWGEATTPWADVKGDKCLSRGETHLPPGWVWEDEWESDLGRAVDEDGWEYCVEATMGGYGPVEKRYHMCRRRRWIRTRRMVEDPKKQKEKIKKSQEQA----DGWEYAPLFNMKFHCKEHTMDMVRRRRWHRKMVAETPGASCFFSMKTDDDDKDAAESLTA------------PRMFLTFDKSYKYQLRAYVYQARDLLAGDESGLSDPYARVSLLTQSGVTEKIHKSLCPTWDQTIIFEEFEIFGDPKTIESQPPEIFVEIYDHDKLGSNEFLGRARARPMVKLDPSDARMPVLQWYDIRRGNEDGGELLAAFELFLVGGGDLPFLPPKKGNLFLVPNGIRPVMQRTGVEVLCWGVRNMKKFQLAGVTSPSIEFECGGHLVSSKVIKNTKKNPNFDESVLFFDVMLPREELYMPPMNIRVRDHRQFGRKPTVGIHVLKTFEEFRCQPAVPAITQDEDDQGGIVGNGPGGDTIIDM------PADNKTKPEVKDI-------------EELDWWSKYYASIGDTTKCRKYLQKGMDKVKVFTNELEKSENYRSFDDFCHCFDLSRGKDEEDEEGNV---VGQFKGSFKVYPLPPAPGEPLPDRVF--SNLPPSTPEECIVRVYVICGIGLQPNDTSGLADPYVEIELGKKKVSSRDDYIPNSIEPVFGKTFDLKCTLPVKKDLIVRIKDYDIISSDDLIGETIIDLENRFLSKHRATCGIPKSYYVAGVNQWRDSQKPKEILDWYCKKNHLTGPLFYGTNSVKVANKTYSLSDFEVNPRSDPDLGQPDERLALHVLNTLPIVKEHVETRPLYNPIQPGIEQGKVQMWVDIFPKSLGPPGSPFNIEPRKPSGFVLRCIILNTVDVVLDEESITGEQMSDIYVKGWISGIDEKQETDVHYRSLDGEGNFNWRFVFPFEYLPAEQAMVVKKKEHFWSLDETEQRLPPNVVMQIWDNDKFSMDDFLGTLSINLSAMPKPAKKASDCTLRQLPDLQTGHEVKLVSLFEQKRLKGFWPCFNDETGERVLTGKVEMELELVSLQEADERPAGQGQEEPNMNPHLDPPKRPETSFLWFTSPWKTFKFIIWRRYK 1979          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A5K4EQ24 (Fer-1-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 2022.67 bits (5239), Expect = 0.000e+0
Identity = 1047/2066 (50.68%), Postives = 1429/2066 (69.17%), Query Frame = 1
Query:   88 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDS-------AGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNS-SNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN-GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNE--TNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLR-ISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKM---KSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAF-DPNVDLEINTFKKPK----EPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLE------NDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            M  ++V V  A NL N+E+ GKSDPYV+++FQGQK+KTK   ++LNP WDE +  DL G  L  +D + +KVMD +K+ PDK MG   +PL+ +     EV + + L +K  + T   + L ++Y+ P+   G      +Q +    +D   +       +G    + +  +I +  +G   +IKK+G    R  YSTK QDFQIR+KV+EARQLQG NISP+CK+ C  + K T+V+N TNSP W+ +FFFNF  SAAE+ D+ + F +++SR+LR D+LIGSFKFDLS++YE  +H  +NKWLLL +PED  SGAKGYLK    ILGPGDEAP     + +E ++IE NLLRPAGVQLRPA F + +Y AEDLP MDS AF+GIK   T S   KE VDPY +VSFAGK +K+STKY  DHP+WNEE+ + +QFPSMC++LK   FDWDR+  ND IGT  I IS + + R +N GFLPTFGP F+N YGSPREYSDLPDK+EALNLGKG G AYRGRVL+EL+T+L +  T D+   V P+ ++ + R+ K LRRRKY+L+VAF+SATM+   SD  IEFE+S+GN+GNKLD++V   +S T PTN V DG HYY+LPWGD KPC++V+  WE+IS RL ++N  LRIAD L + I  + VA+ AN+P E QAQ  IS+ D+ I+  +  +P+W+P   PQ E+D +L+ +RE +L  +  +A+  R   + +  A+ +L ++   + +L++EPQ S+PD+IIWML G KR  Y RIPAH+V++ DNEDYRG  CG  Q I +  P L++D+   +  IPAQLR+ +W G EK+   W     E KL V+AETYENQAS++G W TK P ++RP WSD +G+I+LPK+ I  PTGWEW GDW++SPE+SL + K+A  T F+E++F  E R P   W  A   Y++ +G+    PN + LP GW W   W +D+NRPCDE+G+EY V+ S GGY  AEK+YHM RRRR +R R L       ++++   ++      E WEYA  FD KFH  ERK+DMVRRRRWHR +   + +   +SC   + +  ++ +   K +      KK  +  PR+++++   H + LRAYIFQAR++LAADQ+G SDP+ R  F   SQ T+I  +++CP WD+TL+F+ +E+ GDP  +   PP + +ELFD+DQL  D FLGR +  P V+L    T  +VLQW+ I+K  ++ GE+LAAFE+ L+  K  P  P + G ++ +P+GIRP++QRT +E+L WGVR M+K++L SV SPS EFEIGG V+E+ +IK+V KNPNF++P LF DVLLPKEE+Y+PPMNI +RDHRAFG+KP+VG + L +   ++  A T + D L D     D     +     +PK     P   K          K+      +++ IDWWSK+YAS+G++DKC KY E  +DT+  Y   LE  E ++GF DFC+TF L+RG N + ++D      GEFKGTFRIYPLPED  E +P+ Y +  ++ ++D  EC++R+YII+A DLQPSD SGLADPY++I +G+ + +SKD+Y+PNTLNPEFG++F+MK  LP+ K+L V + DYD +G DDIIG+T IDLENR L+++RATCGLPQ+Y  SG NQWRD +LPS IL   C    +  P+Y E      N   ++  +VF L  FE     NP+LGP KERLALH+LNKLPLVKEH+E R L+S LQP IEQGK++MWVDI P +LG PGPPF+I  R+  +Y LR+VV NT+DV LDE ++ GE+MSDIYVK W+ G++++Q+TDVHYRSL+GEGNFNWRFVFPF Y+P+EN +V+ +KEHFWS+D TE+R +  +  QVWDND FSPDDF+GT+E++L+ +PSP+K R  C L +L   G   + VNLF+C+R+ G+WP  +  +G P LTGK+E+E++L+T+ EA L+PAG AR+DPNENPHL+PP RP TSF WFTSPWKTFKFIIWK MK+ ++ +LI +++ LL+VLF+YAIP L ARKM  +
Sbjct:    1 MYALHVNVKKANNLKNIEISGKSDPYVVVDFQGQKQKTKVKDDDLNPVWDEEIIIDLKGKPLVASDNVLIKVMDFDKVTPDKFMGQALIPLQSVLSATVEVPICVVLQNKKGQDTMSTIELSLRYEFPQTTKGLTSNEIEQGSVSDKVDAGGAVDVGLRGSGGTGTDVNEKDILDDQAGAGKRIKKLGGLAVRPQYSTKKQDFQIRVKVIEARQLQGANISPICKITCWKESKDTRVRNCTNSPFWDQTFFFNFFDSAAEMLDQQLVFTVYDSRRLRRDSLIGSFKFDLSIVYECDRHAMLNKWLLLCNPEDPMSGAKGYLKISVVILGPGDEAPIMKVGESDEKEDIEGNLLRPAGVQLRPAIFKILLYMAEDLPRMDSDAFKGIKNLLTTSDEEKEFVDPYALVSFAGKSIKSSTKYGTDHPEWNEEITMNIQFPSMCEKLKFTFFDWDRIGYNDPIGTGVISISQISAFRDDNDGFLPTFGPSFINLYGSPREYSDLPDKYEALNLGKGQGVAYRGRVLLELSTELLDEPTADL---VKPLEQDKVARIQKSLRRRKYQLYVAFLSATMIEEKSDGPIEFEISIGNHGNKLDESVTPCASTTPPTNPVSDGLHYYYLPWGDDKPCTMVDSQWEDISFRLGAVNLLLRIADHLERGISHLMVAIKANLPIETQAQLAISSLDEFIMDCNHTLPQWEPENIPQNEMDIHLRKLREDQLNTLREQAINTRETVSEIDDALKELKSYRETILNLAIEPQMSIPDIIIWMLCGGKRTAYHRIPAHEVLYHDNEDYRGLKCGTAQTINLKKPTLLKDEKKPEWKIPAQLRVVVWFGLEKDRTAWTESHNEAKLQVVAETYENQASIVGNWVTKRPPLTRPSWSDNTGRIELPKDSIQLPTGWEWVGDWYVSPELSLLYKKDAGKTSFVEELFYNEFRTPTSPWKVAEPAYTDAQGELKGEPNTVELPSGWTWADDWKIDYNRPCDEDGFEYTVEASTGGYVAAEKLYHMFRRRRLIRSRILGDVGVPVKQEQSLSTEPA----EAWEYAFNFDSKFHTKERKVDMVRRRRWHRALAPKELSSETSSCVLQIRSSSKQVESSLKLK------KKENLTVPRIFMRFRTSHIWHLRAYIFQARSVLAADQSGLSDPFVRCSFQGHSQETQIIQQTLCPIWDETLIFEHIEMCGDPKTILSDPPPVMIELFDYDQLSSDHFLGRLQITPAVRLDTETTWANVLQWYTIEKNRKKGGEILAAFELILLDGKSPPPPPTRRGTLFNVPEGIRPVLQRTGIEILCWGVRAMRKYKLASVNSPSVEFEIGGKVVESTIIKSVKKNPNFASPLLFLDVLLPKEEIYLPPMNICVRDHRAFGQKPMVGVHVLTDFQAFKVPARTSQTDVLMDIQVLTDIACSTQEPCLAEPKVELQSPVKSKSKQKKKFMDLKQ------IDDKIDWWSKFYASIGEWDKCLKYKEFGYDTICVYSHPLEDVEGFNGFTDFCNTFTLSRGKNVDEDEDNY---AGEFKGTFRIYPLPEDPKEQLPIRYFEKLSV-SSDPEECMLRVYIIRAIDLQPSDSSGLADPYVEIIVGQHKVNSKDKYLPNTLNPEFGKMFQMKCILPIEKELHVIVKDYDAVGADDIIGQTDIDLENRRLTKYRATCGLPQSYCVSGPNQWRDSKLPSEILLAVCDSYSLPAPQYGETTESKPNPSCRVGQRVFVLEDFERGMVPNPHLGPPKERLALHILNKLPLVKEHVETRLLYSPLQPNIEQGKLQMWVDIFPTSLGEPGPPFDISPREPNEYILRLVVWNTFDVVLDEKSITGEQMSDIYVKGWLAGLDDRQKTDVHYRSLNGEGNFNWRFVFPFFYLPAENNIVIKRKEHFWSMDVTEQRVRPQLVLQVWDNDLFSPDDFIGTLELNLSNMPSPSKTRGKCSLNMLQSVGNETKLVNLFECRRLNGFWPFVNEESGTPLLTGKIEMEMELVTKAEADLRPAGKAREDPNENPHLEPPKRPETSFLWFTSPWKTFKFIIWKKMKWVIIGLLIFLIIGLLIVLFVYAIPPLLARKMVGV 2043          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A3Q0KNB2 (Fer-1-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 2018.82 bits (5229), Expect = 0.000e+0
Identity = 1047/2083 (50.26%), Postives = 1427/2083 (68.51%), Query Frame = 1
Query:   88 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDS-------AGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNS-SNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN-GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNE--TNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLR-ISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSR-----------------RRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKM---KSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAF-DPNVDLEINTFKKPK----EPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLE------NDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            M  ++V V  A NL N+E+ GKSDPYV+++FQGQK+KTK   ++LNP WDE +  DL G  L  +D + +KVMD +K+ PDK MG   +PL+ +     EV + + L +K  + T   + L ++Y+ P+   G      +Q +    +D   +       +G    + +  +I +  +G   +IKK+G    R  YSTK QDFQIR+KV+EARQLQG NISP+CK+ C  + K T+V+N TNSP W+ +FFFNF  SAAE+ D+ + F +++SR+LR D+LIGSFKFDLS++YE  +H  +NKWLLL +PED  SGAKGYLK    ILGPGDEAP     + +E ++IE NLLRPAGVQLRPA F + +Y AEDLP MDS AF+GIK   T S   KE VDPY +VSFAGK +K+STKY  DHP+WNEE+ + +QFPSMC++LK   FDWDR+  ND IGT  I IS + + R +N GFLPTFGP F+N YGSPREYSDLPDK+EALNLGKG G AYRGRVL+EL+T+L +  T D+   V P+ ++ + R+ K LRRRKY+L+VAF+SATM+   SD  IEFE+S+GN+GNKLD++V   +S T PTN V DG HYY+LPWGD KPC++V+  WE+IS RL ++N  LRIAD L + I  + VA+ AN+P E QAQ  IS+ D+ I+  +  +P+W+P   PQ E+D +L+ +RE +L  +  +A+  R   + +  A+ +L ++   + +L++EPQ S+PD+IIWML G KR  Y RIPAH+V++ DNEDYRG  CG  Q I +  P L++D+   +  IPAQLR+ +W G EK+   W     E KL V+AETYENQAS++G W TK P ++RP WSD +G+I+LPK+ I  PTGWEW GDW++SPE+SL + K+A  T F+E++F  E R P   W  A   Y++ +G+    PN + LP GW W   W +D+NRPCDE+G+EY V+ S GGY  AEK+YHM R                 ++  +RQ         ++     L  L TE  E WEYA  FD KFH  ERK+DMVRRRRWHR +   + +   +SC   + +  ++ +   K +      KK  +  PR+++++   H + LRAYIFQAR++LAADQ+G SDP+ R  F   SQ T+I  +++CP WD+TL+F+ +E+ GDP  +   PP + +ELFD+DQL  D FLGR +  P V+L    T  +VLQW+ I+K  ++ GE+LAAFE+ L+  K  P  P + G ++ +P+GIRP++QRT +E+L WGVR M+K++L SV SPS EFEIGG V+E+ +IK+V KNPNF++P LF DVLLPKEE+Y+PPMNI +RDHRAFG+KP+VG + L +   ++  A T + D L D     D     +     +PK     P   K          K+      +++ IDWWSK+YAS+G++DKC KY E  +DT+  Y   LE  E ++GF DFC+TF L+RG N + ++D      GEFKGTFRIYPLPED  E +P+ Y +  ++ ++D  EC++R+YII+A DLQPSD SGLADPY++I +G+ + +SKD+Y+PNTLNPEFG++F+MK  LP+ K+L V + DYD +G DDIIG+T IDLENR L+++RATCGLPQ+Y  SG NQWRD +LPS IL   C    +  P+Y E      N   ++  +VF L  FE     NP+LGP KERLALH+LNKLPLVKEH+E R L+S LQP IEQGK++MWVDI P +LG PGPPF+I  R+  +Y LR+VV NT+DV LDE ++ GE+MSDIYVK W+ G++++Q+TDVHYRSL+GEGNFNWRFVFPF Y+P+EN +V+ +KEHFWS+D TE+R +  +  QVWDND FSPDDF+GT+E++L+ +PSP+K R  C L +L   G   + VNLF+C+R+ G+WP  +  +G P LTGK+E+E++L+T+ EA L+PAG AR+DPNENPHL+PP RP TSF WFTSPWKTFKFIIWK MK+ ++ +LI +++ LL+VLF+YAIP L ARKM  +
Sbjct:    1 MYALHVNVKKANNLKNIEISGKSDPYVVVDFQGQKQKTKVKDDDLNPVWDEEIIIDLKGKPLVASDNVLIKVMDFDKVTPDKFMGQALIPLQSVLSATVEVPICVVLQNKKGQDTMSTIELSLRYEFPQTTKGLTSNEIEQGSVSDKVDAGGAVDVGLRGSGGTGTDVNEKDILDDQAGAGKRIKKLGGLAVRPQYSTKKQDFQIRVKVIEARQLQGANISPICKITCWKESKDTRVRNCTNSPFWDQTFFFNFFDSAAEMLDQQLVFTVYDSRRLRRDSLIGSFKFDLSIVYECDRHAMLNKWLLLCNPEDPMSGAKGYLKISVVILGPGDEAPIMKVGESDEKEDIEGNLLRPAGVQLRPAIFKILLYMAEDLPRMDSDAFKGIKNLLTTSDEEKEFVDPYALVSFAGKSIKSSTKYGTDHPEWNEEITMNIQFPSMCEKLKFTFFDWDRIGYNDPIGTGVISISQISAFRDDNDGFLPTFGPSFINLYGSPREYSDLPDKYEALNLGKGQGVAYRGRVLLELSTELLDEPTADL---VKPLEQDKVARIQKSLRRRKYQLYVAFLSATMIEEKSDGPIEFEISIGNHGNKLDESVTPCASTTPPTNPVSDGLHYYYLPWGDDKPCTMVDSQWEDISFRLGAVNLLLRIADHLERGISHLMVAIKANLPIETQAQLAISSLDEFIMDCNHTLPQWEPENIPQNEMDIHLRKLREDQLNTLREQAINTRETVSEIDDALKELKSYRETILNLAIEPQMSIPDIIIWMLCGGKRTAYHRIPAHEVLYHDNEDYRGLKCGTAQTINLKKPTLLKDEKKPEWKIPAQLRVVVWFGLEKDRTAWTESHNEAKLQVVAETYENQASIVGNWVTKRPPLTRPSWSDNTGRIELPKDSIQLPTGWEWVGDWYVSPELSLLYKKDAGKTSFVEELFYNEFRTPTSPWKVAEPAYTDAQGELKGEPNTVELPSGWTWADDWKIDYNRPCDEDGFEYTVEASTGGYVAAEKLYHMFRRRRLIRSRILGDVGVPVKQEVLRQ----VIAHDQQSRLSLLQSLSTEPAEAWEYAFNFDSKFHTKERKVDMVRRRRWHRALAPKELSSETSSCVLQIRSSSKQVESSLKLK------KKENLTVPRIFMRFRTSHIWHLRAYIFQARSVLAADQSGLSDPFVRCSFQGHSQETQIIQQTLCPIWDETLIFEHIEMCGDPKTILSDPPPVMIELFDYDQLSSDHFLGRLQITPAVRLDTETTWANVLQWYTIEKNRKKGGEILAAFELILLDGKSPPPPPTRRGTLFNVPEGIRPVLQRTGIEILCWGVRAMRKYKLASVNSPSVEFEIGGKVVESTIIKSVKKNPNFASPLLFLDVLLPKEEIYLPPMNICVRDHRAFGQKPMVGVHVLTDFQAFKVPARTSQTDVLMDIQVLTDIACSTQEPCLAEPKVELQSPVKSKSKQKKKFMDLKQ------IDDKIDWWSKFYASIGEWDKCLKYKEFGYDTICVYSHPLEDVEGFNGFTDFCNTFTLSRGKNVDEDEDNY---AGEFKGTFRIYPLPEDPKEQLPIRYFEKLSV-SSDPEECMLRVYIIRAIDLQPSDSSGLADPYVEIIVGQHKVNSKDKYLPNTLNPEFGKMFQMKCILPIEKELHVIVKDYDAVGADDIIGQTDIDLENRRLTKYRATCGLPQSYCVSGPNQWRDSKLPSEILLAVCDSYSLPAPQYGETTESKPNPSCRVGQRVFVLEDFERGMVPNPHLGPPKERLALHILNKLPLVKEHVETRLLYSPLQPNIEQGKLQMWVDIFPTSLGEPGPPFDISPREPNEYILRLVVWNTFDVVLDEKSITGEQMSDIYVKGWLAGLDDRQKTDVHYRSLNGEGNFNWRFVFPFFYLPAENNIVIKRKEHFWSMDVTEQRVRPQLVLQVWDNDLFSPDDFIGTLELNLSNMPSPSKTRGKCSLNMLQSVGNETKLVNLFECRRLNGFWPFVNEESGTPLLTGKIEMEMELVTKAEADLRPAGKAREDPNENPHLEPPKRPETSFLWFTSPWKTFKFIIWKKMKWVIIGLLIFLIIGLLIVLFVYAIPPLLARKMVGV 2060          
BLAST of Fer-1-related vs. TrEMBL
Match: A0A5K4EPJ1 (Fer-1-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 2018.05 bits (5227), Expect = 0.000e+0
Identity = 1047/2086 (50.19%), Postives = 1427/2086 (68.41%), Query Frame = 1
Query:   88 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDS-------AGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNS-SNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAEN----GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNE--TNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLR-ISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSR-----------------RRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKM---KSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAF-DPNVDLEINTFKKPK----EPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLE------NDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            M  ++V V  A NL N+E+ GKSDPYV+++FQGQK+KTK   ++LNP WDE +  DL G  L  +D + +KVMD +K+ PDK MG   +PL+ +     EV + + L +K  + T   + L ++Y+ P+   G      +Q +    +D   +       +G    + +  +I +  +G   +IKK+G    R  YSTK QDFQIR+KV+EARQLQG NISP+CK+ C  + K T+V+N TNSP W+ +FFFNF  SAAE+ D+ + F +++SR+LR D+LIGSFKFDLS++YE  +H  +NKWLLL +PED  SGAKGYLK    ILGPGDEAP     + +E ++IE NLLRPAGVQLRPA F + +Y AEDLP MDS AF+GIK   T S   KE VDPY +VSFAGK +K+STKY  DHP+WNEE+ + +QFPSMC++LK   FDWDR+  ND IGT  I IS + + R +N    GFLPTFGP F+N YGSPREYSDLPDK+EALNLGKG G AYRGRVL+EL+T+L +  T D+   V P+ ++ + R+ K LRRRKY+L+VAF+SATM+   SD  IEFE+S+GN+GNKLD++V   +S T PTN V DG HYY+LPWGD KPC++V+  WE+IS RL ++N  LRIAD L + I  + VA+ AN+P E QAQ  IS+ D+ I+  +  +P+W+P   PQ E+D +L+ +RE +L  +  +A+  R   + +  A+ +L ++   + +L++EPQ S+PD+IIWML G KR  Y RIPAH+V++ DNEDYRG  CG  Q I +  P L++D+   +  IPAQLR+ +W G EK+   W     E KL V+AETYENQAS++G W TK P ++RP WSD +G+I+LPK+ I  PTGWEW GDW++SPE+SL + K+A  T F+E++F  E R P   W  A   Y++ +G+    PN + LP GW W   W +D+NRPCDE+G+EY V+ S GGY  AEK+YHM R                 ++  +RQ         ++     L  L TE  E WEYA  FD KFH  ERK+DMVRRRRWHR +   + +   +SC   + +  ++ +   K +      KK  +  PR+++++   H + LRAYIFQAR++LAADQ+G SDP+ R  F   SQ T+I  +++CP WD+TL+F+ +E+ GDP  +   PP + +ELFD+DQL  D FLGR +  P V+L    T  +VLQW+ I+K  ++ GE+LAAFE+ L+  K  P  P + G ++ +P+GIRP++QRT +E+L WGVR M+K++L SV SPS EFEIGG V+E+ +IK+V KNPNF++P LF DVLLPKEE+Y+PPMNI +RDHRAFG+KP+VG + L +   ++  A T + D L D     D     +     +PK     P   K          K+      +++ IDWWSK+YAS+G++DKC KY E  +DT+  Y   LE  E ++GF DFC+TF L+RG N + ++D      GEFKGTFRIYPLPED  E +P+ Y +  ++ ++D  EC++R+YII+A DLQPSD SGLADPY++I +G+ + +SKD+Y+PNTLNPEFG++F+MK  LP+ K+L V + DYD +G DDIIG+T IDLENR L+++RATCGLPQ+Y  SG NQWRD +LPS IL   C    +  P+Y E      N   ++  +VF L  FE     NP+LGP KERLALH+LNKLPLVKEH+E R L+S LQP IEQGK++MWVDI P +LG PGPPF+I  R+  +Y LR+VV NT+DV LDE ++ GE+MSDIYVK W+ G++++Q+TDVHYRSL+GEGNFNWRFVFPF Y+P+EN +V+ +KEHFWS+D TE+R +  +  QVWDND FSPDDF+GT+E++L+ +PSP+K R  C L +L   G   + VNLF+C+R+ G+WP  +  +G P LTGK+E+E++L+T+ EA L+PAG AR+DPNENPHL+PP RP TSF WFTSPWKTFKFIIWK MK+ ++ +LI +++ LL+VLF+YAIP L ARKM  +
Sbjct:    1 MYALHVNVKKANNLKNIEISGKSDPYVVVDFQGQKQKTKVKDDDLNPVWDEEIIIDLKGKPLVASDNVLIKVMDFDKVTPDKFMGQALIPLQSVLSATVEVPICVVLQNKKGQDTMSTIELSLRYEFPQTTKGLTSNEIEQGSVSDKVDAGGAVDVGLRGSGGTGTDVNEKDILDDQAGAGKRIKKLGGLAVRPQYSTKKQDFQIRVKVIEARQLQGANISPICKITCWKESKDTRVRNCTNSPFWDQTFFFNFFDSAAEMLDQQLVFTVYDSRRLRRDSLIGSFKFDLSIVYECDRHAMLNKWLLLCNPEDPMSGAKGYLKISVVILGPGDEAPIMKVGESDEKEDIEGNLLRPAGVQLRPAIFKILLYMAEDLPRMDSDAFKGIKNLLTTSDEEKEFVDPYALVSFAGKSIKSSTKYGTDHPEWNEEITMNIQFPSMCEKLKFTFFDWDRIGYNDPIGTGVISISQISAFRDDNDGSEGFLPTFGPSFINLYGSPREYSDLPDKYEALNLGKGQGVAYRGRVLLELSTELLDEPTADL---VKPLEQDKVARIQKSLRRRKYQLYVAFLSATMIEEKSDGPIEFEISIGNHGNKLDESVTPCASTTPPTNPVSDGLHYYYLPWGDDKPCTMVDSQWEDISFRLGAVNLLLRIADHLERGISHLMVAIKANLPIETQAQLAISSLDEFIMDCNHTLPQWEPENIPQNEMDIHLRKLREDQLNTLREQAINTRETVSEIDDALKELKSYRETILNLAIEPQMSIPDIIIWMLCGGKRTAYHRIPAHEVLYHDNEDYRGLKCGTAQTINLKKPTLLKDEKKPEWKIPAQLRVVVWFGLEKDRTAWTESHNEAKLQVVAETYENQASIVGNWVTKRPPLTRPSWSDNTGRIELPKDSIQLPTGWEWVGDWYVSPELSLLYKKDAGKTSFVEELFYNEFRTPTSPWKVAEPAYTDAQGELKGEPNTVELPSGWTWADDWKIDYNRPCDEDGFEYTVEASTGGYVAAEKLYHMFRRRRLIRSRILGDVGVPVKQEVLRQ----VIAHDQQSRLSLLQSLSTEPAEAWEYAFNFDSKFHTKERKVDMVRRRRWHRALAPKELSSETSSCVLQIRSSSKQVESSLKLK------KKENLTVPRIFMRFRTSHIWHLRAYIFQARSVLAADQSGLSDPFVRCSFQGHSQETQIIQQTLCPIWDETLIFEHIEMCGDPKTILSDPPPVMIELFDYDQLSSDHFLGRLQITPAVRLDTETTWANVLQWYTIEKNRKKGGEILAAFELILLDGKSPPPPPTRRGTLFNVPEGIRPVLQRTGIEILCWGVRAMRKYKLASVNSPSVEFEIGGKVVESTIIKSVKKNPNFASPLLFLDVLLPKEEIYLPPMNICVRDHRAFGQKPMVGVHVLTDFQAFKVPARTSQTDVLMDIQVLTDIACSTQEPCLAEPKVELQSPVKSKSKQKKKFMDLKQ------IDDKIDWWSKFYASIGEWDKCLKYKEFGYDTICVYSHPLEDVEGFNGFTDFCNTFTLSRGKNVDEDEDNY---AGEFKGTFRIYPLPEDPKEQLPIRYFEKLSV-SSDPEECMLRVYIIRAIDLQPSDSSGLADPYVEIIVGQHKVNSKDKYLPNTLNPEFGKMFQMKCILPIEKELHVIVKDYDAVGADDIIGQTDIDLENRRLTKYRATCGLPQSYCVSGPNQWRDSKLPSEILLAVCDSYSLPAPQYGETTESKPNPSCRVGQRVFVLEDFERGMVPNPHLGPPKERLALHILNKLPLVKEHVETRLLYSPLQPNIEQGKLQMWVDIFPTSLGEPGPPFDISPREPNEYILRLVVWNTFDVVLDEKSITGEQMSDIYVKGWLAGLDDRQKTDVHYRSLNGEGNFNWRFVFPFFYLPAENNIVIKRKEHFWSMDVTEQRVRPQLVLQVWDNDLFSPDDFIGTLELNLSNMPSPSKTRGKCSLNMLQSVGNETKLVNLFECRRLNGFWPFVNEESGTPLLTGKIEMEMELVTKAEADLRPAGKAREDPNENPHLEPPKRPETSFLWFTSPWKTFKFIIWKKMKWVIIGLLIFLIIGLLIVLFVYAIPPLLARKMVGV 2063          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: myofl (myoferlin like [Source:ZFIN;Acc:ZDB-GENE-111116-2])

HSP 1 Score: 1556.58 bits (4029), Expect = 0.000e+0
Identity = 895/2029 (44.11%), Postives = 1233/2029 (60.77%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGS--------------MRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYA--VDPS--LGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRN-EPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDC-LKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEF-GKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            M   V+ +   I  + +G  DP   + F+G+KKKTK I   LNP W+E L FDL G+AL  +  + V V D E IG DK +GS+ V LR+LA G+T    + N+   N++     +    Q+        +A             + T   G +    + A  G  G  PQ  I+   KR  +K+ + KPQDFQIRI+++E RQL G NI PV KV    Q  +T+++   N+P ++  FF+N ++  +ELFDE I  ++          +   F F +S       H+ M +WLLLSD +D +SGA+GYLK    ILG GD+ P     + EE D+IE+NLL PAGV LR AT  L+VY+AED+P MD +  Q +K  F    +K+ LVDP++ V FAGK+L T     N +P+WN+ + + ++FPSMC+R+KL +FDWDR S+NDAIGT +++++ + S              +  E GFLP FGPC+LN YGS RE+SDLPD +E LN GKG+G AYRGRVL+EL+T+L++  D        N++IL    K+ R+RKY L   F SA ML+     I+FEVS+GNYGNK+D T    +S TQ + AVFDG+HYY+LPW DTKP  ++   WE+IS RL S+N  L IADRL  ++  +K A+ A +PE   A+  +   +        P+PE D  ++  T LD  LK +R+  +  +   A ++R EAT V   + D++ ++ +L+ ++ EPQNSMPD+IIWML G KR  Y RIPA+ V++S  +E   G+ CG  Q I M  P+      +K + IP QLRL +WLG    E+ ++    EG   V AE YENQA + GKW T   L+ R  +SD +GKIKL +E   PP GWEW+G+WFI PE  L  + +A  TEF ++++  + RFPGG W PA   Y++  G+    PNE+  P GW+W   W+ D NR  DE+GWEY   V PS     +  AEKMYH+ RR+R VR RK  A  P  EK +           + WEY+ +   KFH  ER  D  RRRR  RKM  +   GAS  F L        D + ++    +AK      P +   +++ + Y LR Y++QARNLL  D++ FSDPY  V F + S+TTEI   ++ PTWDQTL+F  +EI+GDP  ++ +PP + +E+FD DQ+G+DE +GRC   P+VKL  +      L WFP+    R  GEML A E+ L    ++P +PP+ G  +Y +P GIRP++Q TA+E+L WG+RNMK +Q+ ++ SPS   E GG  ++T +IKN+ KNPNF    LF  VLLPKEE+Y PP+ +K+ DHR FGRKPIVG   +++ +++RC   T+  +      A D  +D+E                    I  G+       +EE +DWWSK +AS+G+ +KC  YL+  + TL  Y++ELE    + G  DFC+TF L RG  D+ E+D     VGEFKG+FRIYPL +D    P P  + +   LP +   EC++RIY+++  DLQP D +G+ DPYIKI LGK+    +D Y PNTLNPEFGR FEM   LP  KDL + + D+DLL +DD +G+T IDLENR LSRF + CGL QTY  SG+NQWRD   PS ILQ       +  P+  ++   L    + +NL   E  +  + +LGP KER+ LHVL K  LV EH+E R L S+ QP + QG+++MWVD+ P +LG PGPP +I  RKAKK+ LRVV+ NT DV LDET++ GERMSDIYVK W+ G+EE KQ+TDVHYRSLDG+GNFNWR+VF FDY+P+E   +V++KEHFWSLDKTE R    +  Q+WDNDKFS DD+LGT+E+DL  L  P+K    C L +L +   KN+ F +LF  K + G+WP      G   LTGK+E+ ++++ E+E   +PAG  RD+PN NP L+ PNRP TSF WFT+P KT KFI+W+  K
Sbjct:    1 MLKVVVESAKGIPKKTLGNPDPIAGVVFRGEKKKTKAISNELNPVWNEVLEFDLKGSALDSSSFVEVVVKDYETIGKDKPIGSVKVFLRELASGQTRSLPSRNIPLINEKKQD--IGPGTQFLCSPAGVSSAGKDGTDAD-----EDTGDWGDQRTPGEPATPGQPGKPPQKMIRTGRKR--QKALANKPQDFQIRIRIIEGRQLAGNNIKPVVKVNVCGQTHRTRIRRG-NNPFFDEIFFYNVNMLPSELFDENIYIQL---------CMFFLFCFVIS-----EAHSIMRRWLLLSDTDDSSSGARGYLKASMIILGTGDDPPVEKREESEEQDDIESNLLLPAGVTLRSATLALKVYRAEDMPQMDDAFAQSVKNMFGGEGDKKNLVDPFLEVGFAGKKLCTKIIEKNANPEWNQLVNVQVKFPSMCERIKLTMFDWDRFSSNDAIGTTYLNLTKIASSGGEFEGSVPHFYSVGNEVGFLPAFGPCYLNLYGSLREFSDLPDPYEELNFGKGEGVAYRGRVLIELSTRLDDKVDKKVDDIS-NDDILV-AQKYQRKRKYSLCAVFHSACMLQEPGEPIQFEVSIGNYGNKMDSTCKPLASTTQYSCAVFDGNHYYYLPWADTKPVVILTSFWEDISHRLDSVNIILFIADRLQSSLTSLKTAMLAKVPETRLAEIWLKLINHF------PLPELD-TKANLTALDIQLKKLRDSAIAGIREAARRMREEATDVKATLPDIEEWLERLQQIADEPQNSMPDIIIWMLRGEKRMAYARIPANQVLFSTLSEQATGKYCGKKQTIFMQYPM----DKNKGVKIPVQLRLNVWLGLSAHEKKFNSFA-EGMFSVFAEMYENQAQVFGKWGTTG-LVGRHKFSDVTGKIKLKQECFLPPRGWEWEGEWFIDPERCLLTEADAGHTEFTDEVYENQSRFPGGEWKPAAEPYTDVNGEKAQSPNEVECPPGWKWEDEWSFDSNRAVDEKGWEYGITVPPSDKPSSWVAAEKMYHIHRRKRMVRPRKKIANAPTIEKKES---------GDGWEYSSLIGWKFHRKERSSDTFRRRRKRRKMAPADSVGASAIFKLEGALGVDIDEKTSK--KDAAKLFGANTPTVSCIFNRSYLYHLRVYVYQARNLLPMDKDSFSDPYCHVSFLHVSKTTEIIKANLNPTWDQTLIFNNIEIYGDPQTIALNPPSVVMEIFDSDQVGKDEAMGRCVCPPVVKLNPSSPVSPKLLWFPVLMKGRSGGEMLVAAELILKDKSEMPLVPPRRGEKLYMVPQGIRPVVQLTAIEILAWGLRNMKTYQMAAISSPSLVVECGGQTVQTGVIKNIKKNPNFPGSVLFLKVLLPKEEMYTPPIVLKVIDHRPFGRKPIVGQCTIESLEEFRCDPYTDTAEV--SRTARDVIIDMEDRR----------------QILDGQ-------MEEAVDWWSKLFASIGENEKCGPYLQKGYSTLTVYQQELEAVTGFHGLTDFCNTFKLHRGKTDDDEEDPSV--VGEFKGSFRIYPLSDDPEILPPPRQFRE---LPESGPQECLVRIYVVRCIDLQPKDSNGMCDPYIKISLGKKVIDDRDNYKPNTLNPEFGRTFEMSCFLPQDKDLKISVYDFDLLSRDDKVGDTVIDLENRLLSRFGSHCGLSQTYCVSGVNQWRDQLKPSQILQNLARLRGVPPPQIADDGSWLSFAGREYNLQDLEAGKVLHQHLGPAKERICLHVLRKQGLVPEHVETRTLHSSYQPTLSQGRIQMWVDVFPKSLGMPGPPVDITPRKAKKFFLRVVIWNTTDVILDETSITGERMSDIYVKGWMPGMEEDKQKTDVHYRSLDGDGNFNWRYVFGFDYLPAEQLCLVSRKEHFWSLDKTEFRIPPKLIIQIWDNDKFSLDDYLGTVELDLIHLLPPSKTPEKCSLNMLTQGPSKNLPFKSLFAQKSVRGWWPCAMEEDGKKVLTGKVEMTLEIVEEKEVEERPAGKGRDEPNMNPRLEHPNRPDTSFLWFTNPCKTMKFIVWRRFK 1949          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 1419.06 bits (3672), Expect = 0.000e+0
Identity = 818/1859 (44.00%), Postives = 1136/1859 (61.11%), Query Frame = 1
Query:  673 FQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFD----LSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSN-KELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPL-QFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAV----GSMRAEN--GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRN-EATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCG-TWTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHK--YQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFE-------------------IYLIGDKDLPFLPP-KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEE----HDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIE-EKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
             Q+R++++E RQL G NI PV KV    Q K+T++K   N+P ++ +FF NF  + A+LFDE I   +F+S+ LR+D++IG FK      LS+++   +H  + KWLLL+DP+D ++GA+GYLK    +L  GDE P+      +E ++IE NLLRPAG+ LR A F L+VY+AEDLP MD +   G+KQ     SN K LVDP + ++FA          T+ H        +P  QFPSMC+++++++ DWDR S ND IGT  + +S +    G +  ++  GFLPTFGPCF+N YGS RE++   D  EALNLGKG+G AYRGRVL+EL T+L E   V   V  I  + L  V KF+R+RKY L  AF SAT L+  D  I+FEVS+GNYGNK D T    +S TQ + AVFDG HYY+LPW + KP  V+   WE+IS R+ ++N  L I D L  N++ +++ L +   +++  Q V+   DD+I   S+ +PE+D N    T LDK L+ +R+  LKQ+   A+ +++   T +S  +   + +  +L+SL+ EPQNS+PD++IWML G +R  Y RIPAH+V++S  + Y G+ CG LQ + M  P            IPAQLR+K+W G   + ++++    EG L V AETYENQ   +L+G W T    ++ P +SD +G+I LPKE   P  GW W GDW I PE +L +D +A    F+E++F  +MR PGG W      Y++  G+     +EI  P GW W    W+ D  R  D++GWEY +    D     + PAEKMYH +RRRR++R R+    K +  + +           EHWEYA +F  KFH  +RK D  RR RW R+M+   K G +  F L        +  K                R+ +   K     Y LR Y++QAR+LLA D++ FSDP++ V F +QSQ T     ++ PTWDQTL+F E+EI GD     +SPP I VEL+D D  G DEF+GR    P +           L W+PI K  +EAGE+LAAF+                   + ++ D DLP  PP +  NI+ +P  I+P++QRTA+E+L WG+RN+K FQL SV SPS + E GG ++++ +I+N  KNPNF    LF DV LP+EELYMPP+ IK+ D+R FGRKP+VG   +++ +++RC   ++E    ++  D+ P   P  D+ I+     KEP          +  G+        +E +DWWSK+YAS G+  KC  YLE   DTL  Y++ELE  E ++   DFC TF L RG   E  +D     VGEFKG F+IYPLP D + P P      + LP N I  C++R+YII+A++LQP D +G  DPY+KI LGK+  +  D Y+P TL P FG++FE+   LP+ KDL + + DYD+L KD+ IGET IDLENR+LSR+ A  GLPQ+Y  SG+NQWRD   P+ +LQ  C +     P Y + D +      +  +  +E +  +P+LGP +ERLAL VL +  LV EH+E RPL+S LQP IEQG+++MWVDI P +LGPPGPPFNI  RKAKK+ LR ++ NT DV LD+ ++ GERMSDIYVK W++G E  KQ+TDVHYRSL GEGNFNWRF+FPF Y+P+E    ++KKEHFWSLDK E +    +T Q+WDNDKFS DD+LG +EMDL  +  PAK    C LE+L       + V+LF+ K + G+WP   +  G   L GK+E+ +++++E+E   +PAG  RD+PN NPHL+ P RP TSF WF+SP+KT KFI +  MK
Sbjct:  175 IQVRVRIIEGRQLPGVNIKPVVKVTVGGQTKRTRIKKG-NNPFFDETFFLNFFETPADLFDEPIFITVFDSKSLRTDSVIGEFKVMCACFLSVLFG--RHAILRKWLLLADPDDLSAGARGYLKASMFVLAAGDEPPTDKKEGVQEKEDIEANLLRPAGLTLRGANFTLKVYRAEDLPQMDDAFMDGMKQFLGFDSNRKNLVDPLVEINFA-------VLLTHVH--------VPFSQFPSMCEKMRIRILDWDRASHNDVIGTTHLCMSKICAPGGEIEVDDSLGFLPTFGPCFVNLYGSLREFTAFSDPHEALNLGKGEGVAYRGRVLLELNTKLCER--VEQRVEDIQPDDLLVVEKFMRKRKYSLFAAFYSATHLQDVDDAIQFEVSIGNYGNKFDCTCLPLASTTQYSRAVFDGCHYYYLPWKNVKPVVVLSSEWEDISPRIEALNMLLSIVDHLESNLKLVQLELQSGGDQDDLEQTVVKLLDDVIADCSEELPEFD-NWPCVTPLDKSLRRLRKVNLKQIEQAALTLKHGPETELSSVLEQAEDWAQRLRSLAEEPQNSLPDIVIWMLQGDRRVAYHRIPAHEVLFS--QGYCGKHCGQLQTVFMKYP----QGGGGCTKIPAQLRVKVWFGLAADVKHFNQFS-EGHLSVFAETYENQTKLALVGNWGTTG--LTYPKFSDVTGRISLPKESFKPSPGWSWAGDWCIQPEKTLLYDADAGHMSFVEEVFENQMRLPGGQWIGMPEGYTDVNGEKATAKDEIECPPGWVWEDPEWSEDLKRAVDDQGWEYGITIPPDRRPKSWVPAEKMYHTNRRRRWIRLRRRDQQKMEALRKQHPDDSE----REHWEYASLFGWKFHLKQRKTDSFRRCRWRRRMEPLEKTGPAAIFALECSLVMRVNSMKFT--------------RLELGRGKFGGTLYHLRCYLYQARDLLAMDKDSFSDPFAIVSFLHQSQKTVTVRNNLNPTWDQTLIFYELEIFGDAEVTEKSPPNIVVELYDQDTYGTDEFMGRSVCQPSL------VSSPRLAWYPILKNGKEAGELLAAFQLIRRDKPSIHRIPGQEVGNVSVLYDTDLPCPPPLREPNIFMVPLNIKPVLQRTAIEILAWGLRNLKSFQLASVTSPSLQVECGGRMVQSCVIRNTKKNPNFDINTLFIDVRLPREELYMPPLVIKVIDNRQFGRKPVVGQCTIRSLEEFRCQPESQEAEPPNEEFDEVPQ-TPRDDVLIDI--DDKEP----------LISGQD-------DEFMDWWSKFYASTGETKKCGSYLEKGLDTLQVYERELEKVEGFEQLADFCHTFKLYRGRTQEESEDPSV--VGEFKGMFKIYPLPNDPSAPCPPRQF--SQLPPNGIEVCLVRVYIIQAFNLQPKDANGKCDPYVKITLGKKSVNDHDNYIPCTLEPVFGKMFELTCSLPLEKDLKIMLYDYDMLSKDEKIGETVIDLENRFLSRYGARSGLPQSYCVSGVNQWRDQLKPTQLLQRLCQRRNYKLPIY-KQDRVYFRGHEYTAADLDEAKQPSPHLGPLEERLALLVLRRQGLVPEHVETRPLYSPLQPEIEQGRLQMWVDIFPKSLGPPGPPFNITPRKAKKFFLRCIIWNTSDVILDDVSVTGERMSDIYVKGWMHGHEGNKQKTDVHYRSLGGEGNFNWRFLFPFHYLPAEQLCTIDKKEHFWSLDKAESKIPPKITIQIWDNDKFSFDDYLGCLEMDLNHMLRPAKSPEKCGLELLSR--TQDKLVSLFEQKTVKGWWPCVCDKEGEKILAGKVEMSLEIVSEQEQDERPAGLGRDEPNMNPHLEDPQRPETSFLWFSSPYKTLKFINYAAMK 1952          

HSP 2 Score: 55.0694 bits (131), Expect = 1.082e-6
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPL 360
            + V ++ A N++  +    SD Y  + ++G KKKTK I  N+NP W+E   +DL G  L  T  + V V D EK+G ++ +     P+
Sbjct:    2 LRVFILCAQNVLTHD-EDISDAYCCVAYEGSKKKTKVIKNNVNPVWNEGFEWDLKGIPLDSTAEIHVVVKDHEKMGRNRYVCVCVCPV 88          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: myof (myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138])

HSP 1 Score: 1405.58 bits (3637), Expect = 0.000e+0
Identity = 814/1848 (44.05%), Postives = 1123/1848 (60.77%), Query Frame = 1
Query:  673 FQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWN--ASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKF---DLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAV----GSMRAENG-----FLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSV--EPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNLGAXXXXXXXXXKTQ--VXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYL---IGDKDLPFLPPKLGN-IYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLEN-DCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKN---IEF---VNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            F+IR++V+E RQL G NI PV KV    +  +T++K   N+P +N   SF+  F I          +  I N  K+       SF F   D+  IY+EP H  M KWLLL+DP+D + GAKGYLK  A I+G GD+ P   + +  +SD++E+NLL PAG+ LR  T  L+V++AED+P MD S  Q +K AF  + +K+ LVDP++   FAGK++ T    +N +P+WN+ + + ++FPSMC+R+KL ++DWDR++ NDA+GT +++++ +    G + AE G     FLP FGP ++N YGSPRE++ LPD +E LN GKG+G AYRGRVL+EL+T+L+   D        N++IL    K+ RRRKY L   F SATM+      I+FEVS+GNYGNKLD T    +S TQ + AVFDG+HYY+LPW DTKP   +   WE+IS RL ++N  L IA+RL  NI ++K A+ A  P+   A+        ++  +S+                 Y   +    L       + I NE T++   +       C   +L +  +PQNSMPDVIIWML G KR  Y R+PAH V++S   E   G+ CG  Q I +  P+      +K   +PAQ+R+ +WLG    EQ ++     G   V AE YENQA +LGKW T   L++R  +SD +GK+KL  E   PP GW+W+GDW + P+ SL  + +A  +EF+++++  + RFPGG W  A   Y++  G+    P+E+  P GW+W   WT D  R  DE GWEY +    D     +  AEKMYH+ RRRR +R RK  A      +            +E WE++ +   KFH  ER  D  RRRRW RKM  S + GAS  F L        +G+       S +        P +   +D+ ++Y LR Y++QARNL+A D++ FSDPY  V F + SQTTEI   S+ P WDQTL+F  VEI+GDP  ++  PP++ +E+FD DQ+G+DE LGR    P+VKL         L W P+      AGE+L + E+ L    G+ DLP +PPK G+ +Y +P G+RP++Q TA+E+L WG+RNMK +QL  V SPS   E GG  +++ +IKN+ K+PNFS   L   VLLPKEE+Y PP+ +K+ DHR FGRKP+VG   + + ++YRC       D      A  P  +L IN  ++P      K                    E IDWWSK+YAS+G+ +KC  YL+  +DTL  ++ ELE   +Y G  DFC+TF L RG  ++ EDD     VGEFKG+F++YPL +D   P P        LP +   EC++RIY+++  DLQP D +GL DPYIKI LGK+    +D Y+PNTLNP FGR+FE+   LP  KDL + + D+DLL  D+ +GET IDLENR LSRF + CGLPQTY TSG+NQWRD   PS ILQ       +  P   +N + L    + + LS FE  ++ + +LGP  ER++LHVL    L+ EH+E R L+ST QP + QG ++MWVD+ P +LG PGPPF+I  RKAKKY LRV+V NT +V LDET++ GERMSDIYVK W+ G EE KQ+TDVHYRSLDG+GNFNWRF++ FDY+P+E   +V+KKEHFWSLDKTE +    +  Q+WDNDKFS DD+LGT+E+DL  L SPAK    C L++L +   +   ++F    +LF  K + G+WP +    G  EL GK+E+ ++++ E+EA  +PAG  R++PN NP L+PPNRP TSFFWFT+P KT KFI+W+  K
Sbjct:  138 FKIRVRVIEGRQLPGNNIKPVVKVNVCGETHRTRIKRG-NNPFFNEVISFYTIFLIPGLMYLIRNYAV-IVNKVKIYIFICFTSFIFPQIDIGYIYDEPAHCVMRKWLLLNDPDDSSCGAKGYLKVSAFIVGTGDDPPVEKTDRDTDSDDVESNLLLPAGIALRWVTLQLKVFRAEDIPQMDDSISQSLKAAFGGTGDKKNLVDPFLEAWFAGKKICTKIIESNANPEWNQLVNLHVKFPSMCERIKLTVYDWDRLTRNDAVGTTYLNLTKIASSGGEVEAETGEPDVGFLPAFGPSYINLYGSPREFTGLPDPYEDLNFGKGEGAAYRGRVLIELSTKLDGKADTDVEAIS-NDDILV-AQKYQRRRKYCLCAVFHSATMILEPGEPIQFEVSIGNYGNKLDSTCKPLASTTQYSCAVFDGNHYYYLPWADTKPVVAIMSFWEDISHRLDAVNIILNIANRLECNITELKTAVQAKAPDLRLAEIWQKLVSQVLEDISRCF---------------YFPTIHHTNLF-----LLNILNE-TALKLFLYVSYCIFCITWTLHMFPQPQNSMPDVIIWMLRGEKRVAYSRVPAHQVLYSVLGEQACGQYCGKTQTIVLQYPM----DKNKGSKLPAQVRVNMWLGLSTHEQKFNAFA-SGLFTVSAELYENQAKVLGKWGTTG-LLNRSKFSDVTGKVKLKHEYFLPPRGWQWEGDWMVEPQKSLLTEADAGHSEFVDEVYENQTRFPGGEWKDAAEPYTDVNGEKSHRPDELECPPGWKWMDEWTFDDKRAVDERGWEYGITIPPDDKPKSWVAAEKMYHVHRRRRKIRPRKKVAGGTAATEVWLTGD------SEDWEFSTLVGWKFHKKERSSDSFRRRRWIRKMAPSDRVGASAIFKLEGSLGIDTEGKGDDKGSKSDAINLLDANTPNVSCVFDQGYEYHLRVYVYQARNLMALDKDSFSDPYVHVSFLHMSQTTEIIKASLNPMWDQTLIFNRVEIYGDPQTIARDPPQVVLEIFDSDQVGKDELLGRSTCPPLVKLDPGMDTPPKLLWRPVIHKGTPAGEVLVSAELILRNKTGETDLPLVPPKRGDELYMVPQGVRPVVQLTAIEILAWGLRNMKMYQLAPVSSPSLVVECGGERVQSAVIKNIKKSPNFSGNVLQLKVLLPKEEMYTPPIVLKVIDHRPFGRKPVVGQCTINSLEEYRC-------DPYVALMAAAPQ-ELHINIEERPLLETQEK--------------------ETIDWWSKFYASIGEHEKCGPYLQKGYDTLKVFENELENVTEYKGLTDFCNTFKLYRGKTEDDEDDPTV--VGEFKGSFKVYPLSDDPAIPSPPRQF--RELPDSGPQECVVRIYVVRGIDLQPKDNNGLCDPYIKISLGKKIVDDRDNYIPNTLNPVFGRMFEVSCFLPQDKDLKISVYDFDLLTHDEKVGETVIDLENRLLSRFGSYCGLPQTYCTSGLNQWRDQLKPSQILQNVARLKGVSPPRSEDNGNTLAFNGQEYRLSDFEANKELHQHLGPATERISLHVLRTQGLIPEHVETRTLYSTFQPTLSQGCLQMWVDVFPKSLGLPGPPFDISPRKAKKYVLRVIVWNTTNVILDETSITGERMSDIYVKGWMPGKEEDKQKTDVHYRSLDGDGNFNWRFIYEFDYLPAEQLCLVSKKEHFWSLDKTEFKIPPQLIIQIWDNDKFSLDDYLGTVELDLHHLISPAKMPEKCNLKMLEQAKASKSPLKFDSSKSLFAQKSVRGWWPCYIEKDGKKELGGKVEMTLEIVHEKEAEERPAGKGREEPNMNPKLNPPNRPETSFFWFTNPCKTMKFIVWRRFK 1916          

HSP 2 Score: 75.485 bits (184), Expect = 7.828e-13
Identity = 43/104 (41.35%), Postives = 60/104 (57.69%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNL 408
            + V V +A+ L   +L G  DP   I F+G+ KKT+ I   +NP W E L FDL G+ L  +  + V V D E IG DKL+GS  + L+DLA G+ +   + NL
Sbjct:    2 LRVVVESASGLPKKKL-GNPDPITYILFKGETKKTRSINSEVNPVWKETLEFDLKGSPLDSSSFIDVIVKDFETIGKDKLIGSAKIYLKDLASGQAKSLPSKNL 104          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: fer1l6 (fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-312])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 385/984 (39.13%), Postives = 545/984 (55.39%), Query Frame = 1
Query: 3400 IKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLI---GDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNT----------------------------DQYRCLALTEEHDRLDDF--PAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASL-------------------------GQFDKC-SKYLELMHDT---------LIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVI----YLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNK---LP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLL-GERMSDIYVKAWINGIEEK-QETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            + Y   H++QLRA+++QAR L+AAD  G SDP++RV F + +  T I N+++ PTW+Q L+  ++ +HG    +++ PP I +E++D D LG+ E+LG   A P+VKL         L + P+  GS   G++L AFE+  +   G   LP      G+IY +P  IRP++++  +EVL WG+R +KK QLL+V  P    E  G  + +++I++   NPNFS     F+V LP++E   PP+ I + D RAFGR  +VG + + N                               +  L     H R   F  P ++P+     ++F + +E    K  S     +     +   V   IDWWSKYYAS+                         G F+   S  LE    +         L  Y KELE   ++  FDD+  TF L RG  +E E       VG FKG F +Y LP+  +E    +    Y  +  +P N  V  +IR+YI+ A +L P+DP G ADPYI ++LGK     +D Y+P  LNP FGR FE++A  P    L + I DYD++G DD+IGET IDLENR+ SR RA CG+P  Y   G N WRDC  P+ +L + C  NR+  P +     + I  KV+        ED    +    E LAL VL++   +P     LV EHIE R L+   +PG++QG+V+MWVDI P+ +  PGPP +I  RK K Y+LR+++ NT DV L++TN + G++ SDIYVK W+ G+E+  QETDVHY SL GEGNFNWRFVFPF Y+P+E  +VV+K+E+ +SLDKTE++    +  QVWD ++ S DDFLG++E+DL   P  AK   +CK+E+L E   NI   ++F  KR  G+WP   +     ELTGK+E E  L+T EEA   P G AR +P     L+ PNRP T+F WF +P+K F  +IWKN K
Sbjct:  730 VLYKDHHEFQLRAHMYQARGLIAADNTGLSDPFARVSFQSHTHVTAIINQTLTPTWNQMLMMDKLSLHGMLTELAQEPPLITIEVYDDDALGKPEYLGSTVAVPVVKLAEEPYTAPSLHYSPLFCGSLSGGDILGAFELIEVPKSGKHSLPPYDDPEGSIYPVPSYIRPVLRKYRIEVLFWGLRELKKVQLLTVDRPQVFIECAGKGVSSSVIQSYKSNPNFSMIVDAFEVELPEDEYLHPPLTITVVDWRAFGRSTLVGNHVINNLILFKYTPPSLPPPRAQPQEPDIIERNGFSDFTSLHKYTAHQRCPVFSPPVYNPHSS---DSFTQERESKKSKRRSTKRKKRTAADESADCV---IDWWSKYYASVEKIQMVRLNSSHQFRFQLKPKSEKVGCFNIADSMILETFQSSTCIPGKDALLKIYDKELE--AEFGPFDDWVKTFELYRGKANEEESSSAERFVGNFKGRFCLYKLPD--SEEYDCVDSGDYKINQGIPPNTAVNVLIRVYIVSASNLHPADPDGKADPYIVLKLGKTVIKDRDNYIPKQLNPVFGRSFEIQASFPKESLLKILIYDYDVIGGDDLIGETQIDLENRFYSRHRAMCGIPSEYAIDGYNAWRDCIKPTDLLIKLCKDNRLDSPRFTPGR-ITIGEKVYTGKTVFADED---QMVESYEHLALKVLHRWEEMPGVGCKLVPEHIETRALYIKDKPGLDQGQVQMWVDIFPMDMPHPGPPVDISPRKPKGYELRIIIWNTEDVILEDTNFITGQQSSDIYVKGWLKGLEDDGQETDVHYNSLTGEGNFNWRFVFPFHYLPAEKLVVVSKRENIFSLDKTEQKLPAVLVMQVWDFERLSSDDFLGSVELDLHGFPRGAKTAKDCKMEMLKESNDNI---SIFQQKRSKGWWPFIKSE----ELTGKVEAEFHLVTAEEAEKNPVGRARKEPEP---LEKPNRPDTTFSWFVNPFKCFFHLIWKNYK 1689          

HSP 2 Score: 292.352 bits (747), Expect = 4.306e-79
Identity = 218/726 (30.03%), Postives = 346/726 (47.66%), Query Frame = 1
Query:  610 IKIKKVGKRTTRK-SYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRP-ATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSAND-AIGTHFIDISAVGS-MRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTP------------------------------INEEILTRVSKFLRRRKYRLHVAFMSATML--RISDTTIEFEVSMGNYGNKLDDTVP----------------------------ASSSCTQPT-----NAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAF---DDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKI---RNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKE 2562
            IK+K+  K+  +   ++ +     I I + EARQL G NI P   ++  ++ KQ+ VK  TN+P +N  F F+F       FD+ I   + +S+ ++S   IG+FK D+  +Y +P H + NKW  L DP D ++G KG+LK    + G GD +P        E    +  L+      +RP A + ++VY+AE LP M+SS    + +AF  S N  L+DPY+VVSF  +  +TST+ +   P WNE++     FP +C RLK+Q+   D  S ND AIGTH+ID+  + +    + GFLPTFGP ++N YGS R  S L D  + +N G G+G +YRGR+ ++L  ++      S S+                                +   +  +VS+      + L  A   ATM+  RI D  I FE ++GN GN +D   P                            A+ SC   T     +       YY+LP    KPC  V+C WE+ + RL   N   RIA                         FV +A+    + I S+ K + +     +  T LDK    + +QEL+ MI  A  I   + +  ++ + + +      +++ L  EPQ+++PD+ +WML+ +KR  Y RIPA ++++S+N   +G+ CG +  + +  P     K      + A++ + +WLG+  E
Sbjct:   14 IKMKRRKKKADKGLVFANRGAQGTISINITEARQLVGENIDPSVVIEIGDEKKQSSVKEGTNAPFYNEYFVFDFFAHQEIFFDKVIKLSVMHSKIMKS-YCIGTFKIDVGTVYNQPGHQFTNKWAALIDPNDISTGVKGHLKCDICVTGKGDVSPRSQKFSDAEEQIEKNPLVPEGFPSMRPWARYYVKVYRAEGLPRMNSSIMANVTKAFV-SDNTALIDPYVVVSFFSQVGRTSTQKSTADPVWNEQVVFKEMFPPLCRRLKIQVL--DEGSMNDVAIGTHYIDLCRISNDQDGDKGFLPTFGPAWINIYGSARN-STLVDDNQEMNEGIGEGVSYRGRLYIQLAVEILTGGAESKSMFSLKLPSKDAKGGKTAGKDPKAGTGGADTSFIVGNLVFVKVSE-ENMENFILFGAMFEATMIDRRIGDKPISFEFTIGNCGNFIDGAAPPAAKKRGERGFDHPGQEGAMTTPLLEGQAALSCKSTTRPEKPHTGHGNRVYYYLPISTQKPCIHVQCSWEDRTYRLHHSNMLDRIA-----------------------FLFVSTAYYCGQEFIASVEKKVKD-----NCLTMLDKKRLTLCKQELESMIEVAGTITEPKRKVLTIKEMLQESRKLTQKIRFLVEEPQHTLPDIFVWMLSNNKRLAYARIPARNLLYSENVVEKGKDCGKISTLFLKPP----GKRGATWAVQAKVDVYLWLGKCTE 701          
BLAST of Fer-1-related vs. Ensembl Cavefish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 367/956 (38.39%), Postives = 552/956 (57.74%), Query Frame = 1
Query: 3388 PRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRS----VLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPP-------KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEED-----------IDWWSKYYASLGQFDKCSKYLELMHDTLI-------FYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXS---VGEFKGTFRIY--PLPEDRNEPMPVIYLDS-----ANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNK---LP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLL-GERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWP-VFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            P + + Y     +QLR +++QAR+L AAD  G SDP++RV F   SQ TEI N+++CPTWDQ LVF  VE++G+   + + PP I +E++D D +G+ +F+GR  A P+ K+             L+++ + +G+  AGEMLAAFE+  IG      LPP         G I  +P GIRP++ +  +EVL WG+R++K+  L  V  P  + E  G  +++ +I+N  KNPNFST   +F+V LP+ EL  PP+NI++ D RAFGR  +VG++ + +  ++                 + P+ D  +N +         K+P  PD  K  K   K     +           +DWWSKY+AS+    +    L+L+ +           + +ELE   +++ F+D+  TF L RG + + ++   +D    +G+FKG+  +Y  P+ +D    M +   DS      N+P ND +  ++R+Y+I+A DL P+D +G ADPYI I+LGK     K+ Y+   LNP FG+ F+++A  P+   L V + D+DL+G DD+IGET IDLENRY ++ RATCG+  +Y   G N WRD   P+ IL + C   ++  P+Y     +K+ ++V+  +   E ED N       E LAL VLN    +P     LV EH+E RPL +  +PGIEQG++EMWVD+ P  +  PGP  +I  RK KK++LRV++ NT +V L++ ++  GE+ SDI+V+ W+ G +E KQ+TDVHY SL GEGNFNWRF++PFDY+ +E  +V++KKE  +S D+TE +    +  QVWD D FS DDFLG IE+DL   P  AK    C ++++    + +  VN+F  KRI G+WP V  +     E+TGK+E E+ L+T EEA   P G  R++P     L+ PNRP T+  WF  P K  K ++  + K
Sbjct:  867 PPISLIYTMKQIFQLRVHLYQARSLFAADSTGLSDPFARVFFSTHSQVTEILNETLCPTWDQLLVFDNVELYGEACELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQVYRGNCTAGEMLAAFELLQIGPGGKADLPPIDGPTDMDRGPILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQVDRPRVDIECAGKGIQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTSLRKF----------------IYRPS-DKSVNNWST----MGGKIPVKPDDEKDGKGKKKRKKGGEEAEEEELDESMLDWWSKYFASIETLME----LQLLQNNYSSHSSCEQVFNRELE--NEFEHFEDWLHTFNLYRGKSGDDDEQNASDEDRLIGKFKGSLCMYKVPMTDDMGREMGI---DSNMGMFQNIPHNDPINILVRVYVIRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPVFGKSFDIEATFPMDSSLTVSVYDWDLVGTDDLIGETKIDLENRYYTKHRATCGITASYAIHGYNVWRDPMKPTHILAKLCKDGKLDPPQYGPGGRVKVANRVY--TGPTEIEDENGLKKQTDEHLALAVLNHWEDMPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPKDMPAPGPALDISPRKPKKFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLMAEEKIVISKKESMFSWDETEYKIPARLNIQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTIDMVLN-EQEMPMVNIFKQKRIKGWWPFVARDENDELEITGKVEAELHLMTGEEAEKSPVGEGRNEPEP---LEKPNRPDTTLLWFLMPLKAIKHLVCNSYK 1786          

HSP 2 Score: 352.058 bits (902), Expect = 1.467e-97
Identity = 244/755 (32.32%), Postives = 394/755 (52.19%), Query Frame = 1
Query:  583 IGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETN--------DVSASVTP-INEEILTRVSKFLRRRKYRLHVAFMSATML--RISDTTIEFEVSMGNYGNKLDDTVP----------------------------------ASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNAN--IPEEEQAQFVISAFDDLIISLSK--PIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDA--FVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQY-WHGMQKEGK--LVVLAETYENQASLLGKWTTKSPLMS 2676
            + N  S P IKI+    R         P DFQI + V+E RQL G N+ PV  V+  ++ K T +K STN P +N  F F+FH+    +FD+ +   + +S+ L RS  ++G+FK D+  +Y +  H + +KW +L DP+D  +G KGY+K   A++  GD   +   + + + D+IE NLL P GV  + + A F L++Y+AE LP M++S    +K+AF    NK+L+DPY+ V FAG++ KTS + +   P WNE++    QFP +C R+K+Q+ D D+V+ + A+GTHFID+  + S   + GFLPT GP ++N YGS R Y+ L D+++ LN G G+G ++R R+L+ L  ++ +T+        +V     P I++    ++ +F       L  AF+ ATM+  +I D  I FEV++GNYG+++DDT                                     S S T P   V    +Y+ LP+ + KPC  ++  W++   RL++ N    IAD+L + +  ++         PE      +    +DL    S    +   D NQS +T+LD+       +EL+ M  +A  +R +    +       A  F+ +L+ L+ EPQ+S+PD+ IWM++  KR  Y R+P+ D+++S+ E+  G+ CG ++ I   +P        K    PA      W  Q K E Y W G+ ++ K  L  L   +E   ++ G     +P +S
Sbjct:  151 VSNKRSKPDIKIEPGAGR---------PMDFQISVTVIECRQLVGLNMDPVVCVEIGDEKKYTSMKESTNCPYYNEYFVFDFHLPPDVIFDKILKLSVIHSKNLLRSGTVVGTFKMDVGTVYSQADHQFYHKWAILCDPDDITAGCKGYVKCDIAVVAKGDNIKTPHKANETDEDDIEGNLLLPEGVPAERQWARFYLKIYRAEGLPKMNTSIMANVKKAFI-GENKDLIDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIVFTEQFPPLCKRMKVQIRDSDKVN-DVALGTHFIDLRKI-SNDGDKGFLPTLGPAWVNMYGSTRSYT-LMDEYQDLNEGLGEGVSFRARLLVSLAVEILDTSSPEVMCSTEVQVEGVPNISDNAAGKIEEFF------LFGAFLEATMIDRKIGDKPINFEVTIGNYGSEVDDTPTKPKSKKSKKGDGDDEESELIQGSSDEEVTDDGELVSVSTTPPMKPVITDRNYFHLPYFERKPCIYIKSWWQDQRRRLYNANIIDNIADKLEEGLNDVQEIFKTEKAFPERR----LRGVLEDLSHGCSNFLELANKDQNQSGKTKLDRERLKSCMRELENMSQQAKTMRTQVKKKTVKDKFKQAQIFLQKLRFLADEPQHSVPDIYIWMISNGKRIAYARVPSKDILYSNVEEETGKDCGKVKTIFFKLP-------GKKGFGPAG-----WTVQAKTEMYLWLGLNRQRKDFLSGLPNGFEENKAVKGPGMQSAPPIS 870          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001770.1 (pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 gene:ENSPMAG00000001575.1 transcript:ENSPMAT00000001770.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 420/987 (42.55%), Postives = 592/987 (59.98%), Query Frame = 1
Query:  631 KRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAE-----------------------NGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWD--PNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYR-GRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFS 3489
            K  + ++ S KP+DFQ+RI+V+EARQL G NI PV KV    Q K+T+++   N+P ++ +FFFNFH+S+AELFDE I F++ +S  LR+D+ IG+FK D+  +Y+EP+H +  KWLLL DPED +SGAKGYLK    +LG GDE P   S   EE ++IE NLLRPAGV LR A   LR Y+AED+P MD +    +KQ F   SNK+ LVDPY+ VSFAGK L T     N +P+WN+ + +P++FPSMC+RL++ L+DWDR++ NDA+GT F+ +S +     +                        GFLPTFGPCF+N YGSPRE++  PD +E LN GKG+G AYRGR+L+ELTT+L   + ++  V PI  + L RV K+LRRR+Y L   F SATMLR  +  I+FEVS+GNYGNK D T P  +S TQ + AVFDG   Y+LPWG+ KP   +  +WE++  RL ++N  +    RL  NI +++  L A  P E  A   + A D LI   S+ +PE    PN +P   LD+ +   R   L  ++  A ++R EAT V + +++LD ++ +L  L+ EPQNS+PDV++WML G +R  + RIPAH+V+ S    +  G+ CG  Q I +  P     +D     IP Q+R++IWL    + + ++    EGKL V AETYENQ   +L+G W T    ++R  +SD +G IKLP     PP GW+WDGDWF+SPE SL  + +A   EF +++F   +R PGG W   +  Y++  G+  P   +I  P GW W   WTVD  R  DE GWEY V    D     + PAEKMYH +      R+   A  +  ++  K        E  E WEYA +F  ++H + RK D  RRRRW R+M+ S + G S  F L    +     +  +    S     +++P +   +++ ++Y LR Y++QAR L+A D++ FS
Sbjct:  197 KTPSTRAVSRKPRDFQVRIRVIEARQLPGNNIKPVVKVTVAGQSKRTRIRKG-NNPFFDETFFFNFHLSSAELFDELIYFKVLHSHSLRADSEIGTFKLDVGTVYDEPRHTFQRKWLLLCDPEDLSSGAKGYLKVTLLVLGAGDEPPEDRSEAVEEREDIENNLLRPAGVSLRGAFLTLRAYRAEDVPQMDDAVLDTVKQIFGFDSNKKNLVDPYLEVSFAGKTLCTKIIEKNANPEWNQAISLPIRFPSMCERLRITLYDWDRLTHNDAVGTAFLSMSQISCPGGDEPEAFITMRCLRLNLLRLIEDEGTGFLPTFGPCFINLYGSPREFTGFPDPYEELNFGKGEGVAYRGRILVELTTKLE--DHINNKVEPIPSDDLLRVEKYLRRRRYNLCATFYSATMLREVNEPIQFEVSIGNYGNKYDVTCPPLASTTQYSRAVFDGCSSYYLPWGNIKPVVTLTSYWEDVGHRLEALNILMHTQRRLEVNIGRVRATLQAREPVEAVAVSWLHAIDTLIEDCSQALPEITERPNVTP---LDREVWRARSATLALILRSAQRLREEATRVEETLSELDDWLERLTELTREPQNSIPDVVVWMLRGDRRVAFARIPAHEVMHSSLGPHACGKNCGITQTIVLKYP-----QDTHGFKIPGQVRVRIWLSLAADSKSFNETS-EGKLAVFAETYENQTRLALVGGWGTTG--LTRHKFSDVTGHIKLPMHSFLPPLGWQWDGDWFVSPERSLLHEADAGHMEFTDEVFESNLRLPGGQWRALSDNYTDVNGEKLPPLADIECPAGWFWEEAWTVDTKRAVDESGWEYGVTIPPDARPRAWVPAEKMYHTN----RRRRWARARRRDTRKAAKLPRVLKPEEQGEGWEYASLFGWRYHLEMRKTDTSRRRRWRRQMEPSERLGPSAVFQLEGAIQVDSAWDDDEGKKVSKPVLGVSSPTISCIFEQGYRYHLRCYLYQARELIALDKDSFS 1165          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001654.1 (pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 gene:ENSPMAG00000001492.1 transcript:ENSPMAT00000001654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 382/963 (39.67%), Postives = 563/963 (58.46%), Query Frame = 1
Query: 3388 PRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKL--QANDTRR--SVLQWFPIKKGSREAGEMLAAFEIYLI------------------------GDKDLPFLP----PKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKG---KKKPTKVIV----EEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYK---KELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXS-VGEFKGTFRIY--PLPED--RNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLN---KLP----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLL-GERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWP-VFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            P + + Y +   +QLR +++QAR+L AAD  G SDP+ R++F   SQ TE+  +++CPTWDQ LVF  +E++G+   + + PP I +E+FD D +G+ +F+GR  A P+VK+  +  D  R    L ++ I +G+  AGE+LAAFE+  +                        G  DLP +      + G I  +P GIRP++ +  +EVL WG+R++K+ QL++V  P  + E  G  +++ +I +  +NPNFST F  F+V LP  EL  PP+NI++ D RAFGR  +VGT+ + +  ++   A ++                  I T   P +P   +LP+   + +    +    + I+    EE +DWWSKY+ S+   +K  K       + I  K   KELE   ++D F+D+  TF L RG  ++ +   E D  VG FKG+  +Y  PLPE+  R       +     +P+ND +  ++R+Y+++A DL P+D +G ADPYI ++LGK     K+ Y+   LNP FG+ F+++A  P+   L V I D+DL+G DD+IGET IDLENR  S+ RATCG+ Q Y   G N WRD   PS IL   C + ++  P+Y     +K+ ++ F  +   E ED N    P  E +AL VL+   ++P    L+ EHIE RPL    +PGIEQG++EMWVD+ P  +  PGPP +I  RK K  ++RV++ NT DV L++ +LL GE+ SDI+V++W+ G +E KQ+TDVHY S+ GEGNFNWRFVFPFDY+ +E  +V++KKE  +S D+TE +    +T QVWD D FS DDFLG IE+DL   P  AK    C L++L   G ++  +++F  KRI G+WP    N     ELTGK+E EI LLT EEA   PAG  R++P+    L+ PNRP TSF WF +P ++ K++I    K
Sbjct:   21 PPISLIYKEKQMFQLRVHMYQARSLFAADSTGLSDPFGRIIFSTHSQATEVIPETLCPTWDQMLVFDSIELYGEAQELRDDPPIIVIEVFDQDTVGKADFIGRALAKPVVKMSNEKYDAPRFPPQLDYYQIYRGNSTAGELLAAFELLQVATSPTHHHAPRTTAPRPATLIPPSGKGDLPPISGPTDTEHGTILPVPRGIRPILSKYRIEVLFWGLRDLKRIQLVTVDRPRVDVECSGKSVQSVVIPSYKQNPNFSTLFKHFEVDLPDNELLHPPLNIRVVDCRAFGRYTLVGTHTVTSLRKFILRAPSKTKA-------------ANIRTIGDPNDP---RLPASGSVCQSVCPQVTAHQPIIHQPDEELLDWWSKYFVSIETLNKRCKKKLKKKRSPILEKMFDKELE--GEFDNFEDWLHTFSLYRGKIEDDDSSMEEDRLVGRFKGSLCVYKYPLPEELAREVGYDPQFGMFQGIPSNDPIGVLVRVYVVRANDLHPADVNGKADPYIVVKLGKHEVKDKENYISKQLNPVFGKSFDIEAVFPMDSMLTVSIYDWDLVGTDDLIGETKIDLENRLYSKHRATCGISQRYSIHGYNMWRDPLKPSQILARLCKEVKVDPPQYSPEGRVKVANRTFTAAT--EVEDENGQKKPTDEHMALTVLHHWEEIPGACKLIPEHIETRPLLHPEKPGIEQGRIEMWVDMFPADVPRPGPPIDIAPRKPKSLEMRVIIWNTDDVILEDDSLLTGEKSSDIFVRSWLKGQQEDKQDTDVHYNSVTGEGNFNWRFVFPFDYLVAEEKIVMSKKESVFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTSKLCSLDMLKTDG-SVPMISIFKQKRIKGWWPFAARNENDELELTGKVEAEIHLLTSEEAEKSPAGLGRNEPDP---LEKPNRPDTSFMWFLTPLRSIKYLICHRYK 959          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008905.1 (pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 gene:ENSPMAG00000008043.1 transcript:ENSPMAT00000008905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 439.113 bits (1128), Expect = 3.825e-126
Identity = 253/585 (43.25%), Postives = 357/585 (61.03%), Query Frame = 1
Query: 4399 KYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRG-SXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDS----ANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNK--------LPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKL-DETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWP-VFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            +++ +  +  +  K   L  + L  Y KELE   ++D F+D+  TF L RG ++DE +  +E   VG FKG+  +Y  P   N    V Y         +PTND +  ++R+YI++A DL P+D +G ADPYI I+LGK      + Y+   LNP FG+ F+++A  P+   L VQ++D+DL+G DD+IGET IDLE+RY SR RATCG+ Q Y   G N WRD   P+ IL + C  N++  P Y     +K+ +++FN     E ED + +    +E LAL VL+           LV EH+E RPL    + GIEQG++EMWVD+ P  +  PGPP +I  RK K Y+LR+++ NT +V L D+  + GE+MSDIYV+ W+ G +E KQ+TDVHY SL GEGNFNWRF++PFDY+ +E  +V++KKE  +S D+TE +    +T QVWD D FS DDFLG IE+DL   P  AK    C L +L   G ++  +++F  KR+ G+WP V  +     ELTGK+E E+ LLT EEA   PAG  R++P+    L+ PNRP TSF WF +P K+ K++I    K
Sbjct: 1159 QFHKAADKDKQLKKKPHLQVEELKVYDKELE--AEFDNFEDWLHTFNLYRGKTSDEDDILDEERVVGRFKGSTCVYKWPLADNVLKEVGYDAQFGMFQGIPTNDPINVLVRVYIVRATDLHPADINGKADPYIVIKLGKTEVKDNENYISKQLNPIFGKSFDIEATFPMESMLTVQVMDWDLVGMDDLIGETKIDLESRYYSRHRATCGIAQQYAVHGYNTWRDPMKPTQILAKLCKDNKVDGPHYGPGGRVKVANRIFNGPT--EMEDDSGHKKQTEEHLALKVLHSWEEIARVGCKLVPEHVETRPLLHPDKTGIEQGRLEMWVDMFPKDMPHPGPPVDISPRKPKSYELRIIIWNTDEVILEDDAFMTGEKMSDIYVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLVAEEKIVISKKESLFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKSSKQCTLNMLKMDG-SVPMISIFKLKRVKGWWPFVSRDENDEQELTGKVEAELHLLTAEEAEKNPAGLGRNEPDP---LEKPNRPDTSFIWFLNPLKSIKYVICHRYK 1735          

HSP 2 Score: 340.117 bits (871), Expect = 1.393e-94
Identity = 228/691 (33.00%), Postives = 369/691 (53.40%), Query Frame = 1
Query:  655 STKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQ-LNETNDVSASVTPINEEILTRV---SKFLRRRKYRLHVAFMSATML--RISDTTIEFEVSMGNYGNKLD--------------------------------------DTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSK--PIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKS---LSVEPQNSMPDVIIWMLTG-SKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQ 2568
            + KPQ +Q+ + ++EARQL G N+ PV  V+   + KQT  K STN P +N  F F+FH     +FD+ I   + +S+ L RS  L+G+FK D+  +Y +P H + +KW +L+DP+D  +G KGY+    A++G GD   +   S   ++D IE NLL P G+    + A F +R+Y+AE LP M+++    +K+A      ++LVDPY+ VSFAG++ KTS + ++  P WNE++     FP +C R+KLQ+ D D+V+ + AIGTHFID+  + +   + GFLPTFGP ++N YGS R Y+ L D+ + LN G G+G ++R R+L+ ++ + L+ T+   ++ T I+ E +  V   S   +  ++ L  AF+ ATM+  +ISD  I FE+S+GNYGN LD                                      D   + SS T       +   Y+ +P+ + KPC  V   W +   RL++ N   +IAD+L + I  +   +    P  E+   +  A +++ +  S+   +   DP+   +T LD+    +  +EL+QM  +A   R      +   +        L+S   L   PQ+S+PD+ IWML   +KR  Y RIPA D+++S  E+  G+ CG ++ + + +P            + A+L   +WLG  K+ +
Sbjct:   12 AGKPQSYQVSVMIIEARQLVGLNMDPVVIVEVGEEKKQTSQKESTNCPYYNEYFVFDFHTPPNMMFDKIIKLSVIHSKNLIRSGTLVGTFKLDVGTVYSQPDHRFYHKWAVLTDPDDITAGIKGYVNCDIAVVGKGDNIKTPHKSVDNDADSIEGNLLLPEGIPADRQWARFFVRIYKAEGLPKMNTAIVANVKKALM-GQERDLVDPYVQVSFAGQKGKTSVQRSSYEPVWNEQVVFTELFPPLCRRMKLQIRDSDKVN-DTAIGTHFIDLKKICN-DGDKGFLPTFGPAWVNMYGSTRNYT-LMDEHQELNDGLGEGVSFRARLLLGISMEILDITSPELSTNTEISVESIPHVADESCSGKMEEFFLFGAFLEATMIDRKISDKLISFEISIGNYGNSLDGLNKSNILDRSDDEDEYDEGDEDDETELLNDETDDAEMDDDTSGSSTTPSYKPETNDRQYFHMPYYEQKPCVYVRSAWHDQRRRLYNSNIIDKIADKLEEGISDVLETMKMERPHPERR--LRGALEEMSVGCSRFLTLANKDPSAFGRTRLDRDRLKICMRELEQMGPQAKLGRARTRIHTAPHSTRHTTSSTLRSTAALMAAPQDSIPDIFIWMLVNKTKRVAYARIPAKDILYSIVEEETGKDCGKVKTLFLRLPGK-RVFGSGGWTMQAKLEAYLWLGLNKQRK 695          

HSP 3 Score: 223.787 bits (569), Expect = 9.984e-59
Identity = 109/282 (38.65%), Postives = 176/282 (62.41%), Query Frame = 1
Query: 3388 PRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTR----RSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPP-------KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQY 4200
            P   + Y K  +++LRA+++QAR+L AAD  G SDP++RV+F    ++TE+  +++CPTWDQ L F++V ++G+P  + + PP + +E+FD D +G+ EF+GR  A P+VK+            +L ++ I +G   AGE+LA+FE+  +   D    PP         G I  +P GIRP++ +  +EVL WG+R++K+ QL SV  P  + E  G  +++ +I + NKNPNFS    FF+V LP+ EL+ PP+NI++ D RAFGR  +VG+  + +  ++
Sbjct:  716 PPSVLNYHKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLQFQDVYMYGEPRELRDDPPMVVIEVFDQDTVGKAEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPVTAGELLASFELLQVPPADNCKFPPVSGLNDTDRGPIIPVPKGIRPVLAKYRIEVLFWGLRDLKRVQLQSVDRPRVDIECAGKGIQSVVIADFNKNPNFSHLVKFFEVDLPENELFHPPLNIRVVDCRAFGRYILVGSQTVTSLRKF 997          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002265.1 (pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gene:ENSPMAG00000002063.1 transcript:ENSPMAT00000002265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 379.793 bits (974), Expect = 1.627e-118
Identity = 194/363 (53.44%), Postives = 256/363 (70.52%), Query Frame = 1
Query: 5032 SGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQ-GKVEMWVDIHPVALGPPGPPFNIMSRKAKK-YQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEIL--PEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            SG NQWRD   PS IL+          P Y E D L +  + + +S FE    +NP+LGP KERLALH+L  + L+ EH+E R L  ++QPG+EQ GK+ MWVD+ P  +GPPGPPF+I  RKAKK YQLR ++ NT DV LDET++ GE+MSDIYVK WI+G ++ KQ+TDVHYRSL GEGNFNWR++FPF+Y+P+EN  VV++KEHFWSLDKTE R     T Q+WDNDKFSPDD+LG ++++L+ +P PAK    C LE++  P   K  +  +LF+ K + G+WP      G   + GK+E+ +++L ++EA  +PAG  R++PN NP LDPPNRP TSF WFTSP KTFK+IIW+  K
Sbjct:    1 SGQNQWRDQMTPSMILEGVARAKSWPQPIY-EGDRLTLKGRDYLMSDFEAKAPTNPHLGPVKERLALHLLRSMGLIPEHVETRTLEHSIQPGLEQQGKLMMWVDVFPKNMGPPGPPFDITPRKAKKRYQLRCIIWNTKDVILDETSITGEKMSDIYVKGWIDGRDDAKQKTDVHYRSLGGEGNFNWRYIFPFEYVPAENICVVSRKEHFWSLDKTELRLPPKFTIQIWDNDKFSPDDYLGYLDLNLSHMPVPAKSAEKCSLEMVETPTGKKKHKTTSLFEQKNVKGWWPCIAEEDGKKIIAGKVEMTLEILADKEAEERPAGLGREEPNMNPKLDPPNRPETSFLWFTSPLKTFKYIIWRRYK 362          
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004363.1 (pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 gene:ENSPMAG00000003981.1 transcript:ENSPMAT00000004363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 318.931 bits (816), Expect = 3.772e-90
Identity = 223/749 (29.77%), Postives = 385/749 (51.40%), Query Frame = 1
Query:  532 DQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIF-NSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSAND-AIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLM--------ELTTQLNETNDVSASVTP-INEEILTRVSKFLRRRKYRLHVAFMSATML--RISDTTIEFEVSMGNYGNKLD-------------------------------------DTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSK--PIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMK---------IRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTG-SKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEE-QYWHGM 2583
            D  D+      + + +++ N  S P+ ++            + KPQ +Q+ + ++ A++L G NI P+  ++  +  K+T+++ STN P +N  F F+F+ +   +FD  I   +  N   +RS   IG+FK D+  +Y +P H + +KW  L DP+D  +  +GY++    ++G GD       S + + D +E NL+ P G   + + A F + +Y+A  LP M+++    +K+A      K+LVDPY+ VSFAG++ KTS +  +  P WNE++ +   FP +C R+KLQ+ D D+V  ND AIG+HFID++ + +   + GF+PTFGP ++N YGS R Y+ L D+ + LN G G+G ++R R+L+        + + +LN T +V     P IN+ +L ++ +F       L  AFM ATM+   IS+  I FE+S+GNYGN +D                                     D + +  S T P     +   Y+ +P+ + KPC  VE  W +   RL++ N   +IAD+L + I  +K A+  + P  E+   +  A +++     +   +   D +    T+LD+    +R +EL   I  + K         I N+   V + +  L A +  +K    +PQ+S+PDV IWML   +KR  + RIPA D+++++ ++  G+ CG ++ + + +P            + A+L + +WLG  K+   + +GM
Sbjct:  229 DNLDTISIASGKVETSDVSNKRSKPEQRVDPT---------AGKPQSYQVSVMIIRAQKLVGLNIDPMVILEVGDAKKKTRIEKSTNCPNYNEYFVFDFNTAPNTMFDTMIKLTVVHNKDAIRSGTPIGTFKLDVGTVYSQPDHRFYHKWATLIDPDDITADVRGYVQCDITVVGKGDNIKKSHKSIESDDDSLEGNLILPDGCKGERQWARFYVNIYKAVGLPKMNTAIVANVKKALMGQE-KDLVDPYVQVSFAGQKGKTSVQNNSYEPVWNEQVVLTDIFPPLCRRMKLQIRDSDKV--NDVAIGSHFIDLTKICN-NGDKGFMPTFGPAWVNMYGSTRNYT-LVDEHQELNDGLGEGVSFRARLLLQLTTELLDKTSPELNNTTEVMVEDIPRINDSVLGKMEEFF------LFGAFMEATMIDRSISEKLISFEISIGNYGNSIDGLNKSNPQERSDDEDEDDDEDDEEETVLLTAQKAKGTDELSSMFSTTPPMKPETNDRQYFHMPYYEQKPCVYVESTWHDQRRRLYNSNIIDKIADKLDEGISDVKEAMKTDKPHPERR--LRGALEEMSSGCERFCSLANKDSSSIDCTDLDRKRLKMRLKELIYNIQHSFKTMLCMLFIQIINDMMRVMRNL--LSALIACIK----DPQHSIPDVFIWMLVNKTKRIAFARIPAKDILYANADEELGKDCGKVKTLFLKLPGK-RSFGPGGWAMQAKLEVYLWLGTNKQRNNFLNGM 948          

HSP 2 Score: 127.487 bits (319), Expect = 1.728e-29
Identity = 55/150 (36.67%), Postives = 98/150 (65.33%), Query Frame = 1
Query: 3388 PRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTR----RSVLQWFPIKKGSREAGEMLAAFEIYLI 3825
            P   + Y K  +++LRA+++QAR+L AAD  G SDP++RV+F    ++TE+  +++CPTWDQ L +++V ++G+P  + + PP + +E++D + +G+ EF+GR  A P+VK+            +L ++ I +G   AGE+LA+FE+  +
Sbjct:  963 PPRVLTYSKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLEYQDVYMYGEPRELRDDPPMVVIEVYDQNTMGKSEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPLTAGELLASFELLQV 1112          
BLAST of Fer-1-related vs. Ensembl Yeast
Match: TCB1 (Lipid-binding ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to plasma membrane and regulate PI4P levels by controlling access of Sac1p phosphatase to its substrate PI4P in PM; contains 3 calcium and lipid binding domains; non-tagged protein also localizes to mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact; TCB1 has a paralog, TCB2, that arose from the whole genome duplication [Source:SGD;Acc:S000005612])

HSP 1 Score: 48.9062 bits (115), Expect = 8.782e-6
Identity = 36/120 (30.00%), Postives = 63/120 (52.50%), Query Frame = 1
Query:  115 NATNLINMELVGKSDPYVLIEFQGQKK---KTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDL-AGGKTEVQLTLNLLDKNKRPTAGVLNLKVQY 462
            +A NLI  +L G SDPY+      ++    KTK + + LNP+W++  +  +      + DVL +KVMD +    D  +G+ ++PL  +   G TE+ + +  L+ N     G+L+L   +
Sbjct: 1000 SAENLIASDLNGYSDPYLKYYINNEEDCAYKTKVVKKTLNPKWNDEGTIQINNR---LNDVLRIKVMDWDSTSADDTIGTAEIPLNKVKVEGTTELDVPVEGLE-NAGQDGGMLHLAFSF 1115          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO43088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG6])

HSP 1 Score: 1414.05 bits (3659), Expect = 0.000e+0
Identity = 821/1892 (43.39%), Postives = 1143/1892 (60.41%), Query Frame = 1
Query:  643 RKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXX--XXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTN--SSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENG------------FLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWD--PNQSPQTELD----KYLKIVREQELKQMITE---AMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQK-EGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMR-FPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCG-TWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKL----HKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLI-----------------------GDKDLPFLPPKL---GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVL-LPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXS--VGEFKGTFRIYPLPE----DRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLEN-----DCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGI-EEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            R+ +S K QDFQIR+K++E RQL G NI PV +V   NQ ++TK+  STN P +N SF FNFH S AELFD+  S  +      R        K  L      PK  Y++ +  L    +     +GYLK  A +LGPGDE P  +    K+E+ D+IE+N L P GV  +PA F LR++QAED+P MDS   + IK+ F       K LVDPY+ V+F GK+++TS KY +D+P++ E++KIPL FPSMC+R+K+QL+DWDRV  +D IGT F+ +S++     E              F PTFGPCF+NFYGSPRE+S+LPD+ +ALN G G+G AYRGRVL+EL T L  +N++   V+ I  E + RV  FLRR KY+L   F  ATM++  D  +EFEVS+GNYGNK+D++V  ++  T P+N +FDG HY +LPWG+ KP  VVE  WE+I+ RL  +N   R+ D+L  N+++++ AL+A  P +E A FV      L + +S  IP        S     D    K L +        + TE   A+       ++ Q + +L+ ++ +L+ +++EPQN +PDVI+WM++GS+R  Y RIPA +V++S   D  G++CG    + +  P            IPA +R+++W G EK +  W   +K EG  +V AETYEN+  +   WT K+    RPG+S   G+++LP +K   P+GW++ GDW   PE+SL  DK++    F+E+++    R FPGG WG A IQ+++  GD    P E   P GW W    W VD NR  D EGWEY VD S G Y P +K YH+SRRRR+VR+R L   +  K++ ++KL        E WEYAP+F +KFHA ERK+D VRRRR  RK+             G + +         + +K+   T    P + I    +    HK+Q+ AY++QAR+LLA D++G +DPY RV F NQSQ TE++ K++CPTWDQTL+F  V++      +  +PP + +ELFD DQ+G+D+FLGR E  P  ++  N+     L W+PI  G  + GE+LAA E++L+                       G  ++P  P      G I  + D IRP++Q+T VEVL WGVRNMKK+QL S+ SPS +FEIGG +++++++ +  K PNF  P L   ++ LP EE+Y PPMNI+I D+R FGRKP V  + +K+  ++RC A T             P   +++     P +PA   +P                     DWWSKYYASL Q +           T      ELE  E++ G +D  ++F L RG   + +DD+E     VGEFKGTFRIYPLPE    D + P  V      NLP N+ ++C++R+YI+ A DLQP DP GLADPY+ +QLGK++  +KD+Y PNTLNP FG++FE+ A +PV KDL + ++DYDLL +DD+IGET IDLE R L+R+RA CG+P+TY  SG NQWRD + P  +L+E+C +    F  Y        D + +  +V+ L +F    + N +LG K +RLALHVLN+L  + EH+E R L S +QP IEQGKV++WVDI P   G   P  +I +R+   Y+LRV+V NT  V +DET++ GE+MSDIYVK W+ G+ ++K++TDVHYRSLDG+GNFNWR VF F Y+P E  MV+ +KEHFWSLD  E R    +  Q+WDND FS DDFLG+ ++DL  LP P +    C     P  GKN E+V+LF    I G+W  +    G+ E TGK+E+ I++L   EA +KPAG  RD+PN+NPHLD PNRPATSF WFTSP+KT K+IIW+N K
Sbjct:    1 RRRWSDKVQDFQIRVKILEGRQLSGNNIHPVVRVAMSNQKRETKIVRSTNKPVYNESFTFNFHTSEAELFDDLFSPAVSAHSYWRWGI---RPKKQLFQGLPRPKCAYISSFAFL----NVVFLFQGYLKVTAMVLGPGDEPPIKAKLPPKEEDEDDIESNCLMPMGVARQPALFNLRIFQAEDIPQMDSGMGRSIKKFFKGIFGGAKGLVDPYVKVNFCGKKIETSIKYQDDNPEFKEQVKIPLMFPSMCERIKIQLYDWDRVGNDDCIGTAFLSLSSISGQGDEGNELLVILHPSLLCFPPTFGPCFVNFYGSPREFSELPDQDDALNKGIGEGVAYRGRVLIELETTLG-SNEIEQEVSQIETEDIVRVQPFLRREKYKLFACFYEATMIKDVDGPVEFEVSIGNYGNKMDESVAPAN--TAPSNPLFDGCHYNYLPWGNEKPVVVVESFWEDIAFRLEPLNLISRLCDKLEVNVKRVRSALDAPTPPKEDA-FVPMVTSILEVLISDCIPHVGVLSKSSKHCSYDILGRKVLPLNHRDHDLNLTTELKSALDFPGAEINMEQTVGELNGYLQRLRDVAIEPQNCIPDVIVWMISGSERIAYYRIPAQEVLFSTTPDACGKICGKTVELRLKYPGKKGQDLKDHPEIPALVRVELWFGHEKYQDNWTAREKSEGDFIVYAETYENEIKIGPVWTKKA--CPRPGFSSPDGELELPPDKFIEPSGWKFLGDWEKKPELSLMHDKDSGRKTFVEELYEQGARNFPGGEWGGAKIQWTDVGGDQTTSPQEKATPPGWVWASPQWVVDKNRAVDGEGWEYTVDLSYGVYSPVQKAYHLSRRRRWVRRRDLKHPESTKKQVRRKLLL------EGWEYAPVFTMKFHAKERKMDFVRRRRMMRKLIPEG---------GGKIDPKKSKLPPILRNKAKGITFFRTPSLSISKSVISCTPHKFQMWAYVYQARDLLAKDESGMNDPYVRVAFANQSQMTEVKQKTLCPTWDQTLIF-HVDLFDSLENIQRNPPTVVMELFDKDQVGKDDFLGRTEFKPYPRIHGNEGPACKLLWYPISHGDEDGGEILAACELFLVSFIFFQCTTKLETGLLNFHLQDDGVVNIPHPPTPRDAEGEILPVRDRIRPVLQKTVVEVLCWGVRNMKKYQLASIKSPSVQFEIGGEIIQSDILTDAKKFPNFGRPILPRKIINLPVEEMYTPPMNIRIHDNRTFGRKPTVAVHSIKSLTRFRCAAPT-------------PAGQIQVEGPAAPGQPAEGVVPEAES--------------HKFDWWSKYYASLNQTEDSKSEKVGDGTTGRTLSPELEKIEEFGGLEDMIASFSLYRGKAKKRDDDDEETQKVVGEFKGTFRIYPLPEAEGVDPDLPETVF----TNLPPNEPIDCVVRVYILSAIDLQPQDPGGLADPYVVVQLGKKKLDNKDQYKPNTLNPIFGKMFELDAVIPVHKDLKITLMDYDLLTRDDMIGETVIDLEQRLLTRYRAKCGIPKTYCDSGPNQWRDHKRPMELLREWCEETEKNFKFYKGTKDGTPDRIVVGYRVYQLDEFGAFRNPNEHLGAKHQRLALHVLNQLEFIPEHVETRGLRSPMQPNIEQGKVQLWVDIFPKNEGVLKPSVDITAREPTNYELRVIVWNTSGVIMDETSITGEQMSDIYVKGWLEGMGDDKEKTDVHYRSLDGDGNFNWRMVFNFLYLPIEKKMVIREKEHFWSLDAKEVRLAPRLNMQIWDNDTFSYDDFLGSCQLDLIKLPKPCQTAKRCGTSRDP--GKNGEYVDLFQQHSIQGWWACYQE--GIEEPTGKIEMTIEVLNSNEAAVKPAGKGRDEPNQNPHLDEPNRPATSFLWFTSPFKTLKYIIWRNYK 1828          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO36863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC0])

HSP 1 Score: 1158.67 bits (2996), Expect = 0.000e+0
Identity = 606/1217 (49.79%), Postives = 808/1217 (66.39%), Query Frame = 1
Query:  631 KRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAF-TNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENG---------FLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQ-KEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIG--------------DKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRC 4206
            ++  R   S KPQDFQ+R++++E RQL G NISPV +V   NQ +QTKVK STN P ++ +FFFNF++S  ELFDE ISFE+FNSRKLR++A+IG FK D+   YEEP H  + KW+LL+DP+D  +G KGYLK    +LGPGDEAP  S+    +  E  TNLL+P+GV LRPATF L+VY+AED+P MDS   +GIK+        KELVDPY++ SFAG + +T   Y +DHP++N+EL +  +FPSMC+RLKLQ+FDWDR++A+D IGT  + +SA+ S + E+G         FLP FGPCF+N YGS REYSDLPD+++ LNLG G+G AYRGRVL+EL T+L  T   S +    + EI++ V  +LRRRKY+L   F+ A+M+  SD  +EFEVS+GNYGNKLD +VP SSS T PTNAV+DG +YYFLPWGDTKPC  VE HWE+I  RL + N   R+ +RL  N++K+ ++L AN    E A  +IS  D LI  + KP+P+ D N     +LD  L+ VR  E   +  EA+K+R  AT V +A+ +++ F+ +L+ L+VEPQNSMPDVIIWML+G+KR  Y RIPA DV++    +  G  CG +QNI M  P   +   +    +PA +R+ IWLG EK ++ W   +  EG   V AETYEN+ ++LGKWT K   +SRP +S+  G + LPK+    P GW +DGD       SL +D+++    FLED+F CE R PGG+WGPAT+ +++ RGD     +EI   E WEW   W VD NR  DE+G+EY V+ ++GGY P EK YH+ R     R+   +     + +  +          E WEYAPMF +KFHA ERK+D+VRRRRWHRKM    P A                          ++T M APRM+I Y+K H+YQLRAY+FQAR+LLA+D +G SDPY+RVVF  +S  TE   +++CPTWDQTL+F EV I+G   +V+E+PP + +EL+D D +G+DEF+GRC   P+VKL         L W+ +++G    GE+LAAFE++L+                 DLPF PP  GN++ +P+GIRP+MQRTA+EVL WGVRNMKKFQL SV SPS EFE GG+V+ + +IKN  KNPNF  P  FFDV LPKEELY PPMNIK+RD+R+FGRKP+VG + LK+  ++RC
Sbjct:    3 EKDQRHKLSNKPQDFQVRVRIIEGRQLSGQNISPVARVTVANQTRQTKVKISTNKPFYDETFFFNFNMSPMELFDEIISFEVFNSRKLRANAMIGYFKCDIGFFYEEPGHAAIRKWVLLTDPDDKMAGVKGYLKVTVMVLGPGDEAPVKSAQDDNDDIE--TNLLQPSGVMLRPATFSLKVYRAEDIPQMDSGFIEGIKRVLRVGEEQKELVDPYLLFSFAGMKARTRIHYNSDHPEFNQELNVQFKFPSMCERLKLQMFDWDRLTADDCIGTAHLPMSAI-SGQGEDGESWVERNISFLPMFGPCFINVYGSTREYSDLPDEYDDLNLGNGEGVAYRGRVLVELETKLGVTPQ-SPTDDLQSHEIIS-VQPYLRRRKYKLFACFLEASMVSCSDGPVEFEVSIGNYGNKLDLSVPPSSSTTPPTNAVYDGCYYYFLPWGDTKPCVCVESHWEDIGFRLGTKNILTRMCERLEVNMDKVNLSLEANAQPAETATLLISLLDQLINDVRKPLPKIDNNTPGVNDLDLKLQEVRLMEKLSISEEAIKLRESATDVREALGEIEGFLQRLRDLTVEPQNSMPDVIIWMLSGTKRIAYYRIPAFDVLYEPYSEACGENCGQVQNIFMKYPGKKQQNIEDYPEVPAHVRMMIWLGLEKHQEDWTNRELTEGDFCVYAETYENEMNILGKWTAKG--LSRPNFSNTRGDVSLPKKAFIAPDGWRFDGDCLFHCCFSLSYDRDSGHKTFLEDVFQCESRLPGGSWGPATVPWTDVRGDAATAKDEIQCDEDWEWTSEWMVDLNRAVDEDGYEYTVESTIGGYGPVEKTYHLCR----RRRWVRSRKLIAELEIDEDDVYAEQLAKEGWEYAPMFTMKFHAKERKMDLVRRRRWHRKMVQEDPSAPA---------------------DLERETMMNAPRMFITYEKPHRYQLRAYLFQARDLLASDPDGVSDPYARVVFGTRSSVTETLARTLCPTWDQTLIFDEVNIYGSIEQVAENPPAVIIELYDKDPVGKDEFMGRCVVKPLVKLNGQGPPAPRLLWYDVERGDEYGGEILAAFELFLVSITKVQNASKRGNDEGTDLPFAPPMKGNLFLVPNGIRPVMQRTAIEVLCWGVRNMKKFQLASVSSPSIEFECGGHVVNSTIIKNTQKNPNFDQPLFFFDVYLPKEELYTPPMNIKVRDNRSFGRKPMVGLHALKSLQRFRC 1187          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO36866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC4])

HSP 1 Score: 1121.3 bits (2899), Expect = 0.000e+0
Identity = 572/1201 (47.63%), Postives = 782/1201 (65.11%), Query Frame = 1
Query:  676 QIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAE---------NGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKE-GKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLI------------GDK--DLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRC 4206
            Q+R++V++ RQ+ G NISPV KV   NQ +QTKVK STN P ++  FFFN+   A+  FD  ISFE+FNS+KLR++ALIGSF+ D+   +++  H    KW+LL+DPED   GAKGYLK    +LGPGDEAP     + +       NLL+PAGV +R + F L+VY+AED+P MDSS    +K+ F   +NKELVDPY++VSFAGK+ +T     +DHP++ EEL +  + PSMC+RLK+Q++DWDR +A+D IGT ++ +SA+     E         +GFLPTFGPC++NFYGS REYSDLPD+F+ LNLG G+G AYRGR+L+EL T L E N +S S   +++E + R+  FLRRRK++L   F+ ATM+   D++++FEVS+GNYGN+LD +V  SSS T   N VFDGS YYFLPW D+KPC  VE HWE+I+ RL + N   R  +RL KN++K+++AL+A +P  E A  VI+   DLI    +P+PE     +   +LD      RE+E   +  EA K+R+ AT + +A+ +++ +  +L+ ++VEPQN MPDV+IWML G+KR  Y RIPA++V++S +E  RG+ CG + ++ +  P   +   +    +P ++ + +WLG EK++  W       G+ +V AETYEN    LGKWTTK    +RP WS+  G  KL KE   PP GW WDGDWFI PE S  +D++     F+ED+F  E R PGGNW PAT  +++  G+     + +  PEGW+W   WTVD NR  DE+G+EY+VDPS+G Y P EK YH+SR     R+        KK+   +   +    + + WEYAP F L+FH  ER +D+V+RRRWHRKM    P     F +                         + PRM+IK++K  K+QLR Y+FQA +LLAAD +G +DPY+RVVF  QSQTT  +  ++CP WDQTL+F++V I+     V ESPPKI +ELFD DQ+G+DE++GRC A P VKL         L W+P+ KG  E GE+LAAFE++L             GD+  DLP+ PP   ++Y +P GIRP++QRTA+EVL WGVRNMKKFQL SV SPS EFE GG+V+ + +IKN  KNPNF  P  FFDV LPKEELY PPMNIK+RD+R+FGR+PIVG +C+ +   +RC
Sbjct:    1 QVRVRVIQGRQIAGANISPVVKVTVGNQARQTKVKKSTNRPYFDEMFFFNYQEIASTFFDNLISFEVFNSQKLRANALIGSFESDVGFFFDQQDHMVNRKWVLLTDPEDKMEGAKGYLKVTVIVLGPGDEAPINHDDEDDLE----NNLLQPAGVIMRTSIFALKVYRAEDIPQMDSSFADSVKKVFMGEANKELVDPYVLVSFAGKQSRTRCHEKSDHPEFKEELFVSFRLPSMCERLKIQMYDWDRFTADDCIGTAYLPLSAISGQTEEEVISSLCNCSGFLPTFGPCYVNFYGSTREYSDLPDEFDDLNLGIGEGVAYRGRLLVELETTLGE-NAMSPS-EDLDDEDIIRIQPFLRRRKFKLFACFLEATMVACPDSSVQFEVSIGNYGNRLDTSVEPSSSSTAACNPVFDGSFYYFLPWSDSKPCCSVESHWEDIAFRLEAFNMLTRTLERLQKNMDKVELALDAKMPAPELAALVIALLGDLIQDCRRPLPEVSSKTAGANDLDFKKYAQREKEKLAIAEEARKLRDNATDIEEAMNEIEGYQKRLELVAVEPQNCMPDVVIWMLNGNKRVAYHRIPAYEVLFSHSEQARGKHCGKVLSVFLKYPGKKQFDIEDHPEVPCKIDVALWLGLEKDQDAWTDRSNTGGEFIVFAETYENMTKFLGKWTTKC--AARPSWSNLEGNEKLLKESFIPPLGWRWDGDWFIDPEKSGGYDQDTGHMVFMEDLFENEARLPGGNWEPATTPWTDIHGNEAVDKDTVTCPEGWDWNQEWTVDMNRAVDEDGFEYSVDPSVGAYVPVEKTYHLSR----RRRWVRTRKVIKKKPSIEPKKEKDLLEGDGWEYAPAFSLRFHNKERTVDLVKRRRWHRKMLQEDPTEPAVFQMEG--------------------GNTSTPRMFIKFEKYQKFQLRVYLFQASDLLAADSDGLADPYARVVFQKQSQTTCTKYHTLCPMWDQTLIFEDVMIYRTQELVVESPPKIVIELFDKDQVGKDEYMGRCVATPEVKLHGQGPPAPRLLWYPVTKGDMEGGEILAAFELFLSIWGMRPCTKFLRGDEGADLPYYPPMNKDLYMVPSGIRPVVQRTAIEVLCWGVRNMKKFQLASVSSPSIEFECGGHVVNSTIIKNTQKNPNFDQPLFFFDVYLPKEELYTPPMNIKVRDNRSFGRRPIVGVHCINSLQPFRC 1169          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO47415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ1])

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 392/1043 (37.58%), Postives = 588/1043 (56.38%), Query Frame = 1
Query: 3388 PRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRS----VLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKL-------GNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTE-EHDRLDDFPAFDPNVD---LEINTFKKPKEPAAHKLPSLPD---------------IFKGKKKPTKVIVEE--------------------------DIDWWSKYYASLGQFDKCSKYLELMHD-----------------------------------TLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRI--YPLPED-RNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNK-------LPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLL-GERMSDIYVKAWINGI-EEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVP-ELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFA 6204
            P  ++ Y +  K+ LRA+++QAR+L+ +D +G SD ++RV+F +    T +  ++  PTWDQTL+F+EV + GD   ++ +PP I VE+FD D  G+ EF+GR  A P+VK+      +      L+WF + +G   AGEMLAAFE+  +      FLP ++       G I  +P GIRP+M++  +EVL WGVR MK+  L +V  P  + ++ G+V+++ +I N  KNPNF  P  +FDV LP+ E Y PP+ I++RD R FGR  +VGT+ L +   +R L   E E +R++   A    +D   L  N   +P  P   ++    D               +    + P  V+  +                           +DWWS+YY +L   +K                                             ++  +K ELE   D++GF+D+  +F L RG     +DD+++  VG+FKG+ ++  YPLPE    +P+   +L    LP+N+ V  ++R+Y++KA +L PSD +G ADPY+ + LGK R   +D YV   LNP FGR FE +A +P+   L V I D+DL+G DD+IGET +DLENR+ SR RATCGL   Y T G N+WRD   P+ IL + C +  +  P Y     +++ +KVF ++  +  E+S  +     E  AL  L +         LV EH+E R LF+  +PG+EQGK+EMWVD+ P+ +  PG P +I  RK   Y+LRV++ NT DV L+E N+L GE+ SDI++K W+ G+ ++KQ+TDVHYRSL GEGNFNWRF+FPF Y  +E  +V+ +K  F+S D++EE+    +  QVWD D FS DDF+G + +DL  +P  AK   +C L++L + G ++  V+ F  K + G+WP F N+     EL GK+E E++LLT+EEA  KPAG AR+DP     L+ PNRP  ++    +P +  K +IW N +  L+ +L+I LL  L+ LF Y++PG T +K+F 
Sbjct:  957 PPNHLIYTEKQKFVLRAHVYQARSLIGSDASGLSDAFARVIFTHLVSDTRVIWETRSPTWDQTLIFQEVVLWGDVNEIAVNPPTIVVEIFDKDIGGDSEFIGRALARPIVKMACEPYEKPFFPPALEWFQVCRGEENAGEMLAAFELLQVTSGTC-FLPSEVEPVNTPDGPITPVPVGIRPVMKKHRIEVLFWGVREMKRINLTTVDRPQVDIDLAGHVIQSTVITNAKKNPNFQNPVCYFDVELPENERYCPPLTIRVRDCRTFGRFTLVGTHVLNSL--HRYLQTGEKEKERIEK--AGKSCLDRKRLLANGPSRPTSPGGGEVALEMDDAPPIEMEQMELQARLITDTETPIAVVATDMHASTDHEKKKEKGDKDKKEDDDDEDSLDWWSRYYETLKDQEKGDSGTHTSGQGKKKPKKEEESEEEKRKKAIPRLNVSSGSRSDGFCSMKIFKLELECMHDFNGFNDWLHSFPLFRGKKTSEDDDDDHRIVGKFKGSLKVWKYPLPEHVEMDPIVGTFL---KLPSNEPVNVLVRVYVVKALNLHPSDVNGKADPYLVVNLGKHRVRDRDNYVSKQLNPTFGRCFEFEAIIPMDSMLTVGIYDWDLVGSDDLIGETKVDLENRFYSRHRATCGLQDQYATFGFNKWRDPLRPTQILAKLCKEEGLDGPHY-STGRVRVDNKVF-VAAPQILEESG-HWKQSDEPSALRCLKQFQTLKRGFTLVPEHVETRALFNPEKPGVEQGKLEMWVDMFPMDMPSPGAPVDITPRKPTSYELRVIIWNTEDVLLEEANMLTGEKCSDIFIKGWLEGLKDDKQQTDVHYRSLTGEGNFNWRFIFPFQYQKAEERIVITRKASFFSWDESEEKVPARLHLQVWDADAFSADDFIGDLCLDLTRMPRGAKTSKSCTLDLLKQDG-SVPQVSFFKMKHMKGFWPFFVNTEEEEIELAGKVEAELELLTQEEAEKKPAGRAREDPQA---LEKPNRPDVAWMMMMNPLRGLKAMIWNNYRMCLIKMLVIALLLALMGLFFYSMPGYTVKKIFG 1984          

HSP 2 Score: 338.961 bits (868), Expect = 9.323e-94
Identity = 237/705 (33.62%), Postives = 375/705 (53.19%), Query Frame = 1
Query:  628 GKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSD-ALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPED--GNSGA--KGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQL-RP-ATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFL--RRRKYRLHVAFMSATML--RISDTTIEFEVSMGNYGNKLD----DTVPASS------------------------------SCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADR----LTKNIEKIKVALNANIPEEEQAQFVISAFDDLI------ISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEA---TSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQ 2568
            G + +  S  +    + I+I++ EARQL G  I PVC V   NQ K T +K  TN P ++  F F+F +    LFD+ + F+ +  R L S  ALIGSFK D+  +Y +P H +  +W +L+DPE+  G SGA  KGY +    +LG GD A      K  + D    NLL P GV   RP A  ++++Y+AE LP M+S     +K+AFT    ++LV+PY+ V FAG   +T+ K     P WNE++     FP +C R+K+QL D D V+ ++ IGTHFID+S + S    NGF+PTFGPC+ N YGS R+YS L D+   LN G G+G A+RGR+L+ +  +  E+   S  +  +  E    +S     +  +++L   F  A+M+  ++ D  + FE+S+GN+GN +D    D V  ++                              S T P   V +   YY +PW D+KPC+ ++  W++   RL++ N  L+I +R    LT  IE++K+ L          +++     +LI      ++L K +P    +   +T+LDK    + + E++ + T A +++      T +   +   +A + +L +++VEPQ+++PDV IWML G KR  Y RIP+  +++S  E+ RG+  G +Q + + +P        K   I A+L + IWLG  K ++
Sbjct:  245 GSQISVHSDRSMSMKWYIQIRIHEARQLAGTQIDPVCTVSVGNQKKSTTIKEQTNCPFYDEFFVFDFKMPPMVLFDKIVMFQFYTGRNLVSQGALIGSFKLDVGTVYAQPDHRFCRRWAVLTDPEETLGASGAGVKGYARVDITVLGKGDPAKEQPGIKDNDDDIE-GNLLLPDGVPAERPKARVIIKIYRAEGLPKMNSGLMANVKKAFTGEV-RDLVNPYVEVQFAGHRARTTVKKNTYEPKWNEQVVFSELFPPLCRRIKIQLKDSDSVT-DEVIGTHFIDLSRI-SNDGANGFMPTFGPCWANLYGSTRDYS-LFDEHNDLNNGLGEGVAFRGRLLIAVHAEFGESASESG-IRQVEVEPTAPISDTAAGKDEQFQLFACFYEASMIDRKVGDKMVSFEMSIGNWGNSIDGQPIDEVSHATHIQHTSNTQHTQSTMGGDEDRRDGDNPFLYSLTPPVKPVTNDRQYYHIPWEDSKPCTHIKFMWQDHRRRLYNSNVLLKICERLEDGLTDCIERVKMDLPNTF------RWLSRVLSELINGCNQYLNLIKSMPT--ASHVGRTKLDKERLKLCQYEVESVCTSAQELKTSTKDDTHMKDNLKAANALLQRLLNIAVEPQDTIPDVFIWMLCGGKRVAYSRIPSQHIMYSLVEEERGKDSGRMQTVFLRLPGK-RGDGPKGWAIQAKLNIMIWLGLHKHKK 934          
BLAST of Fer-1-related vs. Ensembl Nematostella
Match: EDO36865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC3])

HSP 1 Score: 407.912 bits (1047), Expect = 5.605e-129
Identity = 187/321 (58.26%), Postives = 241/321 (75.08%), Query Frame = 1
Query: 4861 IFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEF 5823
            +FEM A +P++KDL + ++DYDL+ +DD+IGET +DLENR+L+R+RA CGLPQTY TSGINQWRD Q P  IL  FC     G P+YL N  L + ++V+ L +FEE    +P+LG  ++RLALHVLN +P+V EH+E R L+++LQP IEQGK++MWVDI P  LG PG PFNI  RK  +Y+LRV++ NT DV L+ET++ GE+MSDIYVK W+ G ++ Q+TDVHYRSLDGEGNFNWRF+FPF Y+P+E  MVV KK HFWSLD+TEER    +  Q+WDND+FSPDDFLG +E+ L  +P PAK    C L  LP  
Sbjct:    1 MFEMNATIPIIKDLKISLMDYDLVSRDDLIGETVVDLENRFLTRYRACCGLPQTYCTSGINQWRDSQTPRQILDLFCESQGKGRPQYLGNMKLVLDNRVYTLQEFEEGMIHHPHLGAPEQRLALHVLNSMPVVPEHVETRSLYNSLQPNIEQGKLQMWVDIFPKHLGTPGAPFNISPRKPAEYELRVIIWNTSDVILEETSITGEKMSDIYVKGWLAGADDPQKTDVHYRSLDGEGNFNWRFIFPFMYLPAEKIMVVKKKVHFWSLDETEERVPLRLIIQIWDNDQFSPDDFLGQLELTLNRMPKPAKSARKCNLGQLPHL 321          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: myofl (myoferlin [Source:NCBI gene;Acc:101156429])

HSP 1 Score: 1133.63 bits (2931), Expect = 0.000e+0
Identity = 764/2019 (37.84%), Postives = 1089/2019 (53.94%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLN--LLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSM--RAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKM-KSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAG-EMLAAFEIYLIGDKDLPFLPPKLG-NIYTIPDGIRPMMQRTAVE-VLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFK-GTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLEND--CLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEF----VNLFDCKRIMGYWPVFDNSTGVPELT-GKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFI 6087
            M   ++     I  + +G  DP   + F+ +KKKTK +   LNP W+E L FDL G+ L  +  + V V D E  G    +GS  + L DLAGG      + N  L+++ ++     ++L + Y                                 ++  NA+        Q  +    KR   K  +++ QDFQIR++V+E R L G +I PV +V    +  +T V+   N+P ++  FF+N ++S ++L DE                                 H  M KWLLL DP+D   GA+GYLK    I+G GDEAP  +   + E D++E+NLL PAGV +R AT  L+VY+AED+P  D +  Q +KQ      +K+ LVDPY+ VSFAGK++ T     N +P+WN+ + + ++                    +D IGT F+++S +       E GFLP FGPCF+N YGSPREY DLPD+FE LN G G+G AYRGRVL+EL+T L++  + +    P ++ +   V++F RRR+Y L   F SA ML+     I FEV++GNYGNKLD T     S T    AVFD +HYY+LPW DTKP  ++  +WE+IS RL +IN  L  AD+L  N+  +K A++A  PE    +  +   D +I  L  P  E   ++   T LD   K +RE  +  ++  A  ++ EA  +   + D++ ++ ++K L+ EPQNSMPDVIIWM  G KR  Y R+PA+ +++S  ++   G+ CG +Q I M  P+      +K + IPA+LR  +WLG    E+ +     EG   +  E YENQA LLGKW T   L++   +SD +GKIKL +E   PP GWEW+G        SL  + +A  ++F +++F  E+RFPGG W PA   Y++  G+    P E   P GW W   W+ D NR  DE  WEY V    +     +  AEK +H+         R+    +P+++   KK      +  E WEY+ +F  KFH  ER  D  RRRRW R M  S   G S  F L           KT+      K      P +   +   + Y LR YI+Q RNL   D N FS PY+ V F + S+TT +   ++ P WDQTL+F+++EIHGDP  V+  PP++ +EL+D DQ+G+DE +G C+  P++ LQ N   R  LQW PI K    AG  +LAA  +  + D DLP +PP+    +Y +P GI+P++Q TA+E VLTWG+RNM+ FQL  V SPS   E GG  ++T +IKN  KNPNF    +    LLPKEE+Y PP+ +K+ DH+ FG KP+VG   +++  ++RC               +  N D+ +++     +   +       +   + +      +E +DWWSK+Y+SLG+  KC+ YL   +DTL  Y  ELE  E + G  DFC T  L +G   + ++D     VG+FK G+F+IYPL +D + P P        LP +   EC++RIY+++  ++Q  D +G  DPYIKI LGK+    +D Y PNTL+PEFG +FE+   LP  KDL + + D+D   +D+ +GET IDLE+R LS FR  CGLPQT Y SG+NQWRD   PS ILQ   AK R   P  +E D   L    K ++L  F      + +LGP+KERL+LHVL  L LV EH+E R L S+ +  + QG+++MWVDI P  LG PGPP  I  RKA KY LRV++ NT DV LD+ ++  E+ SDIYV                                              K+E FW+ DKTE R    +  Q+WDND+ S DD+L ++E+DL  L  PAK    C L++LP     +       +LF  K + G+WP  +   G   LT GK+E+ ++++ E+EA  +PAG  R++PN NP LDPP RPATSF WFT+     KF+
Sbjct:    1 MLRVIVECAKGIPKKKLGNPDPITTVVFR-EKKKTKAVNSELNPVWNEILEFDLDGSPLDASSFIDVVVKDYETFG-KHFIGSSKILLGDLAGGHVASLPSKNVPLINEKQQIIGATISLLIVY---------------------------------EKPSNAD-------DQKPLCLTRKRN--KPLASEAQDFQIRVRVIEGRHLPGIDIKPVVRVLFDGKTHRTNVR-GGNNPFFDEMFFYNVNMSLSDLSDE---------------------------------HAIMRKWLLLKDPDDSTMGARGYLKVSIIIMGTGDEAPIENRLFRAEQDDLESNLLVPAGVSMRTATLSLKVYRAEDMP-QDDATVQTLKQFLGGEGDKKNLVDPYLEVSFAGKKVCTKIIQKNANPEWNQLISLNVK--------------------DDVIGTTFLNLSQISHSGGNVEVGFLPAFGPCFVNLYGSPREYGDLPDRFEELNFGNGEGVAYRGRVLVELSTHLDKKVEKNVDDIPRDDVL---VAQFQRRRRYSLCSVFHSACMLQEPGGPIRFEVTLGNYGNKLDSTCKPLVSTTPNCFAVFD-NHYYYLPWADTKPVVILTSYWEDISHRLDAINILLFTADQLESNLNLLKTAISAKEPESRLTEIWLKLLDHIIEELVLPALE---DRLNVTVLDLQKKNLREAAVYNIMQMACCMKEEARDIGSTVADIEDWLDRIKQLAEEPQNSMPDVIIWMFRGEKRVAYARVPANQILYSSFSKQACGKHCGKIQTIFMQYPM----DKNKGVKIPAELRFNMWLGLSVHEKEFSRFS-EGNFSICVEMYENQA-LLGKWGTAG-LINCHKFSDVTGKIKLKQELFLPPQGWEWEG--------SLLAEADAGCSKFTDEVFQNEIRFPGGEWKPAAELYTDLNGEKVASPKEFECPPGWTWEDDWSFDSNRAVDER-WEYGVTLPPNEKPSSWVAAEKTFHV--------HRRRRLIRPRRKLSGKKTVAKRRDSEEGWEYSSLFGSKFHIKERCSDTFRRRRWRRNMIPSHCSGCSAIFKLEG------VLSKTE----EDKLFGAKTPTVSCHFSS-YIYHLRVYIYQGRNLCPMDHNSFS-PYAHVSFLHMSKTTHVIQNTLNPIWDQTLIFEDIEIHGDPQTVASCPPEVVLELYDSDQVGKDEPMGHCKYPPLINLQPNIGCRPKLQWLPITKKGHNAGELLLAAELLLKLDDDDLPIVPPRRSEKLYMVPQGIKPVVQLTAIEQVLTWGLRNMEAFQLSPVSSPSLIVECGGETVKTAIIKNFKKNPNFPGS-VLLLKLLPKEEMYAPPIVLKVIDHKPFGWKPVVGQCTIRSLGEFRC-------------DPYRTNSDICMSSRAMMADAQENV------VIDVESRAISETRDEAVDWWSKFYSSLGEQQKCNPYLRKGYDTLKVYNCELEKVEQFQGLTDFCRTINLHQGKTVDDDEDPSV--VGQFKQGSFKIYPLSDDPSVPAPPCQF--KELPESGPQECLVRIYVVRCIEVQSKDSNGKCDPYIKITLGKKTLDDRDNYKPNTLSPEFG-MFELSCTLPQDKDLKIAVYDFDKWSRDEEVGETVIDLEDRLLSYFRPCCGLPQT-YCSGVNQWRDQLKPSQILQNV-AKMRGVPPPSIEEDGRSLLFSGKRYHLQDFANIL-IHSHLGPEKERLSLHVLRNLGLVPEHVETRTLSSSYKSNLSQGRIQMWVDIFPKRLGLPGPPCEISPRKA-KYFLRVIIWNTSDVILDDASITAEKTSDIYV----------------------------------------------KQEQFWNWDKTEYRNPPKLIVQIWDNDRISLDDYL-SVELDLLRLVPPAKTPEKCTLKMLPGMKGTVASKAKPTSLFSRKSVRGWWPCANAQNGSCVLTQGKVEMTLEIVDEKEAEERPAGRGRNEPNMNPKLDPP-RPATSFAWFTNVSSILKFM 1800          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: myof (myoferlin [Source:NCBI gene;Acc:101172285])

HSP 1 Score: 1123.23 bits (2904), Expect = 0.000e+0
Identity = 670/1604 (41.77%), Postives = 947/1604 (59.04%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLN--LLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGS-GPQIKIKK---VGKRTTR----KSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKE-LVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGS---------MRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSK-PIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSD-NEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLG----GYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMK-STKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYL---IGDKDLPFLPP-KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRC--LALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRN-EPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKER 4806
            + V V +A  L   +L G  DP   + ++  KKKTK I   LNP W+E L FDL G+ L  +  L V V D E IG +  +GS  +PLRDLA G+     + N  LL +N +      N+ V +                          ++ G E D     ++G SGS G    IK+   V +R TR       +TKPQDFQIR++VVEARQL G NI PV KV    Q  +T++K S N+P ++  FF+N H+  ++LF+++ISF ++NS  LR+D+L+G FK D+  +Y+EP H  M KWLLL+DP+D +SGAKGYLK    ++G GDE         ++ D+IE+NLL PAG+ LR AT  L+V++AED+P MD +  Q IK+ F    NK+ LVDP++   FAGK+L T     N +P+WN+ L + ++FPSMC+R+KL +FDWDR++ NDA+GT ++D++ + S         + +E GFLP FGPC++N YGSPRE++ LPD ++ LN GKG+G AYRGR+L+EL+T+L+E     A  T  N  I       + RRKY L   F SA+M++     I+FEVS+GNYGNKLD T    +S TQ + AVFDG+ YY+LPW +TKP  V+   WE+IS RL ++N  L I  RL  N+E  KVA+ A +P+ + A+  +   D LI  L + P PE +   S  T LD  LK  R+  L  +    +++R EA+ +   ++D++ +V +LK L+ EPQNSMPDV+IWML G KR  Y RIPAH++++S  +E   G+ CG  Q + +  P+       K L +P Q+R+ +WLG   +E+ ++    EG   V AE YENQA + G W T   L+ R  +SD +GK+KL +E   PP GWEW+ DWFI PE +L  + +A  TEF++++F  E RFPGG W  A+ QY++  G+    P+E   P GW W  +WTVD NR  D++GWEY V    G     + PAEK+YH+ RRRR VR RK  A+  ++ K             E WE++ +   KFH  ER  D  RRRRW RKM    + GAS  F L        + ++    + + K      P +   +D+ + Y LR Y++QARNL++ D++ FSDPY+ V F + S+TTE    ++ PTWDQTL+F  VEI+GDP +++  PP + +E +D DQ+G+DE LGR    P+VKL     +   L W PI +  + AGE+L A E+ L    GD DLP LPP +  N+Y +P GIRP++Q TAVE+L WG+RNMK +QL SV SPS   E GG  +ET +IKN+ K+PNF    LF  VLLPK+E+Y PP+ +K+ DHR FGRKP+VG   + + + +RC    +  E  R                    P +  A  +     + + ++K       E +DWWSK+YAS G+ DKC  YL+  +DTL  Y  ELE   ++ G  DFC+TF L RG ND  ++D     VGEFKG F++YPLP+D    P P  + +   LP +   EC++RIYI++  DLQP D +G     ++IQL K++
Sbjct:    2 LRVVVESAKGLPKKKL-GSPDPIATVIYKDDKKKTKRIDNELNPVWNEVLEFDLKGSPLDSSSFLEVVVKDYETIGRNIHIGSAKIPLRDLAAGQVRSLPSKNVPLLGENGQ------NIGVGFI---------------------FSACEAGGDENDGETATDLGQSGSAGVPSSIKQSANVRQRLTRGQSRHRLATKPQDFQIRVRVVEARQLPGNNIKPVVKVHVCGQTHRTRIK-SGNNPFFDEMFFYNVHMLPSDLFEQSISFRVYNSYSLRADSLMGEFKLDVGYVYDEPAHCVMRKWLLLNDPDDSSSGAKGYLKVSLFVIGTGDEPLVEKRDCDDDQDDIESNLLLPAGMTLRWATLSLKVFRAEDIPQMDDAFVQSIKEIFGAEENKKNLVDPFLEARFAGKKLCTQIIEKNANPEWNQVLHLQVKFPSMCERVKLTVFDWDRLTGNDAVGTTYLDLAKIASSGGEIEGNPVESEVGFLPVFGPCYINLYGSPREFTGLPDPYDDLNFGKGEGVAYRGRILVELSTKLDE----KAEKTIDNIHIKRTSIISILRRKYCLCAVFHSASMIQEPGEPIQFEVSIGNYGNKLDTTCKPLASTTQYSCAVFDGNQYYYLPWANTKPVVVLTSFWEDISHRLNAVNIILCITHRLQSNLEAFKVAILAKVPDNKLAEVWLQLLDQLIEDLERFPTPELE-GCSNLTSLDIQLKKRRDITLNSIKEAVLRMRQEASEIRDTLSDIETWVDKLKQLAEEPQNSMPDVVIWMLRGEKRVAYSRIPAHEILFSTYSEQACGKNCGKTQTVFLKYPM----DKAKGLKVPVQIRVSMWLGLSADEKKFNSYS-EGTFSVFAELYENQAKVFGNWGTTG-LVGRHKFSDVTGKLKLKQEYFIPPRGWEWESDWFIDPEKALLTEADAGHTEFMDEVFQNETRFPGGEWKAASEQYTDVNGEKSRNPSEFDCPPGWIWEDSWTVDINRAVDDQGWEYGVTIPPGDKPLSWVPAEKVYHVHRRRRLVRPRKRDASSSRRNKGDP----------EGWEFSSLIGWKFHRKERSSDTFRRRRWRRKMAPEDRLGASAIFQLEGALGVDTEEKEKTSKANATKMFGANTPTVSCTFDRSYMYHLRVYVYQARNLMSMDKDSFSDPYAHVSFLHVSKTTEKLKATLNPTWDQTLIFNSVEIYGDPQKIAHRPPDVVLEFYDEDQVGKDEMLGRSICTPLVKLSPEMDQSPRLFWHPIIQKGQRAGEVLVAAELILKDKSGDSDLPLLPPMRAENLYMVPQGIRPVVQLTAVEILAWGLRNMKPYQLASVSSPSLVVECGGQRVETAIIKNMKKSPNFPGNILFIKVLLPKDEMYTPPIVLKVIDHRPFGRKPVVGQCTIASLEDFRCDPYVIVSEGARSSKMALM----------MASPHKDVAITMEESSPLLEAQEK-------ETVDWWSKFYASTGEQDKCGPYLKKGYDTLKVYDNELENVPEFKGLTDFCNTFKLQRGKNDNGDEDPTV--VGEFKGAFKVYPLPDDPGIAPPPRQFRE---LPESGPQECLVRIYIVRGIDLQPKDNNG----RVRIQLPKKQ 1529          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 559/1400 (39.93%), Postives = 775/1400 (55.36%), Query Frame = 1
Query:  673 FQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSN-KELVDPYMVVSFAGKELKTSTKYTNDHPDWNE----ELKIPLQFPSMCDRLKLQL-FDWDRVSANDAIGTHFIDISAVGSMRAEN------GFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRN-EATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQA--SLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGT-WTVDFNRPCDEEGWEYAV----DPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKST-KPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFE-IYLIGDKDLPFLPPKLG-NIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKE 4803
            FQ+R++V+EARQL G NI PV KV    Q K+T+++   N+P ++ +FF NF  + +ELFDE I   + ++        +GS         + P H ++ KWLLLSDP+D +SG KGYLK    +L  GDE P     +  E      NLLRPAG+ LR A F +R+++AEDLP MD +   G++Q     SN K LVDP +       EL   T  TND+    E    E        +    L   L +  DR S ND IGT  + +S + +   E       GFLPTFGPCF+N YGSPRE++   D  EALNLGKG+G AYRGRVL+ELTT+L E  +      P ++  L  V KFLR+RK+ L VAF SAT+L+  D  I+FEVS+GNYGNK D +    +S TQ + AVFDG HYY+LPWG+ KP  V+   WE+I  R+ ++N    I DRL        V +  ++  +  + +++                        T LD+ ++ +R   LKQ+   A+  ++   T +S  +   + +  +L++++ EPQNS+PD++IWML G +R  Y RIPAH V +S  + + G+ CG LQ+I +  P            +P QLR+K+W G   +  +++    EGKL V AETYENQ   +L+G W +    ++ P +SD SG++KLPKE   P  GW W GDWFISPE +L FD +A    + E++F  +MR PGG W      Y++  G+     +++  P GW W    W+ D NR  D++GWEY V    D     + PAEKMYH +RRRR+VR            + +           E WEYA +F  KFH   RK D  RRRRW R+M+   K G +  F L         G                      ++    +Y LR +++QAR+L A D++ FSDPY+ V F +QSQ T     ++ P WDQTL+F EVEI GD    + +PP + VEL+D D  G DEF+GRC   P +           L W+PI++G + AGE+LAAF+ I    + DLP+LPP+   +++ +P GI+P++QRTA+E+L WG+RN+K +Q+ SV SPS + E GG ++++ +I NV K PNF    L  DV LP+EELYMPP+ IK+ D+R FGRKP+VG   ++  + YR   L                VDL         E A+H L    D  +G         EE +DWWSK+YAS+G  +KC  YLE   DTL  Y +ELE  E++DG  DFC TF L RG   +  DD     VGEFKG F+IYPL +D   P P        LP N I +C++R+YII+A  LQP DP+G  DPY+KI LGK+
Sbjct:   38 FQVRVRVIEARQLPGINIKPVVKVGVAGQTKRTRIRKG-NNPVFDETFFMNFFETPSELFDEPIFITVSST--------LGS--------KDIPGHCFLRKWLLLSDPDDLSSGVKGYLKVSLFVLAAGDEPPCVEEKEDIE-----GNLLRPAGLSLRGAVFTVRIFRAEDLPQMDDAIMDGMRQILGFDSNRKNLVDPMV-------ELHFQTLMTNDNRSIEEFGSFECFSWFGIKNNTTFLAFPLSYIRDRASHNDVIGTAHLCMSKISAPGGEIDVDDSLGFLPTFGPCFVNMYGSPREFTTFHDPHEALNLGKGEGVAYRGRVLVELTTKLLEKPEHRTQDIPTDD--LLVVEKFLRKRKFSLFVAFYSATLLQDVDDAIQFEVSIGNYGNKFDYSCLPLASTTQFSRAVFDGCHYYYLPWGNIKPVVVLSSEWEDIRPRIEALNMLHAIIDRL--------VGMLLHLLHDSSSTWLVPCV---------------------TPLDRSIRHIRTLHLKQIAAAALAFKHGPETELSTMLEHAEDWANRLRTIAEEPQNSLPDIVIWMLQGDRRVAYHRIPAHSVFFS--KQHCGKHCGQLQSIFLKHP----QGSGGAAKLPGQLRVKVWFGLAADAPHFNQC-TEGKLSVFAETYENQTRLALVGSWGSTG--LTYPKFSDISGRVKLPKESFKPSPGWTWAGDWFISPERTLLFDVDAGHMTYTEEVFETQMRLPGGQWIGMQEGYTDVNGEKTLSKDDVECPPGWVWEEVEWSEDLNRAVDDQGWEYGVTIPPDRRPKSWVPAEKMYHTNRRRRWVRM-----------RRRDLQKMEALRKKEGWEYASLFGWKFHLKPRKTDSFRRRRWRRRMEPLEKTGPAAIFALECSLVRIGWGGVR-------------------RFFGGSRYHLRCHMYQARDLPAMDKDSFSDPYAIVSFLHQSQKTVTICNTLNPIWDQTLIFYEVEIFGDNEATATTPPSVVVELYDQDTYGADEFMGRCVCRPSLSPSPR------LAWYPIQRGDKSAGELLAAFQLIRREKESDLPYLPPQREPDVFMVPQGIKPVLQRTAIEILAWGLRNLKSYQMASVKSPSLQVECGGIMIQSCVIHNVKKKPNFDINTLILDVRLPQEELYMPPIVIKVIDNRQFGRKPVVGQCSIRLLEDYRVSRLL---------------VDLM-------HETASH-LKQFHD--RG---------EESVDWWSKFYASVGDKNKCGTYLEQGLDTLEVYDRELERVEEFDGLSDFCQTFKLYRGKTQDEGDDPSV--VGEFKGMFKIYPLSDDPAAPAPPRQF--KKLPPNGIEDCLVRVYIIQANGLQPKDPNGKCDPYVKISLGKK 1294          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: otofa (otoferlin [Source:NCBI gene;Acc:101155482])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 380/988 (38.46%), Postives = 559/988 (56.58%), Query Frame = 1
Query: 3388 PRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRS----VLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPP-------KLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIV----------------EEDIDWWSKYYASLGQFD------------KCSKY--------------------------LELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXS--VGEFKGTFRIYPLPEDRNEPMPVIYLDSA----NLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLN---KLP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKL-DETNLLGERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWP-VFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMK 6105
            P + + Y     +QLRA+++QAR+L AAD +G SDP++RV F   SQ TE+ ++++CPTWDQ LVF +VE+ G+   + E PP I VE++D D +G+ EF+GR  A P +K+             L++F I +G+  AGE+LAAFE+  IG      LPP       + G I  +P GIRP++ R  +EVL WG+R++K+  L  V  P  + E  G  +++ +I+N  KNPNFST   +F+V LP+ EL  PP+NI++ D RAFGR  +VGT+ + +  ++    +    D+  +  A   +V + ++T     EP   K+ ++  +   K+   +                   E  +DWWSKY+AS+                K SK                           L+   D L+ + KELE   ++  F+D+  TF L RG   + ++   +D   VG FKG+  +Y LP          Y  +     ++P ND +  ++RIY+++A DL P+D +G ADPYI I+LGK     K+ Y+   LNP FG+ F+++A  P+   L V + D+DL+G DD+IGET IDLENR+ S+FRATCG+  +Y   G N WRD   P+ IL   C + +I  P Y     +K+ +++F  +   E ED N      +E LAL VLN   ++P     LV EH+E RPL +  +PGIEQG++EMWVD+ P  +  PGP  +I  RK K+Y+LRV++ NT +V L D+    GE+ SDI+V+ W+ G +E KQ+TDVHY SL GEGNFNWRFVFPF+Y+ +E  +V++KKE  +S D+TE +    +T QVWD D FS DDFLG IE+DL   P  AK    C L+++      +  +++F  KR+ G+WP V  +     ELTGK+E E+ L+T EEA   P G  R++P+    L+ PNRP TS  WF  P K+ ++ IW N +
Sbjct:  953 PPLSLVYSMKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDDVELFGEASELREDPPIIVVEIYDQDTVGKAEFIGRTFAKPTIKMCDEHYGPPRFPPQLEYFQIYRGNCTAGELLAAFELLQIGQGGKADLPPIEGSTDSERGPILPVPLGIRPVLSRYRIEVLFWGLRDLKRINLAQVDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGTHAVSSLRRF----IYSPPDKTSNNWASAGDVIVNLDT-----EPQIRKMDTVVKLDAVKESDKEKKKKKKKKKGGLDEEEETDERVLDWWSKYFASIETLKEVIYVKPNDLLLKGSKIKEKSREKKGVKDKKKGQPPESSEKQPLKAKVDELVVFNKELE--SEFGNFEDWLHTFNLYRGKAGDDDEHALDDDRIVGRFKGSLCMYKLPLSEEITREAGYDPNMGMFQSIPHNDPINVLVRIYVVRATDLHPADINGKADPYIVIRLGKTEVKDKENYISKQLNPVFGKSFDIEATFPMESMLTVSVYDWDLVGTDDLIGETKIDLENRFYSKFRATCGISSSYSVHGYNIWRDPMKPTQILTRLCKEGKIDGPHYGPGGKVKVANRIF--TGPTEIEDENGLKKQTEEHLALTVLNHWEEIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPSDMPAPGPALDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFEYLVAEEKIVISKKESMFSWDETEYKIPPRLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSLDMIRN-EHELPTISIFKQKRVKGWWPFVARDENDEMELTGKVEAELHLVTAEEAEKSPVGLGRNEPDP---LEKPNRPDTSLMWFLGPLKSIRYFIWHNYR 1923          

HSP 2 Score: 353.599 bits (906), Expect = 6.234e-98
Identity = 232/717 (32.36%), Postives = 391/717 (54.53%), Query Frame = 1
Query:  583 IGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETND---VSAS------VTPINEEILTRVSKFLRRRKYRLHVAFMSATML--RISDTTIEFEVSMGNYGNKLDDTVP-----------------------------------ASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIK--VALNANIPEEEQAQFVISAFDDLIISLSK--PIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEA--TSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQ 2568
            + N  S P IK++           S +P D+QI I VVEARQL G N+ PV  V+  +  K T +K STN P +N  F F+FH+    LFD+ I   + +S+ L RS  L+G+FK D+  +Y +P+H + +KW +LSDP+D  +G KGY+K   A++G GD   +   + + + D+IE NLL P G+  + + A F +++Y+AE LP M+++    +K+AF    N++LVDPY+ V FAG++ KTS + ++  P WNE++     FP +C R+K+Q+ D D+V+ + AIGTHFID+  + S   + GFLPT GP ++N YGS R+Y+ L D+ + LN G G+G ++R R+L+ +  ++ +T     +S+S      V+ I+E    ++ +F       L  +F+ ATM+  +I D  I FE+++GNYGN++D                                        S S T     V    +Y+ LP+ + KPC  ++  W++   RL++ N   +IAD+L + +  ++  +      PE      +    ++L +  S+   +   D N + +T+LD+       +EL  M  +A ++R +    +V   +    +F+ +L+ L+ EPQ+S+PDV IWM++ +KR  Y RIP+ D+++S  E+  G+ CG ++   + +P   +        + A+L L +WLG  ++ +
Sbjct:  235 VSNKRSKPDIKME---------PGSGRPVDYQISITVVEARQLIGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVLFDKIIKLSVIHSKNLLRSGTLVGTFKMDVGTVYFQPEHQFYHKWAILSDPDDITAGCKGYVKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGIPAERQWARFYVKIYRAEGLPKMNTTIMANVKKAFI-GENRDLVDPYVQVQFAGQKGKTSVQKSSYEPIWNEQIVFTELFPPLCKRIKVQIRDSDKVN-DVAIGTHFIDLRKI-SNDGDKGFLPTLGPAWVNMYGSTRQYT-LMDEHQDLNEGIGEGVSFRARLLVSVAVEILDTTSPEIISSSDVQVEGVSNISESATGKMEEFF------LFGSFLEATMVDRKIGDKPITFEITIGNYGNQIDGVSKSPAAKKKKKDGENEEDENELILNSSEDEAEEEGDLVSVSTTPLMKPVITDRNYFHLPYFEKKPCVYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAFPERR----LRGVLEELSVGCSRFVALANKDVNLAGRTKLDRERLKSCMRELDSMGQQAKQLRTQVKKNTVKDRLKLAQSFLQRLRFLADEPQHSIPDVFIWMMSNNKRIAYARIPSKDILYSTVEEETGKDCGKVKAAFLKLPGK-KSFGPAGWTVQAKLELYLWLGVNRQRK 927          
BLAST of Fer-1-related vs. Ensembl Medaka
Match: otofb (otoferlin-like [Source:NCBI gene;Acc:101160130])

HSP 1 Score: 565.459 bits (1456), Expect = 1.257e-169
Identity = 360/906 (39.74%), Postives = 520/906 (57.40%), Query Frame = 1
Query: 3424 YQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTR----RSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPP-------KLGNIYTIPDGIRPMMQRTAVE-VLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEED---------------IDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXS---VGEFKGTFRIYPLPEDRNEPMPVIYLDS-----ANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKK-ERLALHVLN---KLP-----LVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLL-GERMSDIYVKAWINGIEE-KQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWP-VFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDP 6000
            +QLR +++QAR+L AAD  G SDP++RV F  QSQ TE+  +++CPTWDQ LVF+ VE+ G+ V + + PP I +E++D D +G+ +F+GR  A P+VK+             L+++ I +G+  AGEMLAAFE+  IG      LPP         G I  +P GIRP++ +  +E VL WG+R++K+  L  V  P  + E  G  +++ +I N  KNPNFST   +F+V LP+ EL  PP+NI++ D RAFGR  +VG+  + +  ++          R  D PA   +   EI      +EP   K+ ++  +     K  K   ++                +DWWSKY+AS+    +              Y KELE   ++D F+D+  TF L RG   + +D    D    VG+FKG+  +Y + +D    M     DS      N+P ND V  ++RIY+++A DL P+D +G ADPYI I+LGK     K+ Y+   LNP FG  F+++A  P+   L V I D+DL+G DD+IGET IDLENR+ S+ RATCG+       G N WRD   P+ IL + C   ++  P Y     +K+ ++VF       TE  + NL  K  E LAL VL    ++P     LV EH+E RPL    +PGIEQG++E+WVD+ P  +  PGP  +I  RK  K++LRV++ NT +V L++ ++  GE+ SDI+V+ W+ G +E KQ+TDVHY S+ GEGNFNWRFV+PFDY+ +E  +V++KKE  ++ D+TE +    +  QVWD D FS DDFL  IE+DL   P  AK    C +E++    + +  V++F  KRI G+WP V  N     ELTGK+E E+ LLT EEA   PAG  R++P
Sbjct:  758 FQLRVHMYQARSLFAADSTGLSDPFARVFFSTQSQVTEVLAETLCPTWDQLLVFENVELFGEAVELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMADEHYGPPRFPPQLEYYQIYRGNCAAGEMLAAFELLQIGPNGKADLPPIDGPTDMDRGPILPVPLGIRPVLSKYRIEQVLFWGLRDLKRVNLAQVDRPRVDIECAGKGVQSALIPNFKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSNAVSSLRKFIY--------RGQDNPANSWST-TEIIVVSMEQEPTCKKMETVVKLDSDDDKDEKGKKKKRKKVDEPEEEELDESMLDWWSKYFASIETLTEV-------------YPKELE--SEFDNFEDWLHTFYLFRGKAGDDDDQTVADEDRIVGKFKGSMCMYKVSDDAPRDMS---FDSNMGMFQNIPNNDPVNVLVRIYVVRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPLFGS-FDVEATFPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGVA----NHGYNVWRDPMKPTHILAKLCKDGKLDGPHYGPGGRVKVENRVF----MAPTEIEDENLKKKTDEHLALCVLTHWEEIPRVGCKLVPEHVETRPLLHPDKPGIEQGRIELWVDMFPKEMTAPGPALDISPRKP-KFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVR-WLKGQQEDKQDTDVHYHSITGEGNFNWRFVYPFDYLMAEEKIVISKKESMFAWDETEYKIPPRLNLQVWDADHFSADDFLA-IELDLNRFPRGAKTAKQCTIEMVTNEAE-MPMVSIFKQKRIKGWWPFVARNEEDEFELTGKVEAELHLLTGEEAEKSPAGEGRNEP 1623          

HSP 2 Score: 338.191 bits (866), Expect = 1.386e-93
Identity = 237/737 (32.16%), Postives = 397/737 (53.87%), Query Frame = 1
Query:  556 EEDETDNAEIGNSGSGPQ-IKIKKVGKRTTRKSYSTKPQ-----------DFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKL-RSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGV--QLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETN--DVSAS-------VTPINEEILTRVSKFLRRRKYRLHVAFMSATML--RISDTTIEFEVSMGNYGNKLD-------------------------------DTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKI-KVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDK-YLKI-VREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQ-YWHGM 2583
            E +  DN  +   G  P  I +  V   TT  S  +KP+           D+Q+ + V+EARQL G N+ P+  V+     K T +K STN P +N  F F+FH+    +FD+ +   + +S+ L RS  L+G+FK D+  IY +P H + +KW LLSDP+D  +G KGY+K   A++  GD   +   + + + D+IE+NLL P GV  + + A + L++Y+AE LP M++S    +K+AF    NK+LVDPY+ V FAG++ KTS + +   P WNE++     FP +C R+K+QL D D+V+ + AIGTHF+D+  + +    + FLPT GP ++N YGS R +S L D+++ LN G G+G ++R R+L+ L  ++ +T+  ++S S       V  I+E    +V +F       L  +F+ ATM+  +I D  I FEV++  YGN++D                               D    +S  T P        +Y+ LP+ + KPC  ++  W++   RL++ N    IAD+L   +  + ++        E + + V+         L+  +   D NQS +T+LDK  LK+ + E E   +  +AM+ + + ++V   +     F+ +L+ L+ EPQ+S+PDV IWM++  KR  Y RIP+ D+++S  ++ +G+ CG ++ I + IP   +        + +++ + +WLG  ++ + Y +G+
Sbjct:    6 EAENLDNNGMFRGGPDPDTISLASVTAVTTNVSNKSKPEIKMEPSSGRPVDYQVSVTVIEARQLVGLNMDPMVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKNLLRSGTLVGTFKLDVGTIYSQP-HQFYHKWALLSDPDDITAGGKGYVKCDIAVVAKGDTIKTPHKANESDEDDIESNLLLPEGVPAERQWARYYLKIYKAEGLPRMNTSIMANVKKAFI-GENKDLVDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIAFTEMFPPLCRRMKIQLRDSDKVN-DVAIGTHFLDLRNISN--DGDKFLPTLGPAWVNMYGSTRTFS-LLDEYQELNDGLGEGVSFRARLLISLGVEILDTSSPEISCSTEVQVEGVPNISESATGKVEEFF------LFGSFLEATMIDRKIGDKPINFEVTI-YYGNEIDGALQPKPKGEKGKGDEEETELIHNSSEEEMEDDGDLTSVATTPPMKPVITDNYFHLPYFERKPCIYIKSLWQDQKRRLYNSNIIDNIADKLEDGLNDVNEIIKTEKAYPERRLRGVLEELSQGCQFLA--LANKDQNQSGRTKLDKERLKLCLSEVEAIGLQAKAMRSQVKKSTVRDKLKLSQNFLSKLRFLADEPQHSVPDVFIWMISNGKRIAYARIPSKDILYSSIDEEKGKDCGKVKTIFLRIPGK-KGFGPAGWTVQSKIEIYLWLGLTRQRKDYLNGL 726          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000070967.1 (SMESG000070967.1)

HSP 1 Score: 3823.48 bits (9914), Expect = 0.000e+0
Identity = 2020/2040 (99.02%), Postives = 2024/2040 (99.22%), Query Frame = 1
Query:   88 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRL+KNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRKLAATKPKKEK  K L++     NEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEE      +  VSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI
Sbjct:    1 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLSKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRKLAATKPKKEKQSKLLTED----NEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEE------EGDVSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI 2030          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000070967.1 (SMESG000070967.1)

HSP 1 Score: 3818.47 bits (9901), Expect = 0.000e+0
Identity = 2019/2040 (98.97%), Postives = 2022/2040 (99.12%), Query Frame = 1
Query:   88 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRL+KNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQR         +  K+K SKLLTEDNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEEEGDDGEKTQVSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFP      DLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI
Sbjct:    1 MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLSKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQR----KLAATKPKKEKQSKLLTEDNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEEEGDDGEKTQVSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFP------DLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI 2030          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000070967.1 (SMESG000070967.1)

HSP 1 Score: 3817.7 bits (9899), Expect = 0.000e+0
Identity = 2017/2037 (99.02%), Postives = 2021/2037 (99.21%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRL+KNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRKLAATKPKKEK  K L++     NEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEE      +  VSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI
Sbjct:    1 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLSKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRKLAATKPKKEKQSKLLTED----NEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEE------EGDVSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI 2027          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000070967.1 (SMESG000070967.1)

HSP 1 Score: 3811.15 bits (9882), Expect = 0.000e+0
Identity = 2016/2037 (98.97%), Postives = 2019/2037 (99.12%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRL+KNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQR         +  K+K SKLLTEDNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEEEGDDGEKTQVSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFP      DLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI
Sbjct:    1 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLSKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQR----KLAATKPKKEKQSKLLTEDNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAEEEEGDDGEKTQVSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFP------DLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI 2027          
BLAST of Fer-1-related vs. Planmine SMEST
Match: SMESG000070967.1 (SMESG000070967.1)

HSP 1 Score: 3799.98 bits (9853), Expect = 0.000e+0
Identity = 2005/2037 (98.43%), Postives = 2010/2037 (98.67%), Query Frame = 1
Query:   97 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYXXXXXXXXXXXXXXXXXXXXXXIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPXXXXXXXXXXXXXXXXXSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDXXXXXXXXXXXXXXXXXTNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEXXXXXXXXIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQRXXXXXXXXXXXXXXXXXXXXXXXNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGAXXXXXXXXXKTQVXXXXXXXXXXXXPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSXXXXXXXXXXXSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKXXXXXXXXXXXXXXXKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKXXXXXXXXXXXXXXXXXXXXXXXPGLTARKMFAI 6207
            MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRL+KNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQR         +  K+K SKLLTEDNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGA      + E+  VSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFP      DLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI
Sbjct:    1 MNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWDENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTEVQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQTDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRIKVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHISAAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLLSDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAGVQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSFAGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDAIGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNLGKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKYRLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVFDGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLSKNIEKIKVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLKIVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMPDVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLIEDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQASLLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMSLYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIVLPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRYVRQR----KLAATKPKKEKQSKLLTEDNEHWEYAPMFDLKFHADERKIDMVRRRRWHRKMKSTKPGASCFFNLGA------EEEEGDVSSKSAKKTAMAAPRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTEIQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEFLGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKDLPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSAEFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRDHRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFP------DLEINTFKKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCSKYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEENDSVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAYDLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLPVVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSGINQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETEDSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWVDIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSDIYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNKKEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKKRANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELEIDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFIIWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI 2021          
The following BLAST results are available for this feature:
BLAST of Fer-1-related vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYSF0.000e+043.18dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
DYSF0.000e+042.89dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
DYSF0.000e+042.71dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
DYSF0.000e+043.06dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
DYSF0.000e+042.88dysferlin [Source:HGNC Symbol;Acc:HGNC:3097][more]
back to top
BLAST of Fer-1-related vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fer-18.063e-11124.45Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-15.576e-11025.02Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-15.576e-11025.02Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
ferl-11.654e-2223.62FER-1 Like [Source:UniProtKB/TrEMBL;Acc:O01596][more]
snt-53.621e-1037.29SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfr1.451e-8332.13gene:FBgn0266757 transcript:FBtr0273291[more]
mfr1.216e-7832.18gene:FBgn0266757 transcript:FBtr0273287[more]
mfr2.026e-7832.18gene:FBgn0266757 transcript:FBtr0273290[more]
mfr6.332e-7832.18gene:FBgn0266757 transcript:FBtr0273289[more]
mfr2.042e-7331.62gene:FBgn0266757 transcript:FBtr0273285[more]
back to top
BLAST of Fer-1-related vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myof0.000e+044.35myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138][more]
dysf0.000e+042.97dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
dysf0.000e+042.52dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
myofl0.000e+041.88myoferlin like [Source:ZFIN;Acc:ZDB-GENE-111116-2][more]
otofb8.682e-10237.75otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
back to top
BLAST of Fer-1-related vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctnnal10.000e+045.17catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5... [more]
ctnnal10.000e+044.36catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5... [more]
ctnnal10.000e+043.87catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5... [more]
ctnnal10.000e+044.06catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5... [more]
ctnnal10.000e+043.95catenin alpha-like 1 [Source:Xenbase;Acc:XB-GENE-5... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dysf0.000e+043.11dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
Dysf0.000e+043.19dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
Dysf0.000e+042.90dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
Dysf0.000e+042.82dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
Dysf0.000e+042.93dysferlin [Source:MGI Symbol;Acc:MGI:1349385][more]
back to top
BLAST of Fer-1-related vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75923|DYSF_HUMAN0.000e+042.88Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=... [more]
sp|Q9NZM1|MYOF_HUMAN0.000e+043.45Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=... [more]
sp|A6QQP7|DYSF_BOVIN0.000e+042.86Dysferlin OS=Bos taurus OX=9913 GN=DYSF PE=2 SV=1[more]
sp|Q9ESD7|DYSF_MOUSE0.000e+042.77Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV... [more]
sp|Q69ZN7|MYOF_MOUSE0.000e+043.30Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV... [more]
back to top
BLAST of Fer-1-related vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FV950.000e+054.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210PPE80.000e+051.89Dysferlin OS=Mizuhopecten yessoensis OX=6573 GN=KP... [more]
A0A5K4EQ240.000e+050.68Fer-1-related OS=Schistosoma mansoni OX=6183 PE=4 ... [more]
A0A3Q0KNB20.000e+050.26Fer-1-related OS=Schistosoma mansoni OX=6183 PE=4 ... [more]
A0A5K4EPJ10.000e+050.19Fer-1-related OS=Schistosoma mansoni OX=6183 PE=4 ... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myofl0.000e+044.11myoferlin like [Source:ZFIN;Acc:ZDB-GENE-111116-2][more]
dysf1.082e-644.00dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
myof7.828e-1344.05myoferlin [Source:ZFIN;Acc:ZDB-GENE-040426-1138][more]
fer1l64.306e-7939.13fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
otofb1.467e-9738.39otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
back to top
BLAST of Fer-1-related vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001770.10.000e+042.55pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 ge... [more]
ENSPMAT00000001654.10.000e+039.67pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 ge... [more]
ENSPMAT00000008905.13.825e-12643.25pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 ge... [more]
ENSPMAT00000002265.11.627e-11853.44pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gen... [more]
ENSPMAT00000004363.13.772e-9029.77pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 ge... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TCB18.782e-630.00Lipid-binding ER protein involved in ER-plasma mem... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO430880.000e+043.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368630.000e+049.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368660.000e+047.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474159.323e-9437.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368655.605e-12958.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fer-1-related vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myofl0.000e+037.84myoferlin [Source:NCBI gene;Acc:101156429][more]
myof0.000e+041.77myoferlin [Source:NCBI gene;Acc:101172285][more]
dysf0.000e+039.93dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
otofa6.234e-9838.46otoferlin [Source:NCBI gene;Acc:101155482][more]
otofb1.257e-16939.74otoferlin-like [Source:NCBI gene;Acc:101160130][more]
back to top
BLAST of Fer-1-related vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070967.10.000e+099.02SMESG000070967.1[more]
SMESG000070967.10.000e+098.97SMESG000070967.1[more]
SMESG000070967.10.000e+099.02SMESG000070967.1[more]
SMESG000070967.10.000e+098.97SMESG000070967.1[more]
SMESG000070967.10.000e+098.43SMESG000070967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017663 ID=SMED30017663|Name=Fer-1-related|organism=Schmidtea mediterranea sexual|type=transcript|length=6375bp
TTTAACAGAAAAATTACTGTTTAATTCAATTCAGTTTTTTTGTATTTCAT
TTTTTGTAAACTATAGAAAAAAAGATCCACGAACGAAATGAGTGGCATGA
ATGTTACTGTTATCAATGCGACAAATCTCATCAACATGGAACTCGTCGGG
AAAAGTGATCCATACGTTCTAATCGAGTTTCAAGGTCAAAAGAAAAAAAC
TAAAGAAATAGGAGAAAACCTGAATCCTCAATGGGACGAAAATTTATCAT
TTGATCTGGCTGGAGCAGCTTTGACCGTAACAGATGTATTAGGAGTCAAA
GTTATGGACAAAGAAAAAATCGGACCTGACAAATTAATGGGATCTATTGA
TGTTCCTCTTCGAGACCTAGCCGGTGGAAAAACTGAAGTTCAGTTAACTC
TCAATTTATTGGATAAAAACAAAAGACCTACCGCAGGTGTTTTAAATTTA
AAAGTTCAATATCAACCTCCTAAACCAGCCCCGGGAGCAGCACAAGGTGG
GTCTCAACAACAGACTGCTGGAACAGCTATTGATCAAACGGATAGTGCAG
GAGCAGAAGAAGACGAGACAGATAATGCTGAAATCGGTAATTCTGGATCA
GGTCCGCAAATTAAAATCAAAAAAGTAGGAAAGAGAACTACGAGAAAATC
ATATTCAACAAAACCGCAAGATTTCCAAATACGAATTAAAGTCGTTGAAG
CTCGACAACTGCAAGGTGGAAACATTTCGCCGGTTTGCAAAGTCAAATGT
AAAAATCAAGTAAAACAAACCAAAGTGAAAAATTCGACTAACTCACCAGA
ATGGAATGCGAGTTTCTTTTTCAATTTCCATATTTCAGCGGCCGAATTGT
TCGACGAAACAATATCGTTTGAAATTTTCAACTCGAGAAAATTACGATCT
GATGCATTAATCGGCTCGTTTAAATTTGATTTGAGCATGATATATGAAGA
ACCGAAACATAATTACATGAATAAATGGCTGTTGTTATCGGACCCAGAAG
ACGGGAATTCTGGAGCAAAAGGTTATCTGAAATTTTGTGCTGCTATTCTC
GGACCGGGAGATGAGGCACCGAGTTTTTCAAGTTCAAAAAAAGAAGAAAG
CGATGAAATCGAAACTAATTTACTTCGTCCAGCTGGAGTTCAATTGCGAC
CGGCGACGTTCGTATTAAGAGTTTATCAAGCTGAAGACTTACCAATAATG
GATTCTTCGGCTTTCCAAGGAATAAAGCAAGCTTTCACGAACTCGTCAAA
TAAAGAATTAGTCGATCCATATATGGTTGTTTCATTTGCCGGGAAAGAAC
TCAAAACATCAACTAAATACACAAACGATCATCCGGACTGGAATGAAGAA
TTAAAAATACCTCTTCAATTCCCATCGATGTGCGATAGACTGAAATTGCA
GCTGTTTGATTGGGACAGAGTCAGTGCAAATGACGCAATTGGAACTCATT
TTATAGATATTTCTGCTGTTGGGAGCATGCGGGCAGAAAATGGGTTTCTT
CCAACATTTGGACCGTGTTTTCTTAATTTCTACGGTAGTCCAAGAGAATA
TTCAGACCTGCCGGACAAATTTGAAGCTCTCAATCTAGGAAAAGGTGACG
GATGCGCCTATCGAGGCAGGGTGCTGATGGAATTGACAACACAATTGAAT
GAAACGAATGATGTATCAGCATCGGTAACGCCAATTAATGAGGAAATTCT
CACAAGAGTTTCTAAATTTCTCCGTAGACGAAAATACCGACTTCATGTAG
CATTTATGTCTGCGACTATGCTTAGGATTTCAGACACTACAATTGAATTC
GAAGTCAGCATGGGTAATTATGGTAACAAATTGGACGATACCGTTCCAGC
AAGTAGTTCGTGCACTCAACCAACCAATGCTGTCTTTGATGGATCACACT
ACTATTTTCTTCCTTGGGGAGACACAAAACCTTGCTCAGTTGTTGAATGT
CACTGGGAGAATATCTCATGTCGACTCTTTTCTATAAATTTCTTTCTAAG
AATTGCTGATCGACTAACTAAAAACATTGAGAAAATAAAAGTTGCATTGA
ATGCGAATATCCCAGAAGAGGAACAAGCCCAATTTGTTATTTCTGCTTTC
GATGATCTAATAATTAGTTTAAGCAAACCGATTCCTGAGTGGGATCCTAA
TCAATCTCCTCAAACAGAACTGGATAAATATTTAAAAATAGTCCGAGAAC
AAGAATTGAAGCAAATGATCACTGAAGCCATGAAGATTAGAAATGAAGCA
ACAAGCGTATCTCAAGCAATTACTGATCTTGATGCTTTCGTATGTCAGTT
GAAGAGTTTATCAGTAGAACCACAAAACAGCATGCCAGACGTTATCATTT
GGATGCTTACTGGCAGTAAAAGAAAGTATTATGTTCGAATTCCAGCTCAT
GACGTGATTTGGAGTGACAATGAAGATTATCGTGGTCGCCTTTGTGGTGC
TTTGCAAAATATTCCCATGAATATTCCAGTTTTGATAGAAGATAAAGATG
ATAAAGATTTGTTGATACCAGCACAGTTACGTTTAAAAATATGGCTTGGT
CAAGAAAAAGAAGAACAATATTGGCATGGAATGCAGAAAGAAGGGAAGCT
GGTTGTGTTGGCTGAAACATACGAAAATCAAGCTAGTCTCCTTGGAAAAT
GGACCACAAAATCTCCATTGATGAGTCGACCAGGTTGGTCAGATGCAAGT
GGAAAAATAAAATTACCAAAAGAGAAAATAAATCCGCCTACTGGGTGGGA
ATGGGACGGCGATTGGTTTATTAGTCCAGAAATGTCTTTGTATTTTGATA
AGAATGCTCTTTTGACCGAATTTTTGGAAGACATGTTTGTTTGTGAAATG
AGATTTCCAGGAGGAAATTGGGGCCCGGCTACAATTCAATATTCAAATAC
TAGAGGAGATCCATGCCCTGGTCCAAATGAAATAGTTCTACCAGAAGGTT
GGGAATGGTGCGGTACTTGGACAGTGGATTTCAATAGGCCTTGTGATGAA
GAAGGATGGGAGTATGCCGTTGACCCGTCTTTGGGTGGATATCAACCTGC
TGAGAAAATGTATCACATGAGCCGGCGTCGAAGATATGTTAGACAAAGGA
AATTAGCAGCAACTAAACCTAAAAAAGAAAAAGATAAAAAGAAACTGTCT
AAACTGCTCACTGAGGACAATGAGCATTGGGAGTATGCTCCGATGTTTGA
TTTGAAATTTCACGCTGACGAACGGAAAATTGACATGGTGAGACGTAGAA
GATGGCACAGGAAAATGAAATCTACAAAACCCGGAGCTTCTTGTTTTTTT
AATTTGGGCGCCGAAGAAGAGGAAGGAGATGATGGTGAAAAGACGCAGGT
TTCCTCCAAATCAGCAAAGAAAACCGCAATGGCTGCTCCTCGAATGTATA
TCAAATATGATAAATTGCACAAATATCAACTACGAGCTTACATATTCCAA
GCAAGAAATCTTTTGGCTGCGGATCAGAACGGATTTTCAGATCCGTATTC
TAGGGTCGTATTTTGCAATCAATCACAAACTACTGAGATTCAGAATAAAT
CTATTTGTCCAACATGGGATCAAACTCTTGTATTCAAAGAAGTAGAAATC
CATGGAGATCCAGTCAGGGTTTCCGAGTCTCCACCTAAGATTAATGTGGA
ATTATTTGATCATGATCAACTCGGTGAAGATGAATTTCTCGGCCGTTGTG
AAGCATTCCCAATGGTAAAATTACAAGCGAACGATACTCGCCGTTCGGTT
TTACAATGGTTTCCAATTAAAAAGGGTTCAAGAGAAGCTGGAGAAATGTT
AGCGGCGTTTGAGATTTATTTGATTGGAGACAAAGACCTCCCATTTCTTC
CTCCAAAGCTTGGAAACATATATACGATTCCTGATGGAATTCGACCAATG
ATGCAACGAACTGCAGTCGAAGTGTTGACTTGGGGAGTTCGTAATATGAA
GAAATTTCAGTTGCTTAGTGTCGTTTCCCCAAGTGCAGAATTTGAAATCG
GTGGAAATGTCTTAGAAACGAATATGATAAAAAATGTCAACAAGAATCCC
AATTTCTCGACACCGTTTTTATTTTTCGATGTCCTTTTACCTAAGGAAGA
ACTTTATATGCCACCGATGAATATAAAAATCCGTGATCATAGAGCTTTTG
GCCGCAAGCCAATAGTTGGAACGTATTGTTTAAAAAATACAGATCAGTAC
AGATGTTTAGCCTTGACCGAAGAACACGACAGACTTGATGATTTCCCAGC
CTTTGACCCAAATGTCGATCTAGAAATAAACACATTTAAAAAACCGAAAG
AACCTGCTGCTCATAAACTACCGTCTCTACCAGATATTTTTAAAGGGAAG
AAAAAGCCCACTAAAGTCATTGTAGAAGAAGACATTGATTGGTGGTCTAA
ATATTATGCCTCCCTTGGTCAGTTTGATAAATGCAGCAAATATTTGGAAC
TTATGCACGATACTTTAATATTTTATAAGAAGGAGCTGGAATTTAGTGAA
GATTATGATGGATTTGATGATTTTTGCAGTACATTTTTACTTACTCGTGG
TAGTAATGATGAGTGTGAGGATGATGAAGAAAATGATTCTGTTGGTGAAT
TTAAAGGAACATTTAGAATATATCCGTTACCAGAAGATCGAAATGAACCA
ATGCCCGTGATATATTTAGATTCGGCAAATCTACCAACAAACGATATAGT
GGAATGTATAATTCGTATTTATATTATCAAAGCATACGATTTGCAGCCAT
CTGATCCAAGTGGCTTAGCTGATCCATACATTAAAATACAATTAGGTAAA
GAAAGAAAATCTTCAAAAGATGAATACGTACCTAATACATTAAATCCAGA
ATTCGGAAGAATATTCGAAATGAAAGCTCGACTACCGGTTGTCAAAGATT
TATGCGTGCAGATTTTGGATTATGATTTACTGGGGAAAGACGACATAATT
GGTGAAACTTGGATCGACCTTGAAAACCGATACCTAAGCAGATTTCGTGC
AACTTGTGGATTACCGCAGACTTACTACACTAGTGGAATCAATCAATGGA
GAGACTGCCAATTACCCTCATCTATTTTGCAGGAATTCTGTGCAAAAAAT
AGAATTGGTTTCCCAGAATATTTAGAGAATGATTGCTTGAAAATCTGCTC
AAAGGTTTTCAATTTATCTCAGTTTGAAGAGACAGAAGACTCAAATCCGA
ACTTAGGTCCAAAGAAAGAAAGACTTGCTCTCCATGTTTTAAATAAGTTA
CCGTTGGTTAAAGAACACATCGAGGTTCGTCCTCTATTCAGTACTTTGCA
GCCAGGAATCGAGCAAGGTAAAGTTGAAATGTGGGTTGATATTCATCCTG
TGGCATTGGGTCCACCAGGTCCACCTTTCAATATTATGTCAAGAAAAGCT
AAGAAATACCAATTACGTGTGGTTGTCAGAAATACATATGATGTTAAACT
CGACGAAACAAATTTATTGGGAGAAAGAATGTCAGATATATATGTTAAAG
CTTGGATAAATGGAATCGAAGAAAAACAAGAAACCGATGTGCATTATCGT
TCTCTTGATGGGGAAGGAAACTTCAACTGGAGATTCGTTTTTCCGTTTGA
TTATATTCCGTCAGAAAATTGTATGGTTGTGAATAAGAAAGAACACTTTT
GGTCTTTGGATAAAACTGAGGAAAGACGAAAATGCAGTGTAACTTTTCAA
GTTTGGGACAACGACAAATTTTCTCCTGATGACTTTTTGGGAACTATAGA
AATGGATTTGGCTGCATTGCCTTCACCTGCAAAAAAGAGAGCAAACTGTA
AACTGGAAATACTTCCAGAGTTTGGAAAAAATATTGAATTCGTTAATCTT
TTCGATTGCAAGAGAATCATGGGTTACTGGCCTGTTTTTGATAATTCGAC
AGGCGTTCCTGAATTAACTGGTAAGTTAGAACTGGAAATAGATCTGCTTA
CTGAAGAAGAAGCAACACTGAAACCGGCTGGATGTGCGAGAGATGACCCC
AATGAAAATCCCCATTTGGATCCACCAAACCGTCCTGCGACTTCATTCTT
CTGGTTCACATCACCTTGGAAAACCTTCAAATTTATAATATGGAAGAATA
TGAAATATTATCTCCTTACAGTATTGATAATAGTTTTACTCGCACTTCTA
GTGGTCTTGTTTATTTATGCCATTCCGGGTTTGACAGCTAGAAAAATGTT
TGCTATTTAAGTAAGTGAAAGGGAGTCGCTGTCCGAAAAATATTTAAAAT
TTAATTTATTTGAACCAAGAATGTGATAAAATACTTTAGTACCTGTTGTA
CATTTGATTGCACCGATTTTTCTGTCGGTTTCTCATATTTATACTTGCTT
TATACTATAGAAGATTTTTTATAAT
back to top

protein sequence of SMED30017663-orf-1

>SMED30017663-orf-1 ID=SMED30017663-orf-1|Name=SMED30017663-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2041bp
MSGMNVTVINATNLINMELVGKSDPYVLIEFQGQKKKTKEIGENLNPQWD
ENLSFDLAGAALTVTDVLGVKVMDKEKIGPDKLMGSIDVPLRDLAGGKTE
VQLTLNLLDKNKRPTAGVLNLKVQYQPPKPAPGAAQGGSQQQTAGTAIDQ
TDSAGAEEDETDNAEIGNSGSGPQIKIKKVGKRTTRKSYSTKPQDFQIRI
KVVEARQLQGGNISPVCKVKCKNQVKQTKVKNSTNSPEWNASFFFNFHIS
AAELFDETISFEIFNSRKLRSDALIGSFKFDLSMIYEEPKHNYMNKWLLL
SDPEDGNSGAKGYLKFCAAILGPGDEAPSFSSSKKEESDEIETNLLRPAG
VQLRPATFVLRVYQAEDLPIMDSSAFQGIKQAFTNSSNKELVDPYMVVSF
AGKELKTSTKYTNDHPDWNEELKIPLQFPSMCDRLKLQLFDWDRVSANDA
IGTHFIDISAVGSMRAENGFLPTFGPCFLNFYGSPREYSDLPDKFEALNL
GKGDGCAYRGRVLMELTTQLNETNDVSASVTPINEEILTRVSKFLRRRKY
RLHVAFMSATMLRISDTTIEFEVSMGNYGNKLDDTVPASSSCTQPTNAVF
DGSHYYFLPWGDTKPCSVVECHWENISCRLFSINFFLRIADRLTKNIEKI
KVALNANIPEEEQAQFVISAFDDLIISLSKPIPEWDPNQSPQTELDKYLK
IVREQELKQMITEAMKIRNEATSVSQAITDLDAFVCQLKSLSVEPQNSMP
DVIIWMLTGSKRKYYVRIPAHDVIWSDNEDYRGRLCGALQNIPMNIPVLI
EDKDDKDLLIPAQLRLKIWLGQEKEEQYWHGMQKEGKLVVLAETYENQAS
LLGKWTTKSPLMSRPGWSDASGKIKLPKEKINPPTGWEWDGDWFISPEMS
LYFDKNALLTEFLEDMFVCEMRFPGGNWGPATIQYSNTRGDPCPGPNEIV
LPEGWEWCGTWTVDFNRPCDEEGWEYAVDPSLGGYQPAEKMYHMSRRRRY
VRQRKLAATKPKKEKDKKKLSKLLTEDNEHWEYAPMFDLKFHADERKIDM
VRRRRWHRKMKSTKPGASCFFNLGAEEEEGDDGEKTQVSSKSAKKTAMAA
PRMYIKYDKLHKYQLRAYIFQARNLLAADQNGFSDPYSRVVFCNQSQTTE
IQNKSICPTWDQTLVFKEVEIHGDPVRVSESPPKINVELFDHDQLGEDEF
LGRCEAFPMVKLQANDTRRSVLQWFPIKKGSREAGEMLAAFEIYLIGDKD
LPFLPPKLGNIYTIPDGIRPMMQRTAVEVLTWGVRNMKKFQLLSVVSPSA
EFEIGGNVLETNMIKNVNKNPNFSTPFLFFDVLLPKEELYMPPMNIKIRD
HRAFGRKPIVGTYCLKNTDQYRCLALTEEHDRLDDFPAFDPNVDLEINTF
KKPKEPAAHKLPSLPDIFKGKKKPTKVIVEEDIDWWSKYYASLGQFDKCS
KYLELMHDTLIFYKKELEFSEDYDGFDDFCSTFLLTRGSNDECEDDEEND
SVGEFKGTFRIYPLPEDRNEPMPVIYLDSANLPTNDIVECIIRIYIIKAY
DLQPSDPSGLADPYIKIQLGKERKSSKDEYVPNTLNPEFGRIFEMKARLP
VVKDLCVQILDYDLLGKDDIIGETWIDLENRYLSRFRATCGLPQTYYTSG
INQWRDCQLPSSILQEFCAKNRIGFPEYLENDCLKICSKVFNLSQFEETE
DSNPNLGPKKERLALHVLNKLPLVKEHIEVRPLFSTLQPGIEQGKVEMWV
DIHPVALGPPGPPFNIMSRKAKKYQLRVVVRNTYDVKLDETNLLGERMSD
IYVKAWINGIEEKQETDVHYRSLDGEGNFNWRFVFPFDYIPSENCMVVNK
KEHFWSLDKTEERRKCSVTFQVWDNDKFSPDDFLGTIEMDLAALPSPAKK
RANCKLEILPEFGKNIEFVNLFDCKRIMGYWPVFDNSTGVPELTGKLELE
IDLLTEEEATLKPAGCARDDPNENPHLDPPNRPATSFFWFTSPWKTFKFI
IWKNMKYYLLTVLIIVLLALLVVLFIYAIPGLTARKMFAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007520myoblast fusion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR037721Ferlin
IPR029999Myoferlin
IPR037720C2B_Ferlin
IPR037725C2F_Ferlin
IPR037724C2E_Ferlin
IPR037723C2D_Ferlin
IPR037722C2C_Ferlin
IPR012968FerIin_dom
IPR006614Peroxin/Ferlin
IPR000008C2_dom
IPR012560Ferlin_A-domain
IPR012561Ferlin_B-domain
IPR032362Ferlin_C
IPR000421FA58C
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006614Peroxin/Ferlin domainSMARTSM00693dysfncoord: 909..964
e-value: 0.17
score: 21.0
coord: 837..896
e-value: 5.0E-14
score: 62.6
IPR006614Peroxin/Ferlin domainSMARTSM00694dysfccoord: 1030..1063
e-value: 1.9E-4
score: 30.8
coord: 973..1007
e-value: 8.9E-6
score: 35.2
IPR000008C2 domainSMARTSM00239C2_3ccoord: 197..294
e-value: 1.2E-12
score: 58.1
coord: 1775..1903
e-value: 2.0E-4
score: 30.7
coord: 3..103
e-value: 2.6E-13
score: 60.2
coord: 1114..1222
e-value: 3.8E-8
score: 43.1
coord: 1281..1379
e-value: 25.0
score: 4.3
coord: 357..470
e-value: 1.0E-10
score: 51.6
coord: 1541..1640
e-value: 1.3E-10
score: 51.3
IPR000008C2 domainPFAMPF00168C2coord: 197..288
e-value: 1.4E-13
score: 51.0
coord: 1541..1630
e-value: 2.8E-15
score: 56.5
coord: 358..469
e-value: 5.8E-16
score: 58.7
coord: 1114..1226
e-value: 1.2E-13
score: 51.3
coord: 5..98
e-value: 1.1E-17
score: 64.1
coord: 1782..1900
e-value: 9.9E-5
score: 22.6
IPR000008C2 domainPROSITEPS50004C2coord: 197..279
score: 9.716
IPR000008C2 domainPROSITEPS50004C2coord: 1542..1625
score: 13.505
IPR000008C2 domainPROSITEPS50004C2coord: 355..455
score: 12.099
IPR000008C2 domainPROSITEPS50004C2coord: 1775..1888
score: 8.784
IPR000008C2 domainPROSITEPS50004C2coord: 1..88
score: 14.763
IPR000008C2 domainPROSITEPS50004C2coord: 1100..1205
score: 14.452
IPR012561Ferlin B-domainSMARTSM01201FerB_2coord: 745..822
e-value: 3.1E-30
score: 116.5
IPR012561Ferlin B-domainPFAMPF08150FerBcoord: 745..821
e-value: 5.3E-24
score: 84.6
IPR012968FerIin domainSMARTSM01202FerI_2coord: 280..351
e-value: 8.8E-30
score: 114.9
IPR012968FerIin domainPFAMPF08151FerIcoord: 301..351
e-value: 2.8E-16
score: 59.3
IPR012560Ferlin A-domainSMARTSM01200FerA_2coord: 652..718
e-value: 3.4E-12
score: 56.5
IPR012560Ferlin A-domainPFAMPF08165FerAcoord: 653..718
e-value: 2.0E-13
score: 50.1
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1099..1243
e-value: 3.8E-24
score: 87.1
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 195..317
e-value: 7.2E-22
score: 79.6
coord: 2..131
e-value: 8.6E-31
score: 108.4
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 349..472
e-value: 1.3E-19
score: 72.2
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1765..1907
e-value: 2.2E-18
score: 68.2
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1538..1646
e-value: 3.9E-19
score: 71.2
IPR032362Ferlin, C-terminal domainPFAMPF16165Ferlin_Ccoord: 1936..2034
e-value: 2.6E-24
score: 85.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 135..150
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 129..192
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 356..461
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1111..1243
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1538..1658
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1272..1373
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 193..319
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1743..1899
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 5..130
NoneNo IPR availableTMHMMTMhelixcoord: 2007..2029
IPR037721Ferlin familyPANTHERPTHR12546FER-1-LIKEcoord: 16..2036
IPR029999MyoferlinPANTHERPTHR12546:SF55MYOFERLINcoord: 16..2036
IPR037720Ferlin, second C2 domainCDDcd04011C2B_Ferlincoord: 193..303
e-value: 1.44311E-53
score: 180.85
IPR037725Ferlin, sixth C2 domainCDDcd08374C2F_Ferlincoord: 1775..1906
e-value: 2.08749E-69
score: 227.161
IPR037724Ferlin, fifth C2 domainCDDcd04037C2E_Ferlincoord: 1541..1664
e-value: 2.03657E-60
score: 201.239
IPR037723Ferlin, fourth C2 domainCDDcd04017C2D_Ferlincoord: 1113..1246
e-value: 4.7328E-63
score: 208.936
IPR037722Ferlin, third C2 domainCDDcd04018C2C_Ferlincoord: 357..510
e-value: 3.46579E-75
score: 244.465