Calsyntenin 1

Overview
NameCalsyntenin 1
Smed IDSMED30017636
Length (bp)3071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calsyntenin 1 (SMED30017636) t-SNE clustered cells

Violin plots show distribution of expression levels for Calsyntenin 1 (SMED30017636) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calsyntenin 1 (SMED30017636) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calsyntenin 1 (SMED30017636) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017636

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017636SMESG000068054.1 dd_Smed_v4_4147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017636SMESG000068054.1 dd_Smed_v4_4147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017636SMESG000068054.1 dd_Smed_v4_4147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30017636SMESG000068054.1 dd_Smed_v4_4147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017636SMESG000068054.1 dd_Smed_v6_4147_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30017636SMESG000068054.1 dd_Smed_v4_4147_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017636SMESG000068054.1 dd_Smed_v4_4147_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30017636SMESG000068054.1 dd_Smed_v4_4147_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN2 (calsyntenin 2 [Source:HGNC Symbol;Acc:HGNC:17448])

HSP 1 Score: 108.997 bits (271), Expect = 1.763e-23
Identity = 188/863 (21.78%), Postives = 342/863 (39.63%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEG---------------------DSIGPHNIKALGTDFTLSWWMKRQSKL-----KTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTT---VSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRA---IMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIR---IFPNFRFISETNAESVAKDIK---------------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMID----ERKKFSIICTLKGGDYTSQTI-VEV-------IQTKFRIIHVANNENPLNDLAHHQSRNERAMFQEKSSDESLN--LLNISKSKFIAVIIMAVF 2425
            T Y G +  N+ TV + P L A      V  + +IC F++ G   + +PF   +L++ SG G ++ K  +  D +L+  Y F ++A+DC + PH      SH A V I V  VNEF P F   +Y   V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +  P     LV ++++PVC+    D+  +++Y   +G   +  S  L         T     S L+ VT           E   ++  + C  +  + +  + +CGA+   IDLL +     +   G                     D I P N   L   FT++ WMK          K  I C  D    + +  ++ + NC+L  +        +  +  +     ++    +W ++ I+ ++  + L   G + +  L+T    +       Q  +   + GG + K        G        L  +++   K ++Q VI CL  C E   I + +S+    K +   + S LV++   I  +  +  K+ YIN+     T  ++  + S       ++C  +++ IS+P     +M +  I P+       I +    +      + ES R   +FP+ + +S         D+K               L+ C + +   +L  + R        + L+   L+  ++   ++I G  S   YE +L H++         E ++F I C+   G YTS    +EV       +  K  + H+      L  + H +SR+     Q  S   S+   ++ IS    + V+ M V+
Sbjct:   46 TSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHG---QELPFEAVVLNKTSGEGRLRAK--SPIDCELQKEYTFIIQAYDCGAGPHETAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDSILQ--VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQK-PAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHL--------ETCDGAVSSLQIVT-----------ELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKVPDGIVPKN---LTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVTKPQFAQFFHG-------SLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS-RQFPTAGVRRLKVSS-----KVQCFGEDVCISIPEVDAYVMVLQAIEPR-------ITLRGTDHFWRPAAQFESARGVTLFPDIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDILVIGGDL--DPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRNWRPASLEARRFRIKCSELNGRYTSNEFNLEVSILHEDQVSDKEHVNHLIVQPPFLQSVHHPESRSS---IQHSSVVPSIATVVIIISVCMLVFVVAMGVY 853          
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN3 (calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371])

HSP 1 Score: 102.064 bits (253), Expect = 3.080e-21
Identity = 168/815 (20.61%), Postives = 319/815 (39.14%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL--------LTEGGIIHINEGDSI-----GPHNIK---------------ALGTDFTLSWWMK------RQSKLKTEIFC----LKDDHNSISILLENCQLS-----IMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQ--FQIVRIFVGGCMRKSAAHTHLRGHKRSPIAK-------------LGVISLATEKPQTQDVIECLSTCGEAIVASD--SIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKET---------GNDTIDVE------IVTNSTITTTKSESIRIFPNFRFISETNAESVAKDI--KLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDER----KKFSIICTLKGGDYTSQTI---VEVIQTKFRIIH 2272
            Y+G ++ N  TV + P L A      +  + +ICGF L G     VPF   +LD+ +G G ++ K     D + +  + F ++A+DC   P       SH A V + V  VNEF P+F  + Y  +V +    + ++  V A     +P    + + E L    PF I   G I   + L  + +  +   V A +  K         V I+++P C+     +  +++Y    G   +            P + + +   PL  +   I L++  +++         C  D  + R  R +CGA    +DLL         T G  +H ++  S+     G   ++               +L   FTLS+WMK      +  K +  I C     +D  +  S+ +  C+++     ++ + + V+     E+   ++W  + ++ ++  + L T GIS D +L+     ++ L     +   + +G C  +       +G   +   +             L   S+ + + ++++VIECL  C E +   D  S+    KV+V  + S L L+   +     +   + Y+N    + T  ++        +  +++C S+E  +S+P     +  + P                 +D E      +  +  IT + S  +    +  +        ++ +I   L+ C + L   +L       L  T  T L    LE+ +      I G  S  +YE +LR  +  +        +KF + C+   G Y+S      V V+ +  R+ H
Sbjct:   33 YQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHG---SGVPFEAVILDKATGEGLIRAK--EPVDCEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRIL-RVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADD-AEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALF-----------PGIRLETCDEPLWNIQATIELQTSHVAKG--------CDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALI----HDNGLIHPPRREPALMIGACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFA-TPGVRPLR-----LTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFEGTNGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLLLDT--TSLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYTRKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAH 809          
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN3 (calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371])

HSP 1 Score: 102.064 bits (253), Expect = 3.080e-21
Identity = 168/815 (20.61%), Postives = 319/815 (39.14%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL--------LTEGGIIHINEGDSI-----GPHNIK---------------ALGTDFTLSWWMK------RQSKLKTEIFC----LKDDHNSISILLENCQLS-----IMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQ--FQIVRIFVGGCMRKSAAHTHLRGHKRSPIAK-------------LGVISLATEKPQTQDVIECLSTCGEAIVASD--SIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKET---------GNDTIDVE------IVTNSTITTTKSESIRIFPNFRFISETNAESVAKDI--KLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDER----KKFSIICTLKGGDYTSQTI---VEVIQTKFRIIH 2272
            Y+G ++ N  TV + P L A      +  + +ICGF L G     VPF   +LD+ +G G ++ K     D + +  + F ++A+DC   P       SH A V + V  VNEF P+F  + Y  +V +    + ++  V A     +P    + + E L    PF I   G I   + L  + +  +   V A +  K         V I+++P C+     +  +++Y    G   +            P + + +   PL  +   I L++  +++         C  D  + R  R +CGA    +DLL         T G  +H ++  S+     G   ++               +L   FTLS+WMK      +  K +  I C     +D  +  S+ +  C+++     ++ + + V+     E+   ++W  + ++ ++  + L T GIS D +L+     ++ L     +   + +G C  +       +G   +   +             L   S+ + + ++++VIECL  C E +   D  S+    KV+V  + S L L+   +     +   + Y+N    + T  ++        +  +++C S+E  +S+P     +  + P                 +D E      +  +  IT + S  +    +  +        ++ +I   L+ C + L   +L       L  T  T L    LE+ +      I G  S  +YE +LR  +  +        +KF + C+   G Y+S      V V+ +  R+ H
Sbjct:   33 YQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHG---SGVPFEAVILDKATGEGLIRAK--EPVDCEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRIL-RVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADD-AEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALF-----------PGIRLETCDEPLWNIQATIELQTSHVAKG--------CDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALI----HDNGLIHPPRREPALMIGACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFA-TPGVRPLR-----LTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFEGTNGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLLLDT--TSLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYTRKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAH 809          
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN1 (calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447])

HSP 1 Score: 89.3521 bits (220), Expect = 2.302e-17
Identity = 127/585 (21.71%), Postives = 237/585 (40.51%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKA-----------SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYS-------LQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEG---------DSI----GPHNIK--------ALGTDFTLSWWMKRQ--SKLKTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFF-----TISQQW------IMLSTLGISIDGSLLT--TVSRESNLFQFQI-VRIFVGGCMRK-----------------SAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASDSIATLSKVNVKRNGSSLVL 1630
            Y G +  N  TV + P L A           S    V+K  +ICGF++ G   ++VPF   ++D+ +G G ++ K   + D +L+  Y F ++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V +  + +S++   +    AD   ++S       +  D  +PF + + G I   + L   K+  + + V A +  K    +  VLV I I+P C      + ++++Y    G   +            P + + +   P+  V   + L++  + +         C  D  + +    +CGA   T +LL +  G ++   G         D +    G   ++        +    FT+S WM+     + K  I C  D    + +  S+ +  C+L  +        + P+E+ +    +F         ++W      +   ++ + +DG+     +V+ +  L   +I  ++ VG C ++                 +    H+    R  +A L   +L + K   + VI+CL TC E +       +   V ++ + S LVL
Sbjct:   42 YHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIHG---QNVPFDAVVVDKSTGEGVIRSK--EKLDCELQKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILR--VEAVDADCSPQFSQICSYEIITPD--VPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATED-VLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVF-----------PNIHLETCDEPVASVQATVELETSHIGKG--------CDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLFR------QDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGL---TLRSGKLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVL 588          
BLAST of Calsyntenin 1 vs. Ensembl Human
Match: CLSTN1 (calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447])

HSP 1 Score: 87.4261 bits (215), Expect = 8.728e-17
Identity = 124/575 (21.57%), Postives = 235/575 (40.87%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSK-SEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYS-------LQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEG---------DSI----GPHNIK--------ALGTDFTLSWWMKRQ--SKLKTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFF-----TISQQW------IMLSTLGISIDGSLLT--TVSRESNLFQFQI-VRIFVGGCMRK-----------------SAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASDSIATLSKVNVKRNGSSLVL 1630
            Y G +  N  TV + P L A       + + +ICGF++ G   ++VPF   ++D+ +G G ++ K   + D +L+  Y F ++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V +  + +S++   +    AD   ++S       +  D  +PF + + G I   + L   K+  + + V A +  K    +  VLV I I+P C      + ++++Y    G   +            P + + +   P+  V   + L++  + +         C  D  + +    +CGA   T +LL +  G ++   G         D +    G   ++        +    FT+S WM+     + K  I C  D    + +  S+ +  C+L  +        + P+E+ +    +F         ++W      +   ++ + +DG+     +V+ +  L   +I  ++ VG C ++                 +    H+    R  +A L   +L + K   + VI+CL TC E +       +   V ++ + S LVL
Sbjct:   42 YHGIVTENDNTVLLDPPLIALDKDAPLRFAGEICGFKIHG---QNVPFDAVVVDKSTGEGVIRSK--EKLDCELQKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVIEGKQYDSILR--VEAVDADCSPQFSQICSYEIITPD--VPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATED-VLVKISIKPTCTPGWQGWNNRIEYEPGTGALAVF-----------PNIHLETCDEPVASVQATVELETSHIGKG--------CDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTMGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFLFR------QDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQFFRGNLAGL---TLRSGKLADKKVIDCLYTCKEGLDLQVLEDSGRGVQIQAHPSQLVL 578          
BLAST of Calsyntenin 1 vs. Ensembl Celegans
Match: casy-1 (CAlSYntenin/Alcadein homolog; Calsyntenin [Source:UniProtKB/TrEMBL;Acc:G5ED46])

HSP 1 Score: 68.5514 bits (166), Expect = 2.005e-11
Identity = 91/375 (24.27%), Postives = 163/375 (43.47%), Query Frame = 2
Query:  200 VSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNP----VEYSLQHD-EKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMME--SGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL-------------LTEGGI-IHINEGDSIGPHNIKALGTD-FTLSWWMKRQSKLKTE------IFCLKDDHN----SISILLENCQLSIM 1222
            +S++  +C + L  +  E VPF + ++D+ +G   ++VK +   D + KP Y   V+A  CD+    S G  ++I V   N   P   N  YTF V++      V     +     +P     EY + +  ++LPF I+  GV+     L  T+   +++ VVA + +    K SLV V+++ +  C   +T   ++++Y    G   ++   S +  ++      T+C  P  ++ V   I L++  +++         C  D   +      CG +  T+ LL             L + GI      G ++   N + L  D FTLS+ MK  +  K E      I C  DD N      S+ + +C+L ++
Sbjct:   57 LSETGPVCNYLLTSQNNEPVPFDIQVVDKYTGAAVLRVKDAATLDCK-KPEYNLQVQAVKCDNDNVKSEGVSLKIRVKDTNNHAPEIENPWYTFHVEEGKVVEEVGVLKASDKDCGHPNGEICEYEITNGLKELPFAINNHGVLRTTQPLNFTQSKSYILTVVAIDCAMRKSKSSLVTVHVDEK--CVQGITAMNERVNYAPGVGSKLLLPDVSLEFCEKE-----TICE-PKSVQSV---IELRAGHVTQG--------CARDTVYDNQTIQSCGLSTATVKLLNEEALTSSAENQILADQGIEFDGARGVTVSDENHQGLIPDHFTLSFSMKHAAGTKDEQSNKQNILCESDDFNMNRHHFSVYIRHCKLEVV 411          
BLAST of Calsyntenin 1 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0333700)

HSP 1 Score: 70.4774 bits (171), Expect = 6.133e-12
Identity = 90/391 (23.02%), Postives = 163/391 (41.69%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKS----LADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDI----PANRIQRAICGANPDTIDLLLTEG--GIIHINEGDSI--------------GPHNIKALGTDFTLSWWMKRQSKLKTEIFCLKDDH----NSISILLENCQL 1213
            Y G +  N   V +TP +K +        EKIC F +  +    +PF + L++ L   G ++ + +   +N  +  Y F + A  CD  P  +    + +  VNE+ P F   SY   V +    N ++    +      L  +  +Y + ++++ PF I   G I   + L +    + ++ VVA + +  + + + ++V+I++  VC+ K    P+++DY      +   ES QL        L +C + S   E  LRI   S +L  K  SF    C  DI       +++  +      T +L   EG   I H +    +               P +I  L   F  +  ++    +K  I C  DDH    + +++ + NC+L
Sbjct:   46 YHGLIRENETLVEITPLIKVN-------EEKICNFHILKKPYHEIPFKIELVNNL---GILKARRTLNCEN--RKSYHFEICAIYCDGTPSNTANVHITVIDVNEYAPTFLEPSYVIEVDEGRLYNEILRVEASDKDCTPLFGDVCKYEILNNDE-PFSIDNEGSIKNTEPLSHKASHNHILSVVAYDCA--MKESAPIMVSIKVRRVCETKFVGMPERIDY-----TSGSTESLQLFPNAR---LDLCDI-SCKNEEDLRIH-SSIALKTKHISFG---CDRDISNCTSGQKVKDLLPHGAEWTKELSYDEGLEPIFHFDGSTGVVVPATVIDHYDFSSQPFSILTL---FRHNSQVEINKHVKEHIVCSADDHKMNRHHMALFVRNCRL 405          
BLAST of Calsyntenin 1 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0089207)

HSP 1 Score: 70.4774 bits (171), Expect = 6.731e-12
Identity = 52/222 (23.42%), Postives = 103/222 (46.40%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKS----LADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDY 778
            Y G +  N   V +TP +K +        EKIC F +  +    +PF + L++ L   G ++ + +   +N  +  Y F + A  CD  P  +    + +  VNE+ P F   SY   V +    N ++    +      L  +  +Y + ++++ PF I   G I   + L +    + ++ VVA + +  + + + ++V+I++  VC+ K    P+++DY
Sbjct:   46 YHGLIRENETLVEITPLIKVN-------EEKICNFHILKKPYHEIPFKIELVNNL---GILKARRTLNCEN--RKSYHFEICAIYCDGTPSNTANVHITVIDVNEYAPTFLEPSYVIEVDEGRLYNEILRVEASDKDCTPLFGDVCKYEILNNDE-PFSIDNEGSIKNTEPLSHKASHNHILSVVAYDCA--MKESAPIMVSIKVRRVCETKFVGMPERIDY 252          
BLAST of Calsyntenin 1 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0089208)

HSP 1 Score: 70.4774 bits (171), Expect = 6.731e-12
Identity = 52/222 (23.42%), Postives = 103/222 (46.40%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKS----LADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDY 778
            Y G +  N   V +TP +K +        EKIC F +  +    +PF + L++ L   G ++ + +   +N  +  Y F + A  CD  P  +    + +  VNE+ P F   SY   V +    N ++    +      L  +  +Y + ++++ PF I   G I   + L +    + ++ VVA + +  + + + ++V+I++  VC+ K    P+++DY
Sbjct:   46 YHGLIRENETLVEITPLIKVN-------EEKICNFHILKKPYHEIPFKIELVNNL---GILKARRTLNCEN--RKSYHFEICAIYCDGTPSNTANVHITVIDVNEYAPTFLEPSYVIEVDEGRLYNEILRVEASDKDCTPLFGDVCKYEILNNDE-PFSIDNEGSIKNTEPLSHKASHNHILSVVAYDCA--MKESAPIMVSIKVRRVCETKFVGMPERIDY 252          
BLAST of Calsyntenin 1 vs. Ensembl Fly
Match: Cals (gene:FBgn0039928 transcript:FBtr0345193)

HSP 1 Score: 70.4774 bits (171), Expect = 6.731e-12
Identity = 52/222 (23.42%), Postives = 103/222 (46.40%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKS----LADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDY 778
            Y G +  N   V +TP +K +        EKIC F +  +    +PF + L++ L   G ++ + +   +N  +  Y F + A  CD  P  +    + +  VNE+ P F   SY   V +    N ++    +      L  +  +Y + ++++ PF I   G I   + L +    + ++ VVA + +  + + + ++V+I++  VC+ K    P+++DY
Sbjct:   46 YHGLIRENETLVEITPLIKVN-------EEKICNFHILKKPYHEIPFKIELVNNL---GILKARRTLNCEN--RKSYHFEICAIYCDGTPSNTANVHITVIDVNEYAPTFLEPSYVIEVDEGRLYNEILRVEASDKDCTPLFGDVCKYEILNNDE-PFSIDNEGSIKNTEPLSHKASHNHILSVVAYDCA--MKESAPIMVSIKVRRVCETKFVGMPERIDY 252          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: clstn1 (calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1064])

HSP 1 Score: 119.783 bits (299), Expect = 5.853e-27
Identity = 185/805 (22.98%), Postives = 325/805 (40.37%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG-------GIIHINEGDSI------GPHNIK--------ALGTDFTLSWWMKR--QSKLKTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFFTI-SQQW------IMLSTLGISIDGSLLTT--VSRESNLFQFQI-VRIFVGGCMRKSAAHT--HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS---------------------ETNAESVAKD---IKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLL-----RHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVAN 2281
            T Y G +  N   V + P L A      +  + +ICGF + G   ++VPF   +LD+ +G G ++ K  ++ D +L+  + F ++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V +  K +S++   +    AD   ++S     ++     PF I + G I   + L   K+  + + V A +  K    +  VLV I I+P C+     F  +++Y    G   +            P + + +   P+  +   I L+++ + +         C  D  + +    +CGA+  T++LL           G+   N  DS       G   IK         L   FT+S WM+     + K  I C  D    + +  S+ + NC+L ++  L+    E  + K     W+   +  ++W      I    + + +DG       V+ +  L   +I  ++ +G C +  +A      RG+       L  + + + K + + VI+CL TC E   +   + +A+  KV    N SSL L+   I         I Y+N+     T  I+        +  +++C ++E  ISVP +   +  + P+ E       ++            E + +FP  R +S                      T  E+V  +     L+TC V +   +L  +    L   L  I   A LE+ S+     I G  +   YE +L     R+   + + +R KF ++C+   G Y S       + +  +IH AN
Sbjct:   37 TTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHG---QNVPFEAVVLDKSTGEGVIRAK--DKLDCELQKEHTFTIQAYDCGEGPDGGNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDSIMK--VEAVDADCSFQFSQICSYEIVTPDVPFTIDKDGNIKNTEKLNYGKERMYKLTVTAYDCGKNRASED-VLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALF-----------PSMHLETCEEPITSIQASIMLETNHIGKG--------CDRDTYSEKSLHKLCGASSGTVELLPAPSNSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTTLKEPFTISVWMRHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLL--LRQEPTESESYKPAEFHWKLDQVCDKEWHHYVLNIEFPAVTLFVDGGTFEPFLVTEDYPLHTSKIETQLTIGACWQGGSARMTQFFRGN-------LAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLSLEGDDIESFEKVMQHISYLNS-RQFPTPGIRHLR-----VSTTVKCFNEETCISVPDSEGYVMVLQPE-EPKISLSGIDHFARGAAEFESVEGVTLFPELRIVSTITREVEVEAEAETEAEGEDDPTVQETVVSEEIMHNLDTCEVTVVGEDLNGDHE-SLEVDLAQIQQRA-LEMSSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFDR-KFKLVCSELNGRYISNE----FKVEVNVIHTAN 791          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: clstn1 (calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1064])

HSP 1 Score: 119.398 bits (298), Expect = 6.856e-27
Identity = 187/815 (22.94%), Postives = 327/815 (40.12%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-----------SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG-------GIIHINEGDSI------GPHNIK--------ALGTDFTLSWWMKR--QSKLKTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFFTI-SQQW------IMLSTLGISIDGSLLTT--VSRESNLFQFQI-VRIFVGGCMRKSAAHT--HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS---------------------ETNAESVAKD---IKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLL-----RHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVAN 2281
            T Y G +  N   V + P L A           S     +K  +ICGF + G   ++VPF   +LD+ +G G ++ K  ++ D +L+  + F ++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V +  K +S++   +    AD   ++S     ++     PF I + G I   + L   K+  + + V A +  K    +  VLV I I+P C+     F  +++Y    G   +            P + + +   P+  +   I L+++ + +         C  D  + +    +CGA+  T++LL           G+   N  DS       G   IK         L   FT+S WM+     + K  I C  D    + +  S+ + NC+L ++  L+    E  + K     W+   +  ++W      I    + + +DG       V+ +  L   +I  ++ +G C +  +A      RG+       L  + + + K + + VI+CL TC E   +   + +A+  KV    N SSL L+   I         I Y+N+     T  I+      + +  +++C ++E  ISVP +   +  + P+ E       ++            E + +FP  R +S                      T  E+V  +     L+TC V +   +L  +    L   L  I   A LE+ S+     I G  +   YE +L     R+   + + +R KF ++C+   G Y S       + +  +IH AN
Sbjct:   37 TTYHGIVTENDDKVLLDPPLIALDKDAPLRYAESFEVTFTKEGEICGFRIHG---QNVPFEAVVLDKSTGEGVIRAK--DKLDCELQKEHTFTIQAYDCGEGPDGGNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDSIMK--VEAVDADCSFQFSQICSYEIVTPDVPFTIDKDGNIKNTEKLNYGKERMYKLTVTAYDCGKNRASED-VLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALF-----------PSMHLETCEEPITSIQASIMLETNHIGKG--------CDRDTYSEKSLHKLCGASSGTVELLPAPSNSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTTLKEPFTISVWMRHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLL--LRQEPTESESYKPAEFHWKLDQVCDKEWHHYVLNIEFPAVTLFVDGGTFEPFLVTEDYPLHTSKIETQLTIGACWQGGSARMTQFFRGN-------LAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLSLEGDDIESFEKVMQHISYLNS-RQFPTPGIR-----HLRVSTTVKCFNEETCISVPDSEGYVMVLQPE-EPKISLSGIDHFARGAAEFESVEGVTLFPELRIVSTITREVEVEAEAETEAEGEDDPTVQETVVSEEIMHNLDTCEVTVVGEDLNGDHE-SLEVDLAQIQQRA-LEMSSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFDR-KFKLVCSELNGRYISNE----FKVEVNVIHTAN 801          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: clstn1 (calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1064])

HSP 1 Score: 117.472 bits (293), Expect = 2.948e-26
Identity = 184/815 (22.58%), Postives = 325/815 (39.88%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG-------GIIHINEGDSI------GPHNIK--------ALGTDFTLSWWMKR--QSKLKTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFFTI-SQQW------IMLSTLGISIDGSLLTT--VSRESNLFQFQI-VRIFVGGCMRKSAAHTHLRGHKRSPI------------AKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS---------------------ETNAESVAKD---IKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLL-----RHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVAN 2281
            T Y G +  N   V + P L A      +  + +ICGF + G   ++VPF   +LD+ +G G ++ K  ++ D +L+  + F ++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V +  K +S++   +    AD   ++S     ++     PF I + G I   + L   K+  + + V A +  K    +  VLV I I+P C+     F  +++Y    G   +            P + + +   P+  +   I L+++ + +         C  D  + +    +CGA+  T++LL           G+   N  DS       G   IK         L   FT+S WM+     + K  I C  D    + +  S+ + NC+L ++  L+    E  + K     W+   +  ++W      I    + + +DG       V+ +  L   +I  ++ +G C +  + H +       P+              L  + + + K + + VI+CL TC E   +   + +A+  KV    N SSL L+   I         I Y+N+     T  I+        +  +++C ++E  ISVP +   +  + P+ E       ++            E + +FP  R +S                      T  E+V  +     L+TC V +   +L  +    L   L  I   A LE+ S+     I G  +   YE +L     R+   + + +R KF ++C+   G Y S       + +  +IH AN
Sbjct:   37 TTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHG---QNVPFEAVVLDKSTGEGVIRAK--DKLDCELQKEHTFTIQAYDCGEGPDGGNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDSIMK--VEAVDADCSFQFSQICSYEIVTPDVPFTIDKDGNIKNTEKLNYGKERMYKLTVTAYDCGKNRASED-VLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALF-----------PSMHLETCEEPITSIQASIMLETNHIGKG--------CDRDTYSEKSLHKLCGASSGTVELLPAPSNSANWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTTLKEPFTISVWMRHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLL--LRQEPTESESYKPAEFHWKLDQVCDKEWHHYVLNIEFPAVTLFVDGGTFEPFLVTEDYPLHTSKIETQLTIGACWQDFSGHDNDTETLSEPLTGGSARMTQFFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLSLEGDDIESFEKVMQHISYLNS-RQFPTPGIRHLR-----VSTTVKCFNEETCISVPDSEGYVMVLQPE-EPKISLSGIDHFARGAAEFESVEGVTLFPELRIVSTITREVEVEAEAETEAEGEDDPTVQETVVSEEIMHNLDTCEVTVVGEDLNGDHE-SLEVDLAQIQQRA-LEMSSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFDR-KFKLVCSELNGRYISNE----FKVEVNVIHTAN 808          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: clstn2 (calsyntenin 2 [Source:ZFIN;Acc:ZDB-GENE-070911-2])

HSP 1 Score: 103.99 bits (258), Expect = 4.533e-22
Identity = 141/588 (23.98%), Postives = 249/588 (42.35%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG----IIHINEG-------DSIGPHNIKALGTDFTLSWWMKR--QSKLKTE---IFCLKD----DHNSISILLENCQLSI--------MNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQFQI-VRIFVGGCMRKSAAHT-----HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVAS--DSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINN 1690
            T Y G +  N  TV + P L A      V  + +IC F++ G   +  PF   +L+  SG G ++ +     D + +  Y F ++A+DC + P+      SH A V I V  VNEF P+F    Y  +V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +    +S V V+I+++PVC+     +  ++DY    G      S QL  + H   L  C    PL  V   + L++  + +         C  +  + +  + +CGA   + DL             LLT+ G    +I   +G       D + P N   L   FT++ WMK      L+ E   + C  D    + +  S+ + NC+L          +++ +  +     E+    +W ++ I+ ++  + L   G++ +  L+T    +  +   +I V++ VG C +     T     + RG        L  +++   K  TQ VI CL  C E +  S  +S+    K +     S LV+++  +  +  + TK+ YIN+
Sbjct:   34 TSYHGVITENMDTVMLDPPLVALDKDAPVPYAGEICAFKIHG---QEAPFEAEVLNRTSGEGVLRAR--GPIDCEQQKEYTFIIQAYDCGASPNGADWKKSHKAVVHIQVDDVNEFSPVFREPLYRATVTEGKIYDSILQ--VEAWDQDCSPQYSQICNYEIVTQDTPFAIDRNGNIRNTERLSFDKQQHYKIMVTAYDCGQKRAMES-VPVHIDVKPVCKPGWQGWNKRVDYEPGTG------SKQLFPKMH---LETCD--GPLSSVRAMVELQTSHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLPAPSTSTNWTASLLTDSGRDSDLIFRFDGRQAANIPDWVVPQN---LTDQFTIATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFIQLDSFRPAEFHWRLEQICDKEWHYYVINVEFPSVTLFVDGVTYEPYLVTD---DWPIHPSEIDVQLTVGACWQGGEVTTPRFTQYFRG-------SLSGLTIRPGKIATQKVISCLQACKEGLDISSLESLGKGIKFHFNPAQSVLVMEADDLESINTAMTKVSYINS 581          
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Match: si:ch211-276c2.2 (si:ch211-276c2.2 [Source:ZFIN;Acc:ZDB-GENE-121214-77])

HSP 1 Score: 101.679 bits (252), Expect = 2.262e-21
Identity = 170/777 (21.88%), Postives = 309/777 (39.77%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG---GIIHINEG-------DSIGPHNIKALGTDFTLSWWMKR-----QSKLKTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLT---TVSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRI-----------FPNFRFISE-------TNAE--SVAKDIK--LETCTVRLFQRNLVAN-ERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVD---MIDERKKFSIICTLKGGDYTS 2227
            T Y G +  N+  V + P L A      V  + +ICGF ++G    S PF   LL+  SG G ++ +     D +    + F ++A DC + P       SH A VR+ V  VNEF P+F    Y  SV +    +S++   +  S  D   +YS   + ++      F + + G I   +SL   K+S + IRV A +  +    Q   +V+I ++P+C+     +   +DY    G      S  L  + H   L  C         T+ +               ++ C +   +  +  A  G    T+ L+   G    + +  +G       D + P N   L   FT++ WMK      Q   K  + C  D    + +  S+ + NC+L  +        ++ +  +     E+    +W ++ +S  +  + L   G++ +  L+T    +       Q  +   + GG + K+    + RG        L  +++   K ++Q +I CL  C E   I + +++    K ++    S LV++++ + Q+  +  K+ YIN      +          + I  +++C  +++ ISVP   + +  + P              + + IT T +E + I           F +   IS        TN +  S AK+    L+ C + +    L A  E + L  + L       LE  ++    +I G  S   Y  ++R V+      +D  + F + C+   G YTS
Sbjct:   31 TSYHGVITENTDEVLLDPPLVALDKDAPVPYAGEICGFHVQGL---SAPFEAVLLNGTSGEGRLRAR--GPIDCERHREFSFIIQAHDCGTGPQGHGQKRSHKAAVRVQVGDVNEFSPVFGQLEYHGSVTEGKVYDSILQ--VQASDQDCSPQYSQICNYQITSPDTAFAVDRNGNIRNTESLSFEKKSHYKIRVTALDCGQKRAMQE-AIVHIHVKPICKPGWQGWRKLVDYEPGAG------SKLLFPKMH---LETCEGSVSWIRTTVELETSGVGRGCDSERSLQKLCGSSSGSTALLPATGGVCNWTVTLVRDSGRDSDLAYRFDGHQAAKIPDWVVPQN---LTDQFTITTWMKHGPSPGQRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRTDYTQTDSFRPAEFHWKLEQICDKEWHYYVLSVDFPVVTLYVDGVTYEPYLVTDDWPIHSSQIDVQLTVGACWQGGEVSKAKFSQYFRG-------SLSGLTIRPGKIESQKIISCLQACKEGLDITSLENLGQRIKFHLNPAQSVLVMEAEDLEQMNGALRKVSYIN------SRQFPTMGSRHLRISTAVQCFGEDVCISVPDIEVVVMVMQP--------------SEARITITGAEHLTIPAYDLALGLSLFRDLHIISTVTKRDKVTNMDHRSSAKETAHNLDYCDILVLGEELRAGLESLELHHSALL---GKHLEYANSSTGMSIYGVDSISHYTEVIRQVRYQSRRAVDSVRTFRLTCSELNGRYTS 757          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 133.265 bits (334), Expect = 5.084e-31
Identity = 181/815 (22.21%), Postives = 354/815 (43.44%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG-----IIHINEGDSIG-PHNIKALGTD--FTLSWWMKRQS--KLKTEIFC-------LKDDHNSISILLENCQLS-IMNNLQNVQIEIPTE-KCQINK-----WQFFTISQQWIMLSTLGISIDGSLL--TTVSRESNLFQFQIV-RIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIV--ASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSES---IRIFPNFRFIS------ETNAES-------VAKDI--KLETCTVRLFQRNL-VANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQ------VDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVANN-ENPLNDLAHHQ 2317
            T Y G +  N   V + P L A      +  + +ICGF++     + VPF   ++D  +G G   ++ + + D +++  Y F+++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V++  K ++++   +    AD   ++S     ++     PF I + G I   + LI  K+  + + V A +  K    +  +LV + ++P C+     +  +++Y   +G  ++            P + + +   P+  +T  + L++  + +         C  D  + +    +CG++ D ++L             L T+ G     +   N   ++  P     L  D  F +S WM+  +  K K  + C       L+   +   + + NC+L  +++ + + +I  P E   ++N+     W  + ++   + L+T+ + +DG L   + V+ +  +  + I  ++ VG C   S+    L          L  + + + K + + VI+CL TC E +     D I    K+N+  + S + L+   I +   +  ++ Y+N+     T  ++ F      I  S+ C ++E  I++P     I  + P++      I ++ + +   + ++ ES   + +FP    IS      E++ E        V+++I   L+TC V +    L    E + L    +T L   ++EI S+ Y  ++ G  S E YE LL  ++      V + D  +KF +IC+   G Y S         +  +IH A++ E P + +A  Q
Sbjct:   27 TAYHGIVTENDNAVLLDPPLIALDKDSPLQYAGEICGFKIHD---QDVPFEALVVDRSTGEG--LIRSTKQLDCEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVREGKKYDNILR--VEAVDADCSPQFSQICSYEIVTPDVPFTIDKDGFIKNTEKLIYEKEHQYKLTVTAYDCGKKRAAED-ILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF-----------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLPSPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLNFDEPFVISVWMRHGTGGKEKESVLCFSGKTGILEISQHHYFLYIHNCKLGFLLHQVASEEIYKPAEFNWKLNQACDKEWHHYVLN---VELTTVTLYVDGVLFEPSAVTEDYPMHPYPIYSQLVVGACWEDSSDQATLFH------GNLAGLMIHSGKLENKKVIDCLYTCKEGLELHTVDGIGEAVKINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNS-RQFPTPGMRRF-----TITTSVRCFNEETCITIPDVEGYIIVLQPEEP----RISIKGIDHFARSASEFESNGGVPLFPELHIISTITREIESDGEDPTVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLD---VTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD--RKFKLICSELNGRYISNE----FHVEVNVIHTASHVEVPNHIMAQPQ 786          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 131.339 bits (329), Expect = 2.136e-30
Identity = 179/812 (22.04%), Postives = 351/812 (43.23%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG-----IIHINEGDSIG-PHNIKALGTD--FTLSWWMKRQS--KLKTEIFCLKD----DHNSISILLENCQLS-IMNNLQNVQIEIPTE-KCQINK-----WQFFTISQQWIMLSTLGISIDGSLL--TTVSRESNLFQFQIV-RIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIV--ASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSES---IRIFPNFRFIS------ETNAES-------VAKDI--KLETCTVRLFQRNL-VANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQ------VDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVANN-ENPLNDLAHHQ 2317
            T Y G +  N   V + P L A      +  + +ICGF++     + VPF   ++D  +G G   ++ + + D +++  Y F+++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V++  K ++++   +    AD   ++S     ++     PF I + G I   + LI  K+  + + V A +  K    +  +LV + ++P C+     +  +++Y   +G  ++            P + + +   P+  +T  + L++  + +         C  D  + +    +CG++ D ++L             L T+ G     +   N   ++  P     L  D  F +S WM+  +  K K  + C         +   + + NC+L  +++ + + +I  P E   ++N+     W  + ++   + L+T+ + +DG L   + V+ +  +  + I  ++ VG C          R   +     L  + + + K + + VI+CL TC E +     D I    K+N+  + S + L+   I +   +  ++ Y+N+     T  ++ F      I  S+ C ++E  I++P     I  + P++      I ++ + +   + ++ ES   + +FP    IS      E++ E        V+++I   L+TC V +    L    E + L    +T L   ++EI S+ Y  ++ G  S E YE LL  ++      V + D  +KF +IC+   G Y S         +  +IH A++ E P + +A  Q
Sbjct:   86 TAYHGIVTENDNAVLLDPPLIALDKDSPLQYAGEICGFKIHD---QDVPFEALVVDRSTGEG--LIRSTKQLDCEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVREGKKYDNILR--VEAVDADCSPQFSQICSYEIVTPDVPFTIDKDGFIKNTEKLIYEKEHQYKLTVTAYDCGKKRAAED-ILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF-----------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLPSPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLNFDEPFVISVWMRHGTGGKEKESVLCFSGKTEISQHHYFLYIHNCKLGFLLHQVASEEIYKPAEFNWKLNQACDKEWHHYVLN---VELTTVTLYVDGVLFEPSAVTEDYPMHPYPIYSQLVVGACWEGDE-----RQMGQFFSGNLAGLMIHSGKLENKKVIDCLYTCKEGLELHTVDGIGEAVKINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNS-RQFPTPGMRRF-----TITTSVRCFNEETCITIPDVEGYIIVLQPEEP----RISIKGIDHFARSASEFESNGGVPLFPELHIISTITREIESDGEDPTVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLD---VTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD--RKFKLICSELNGRYISNE----FHVEVNVIHTASHVEVPNHIMAQPQ 843          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 130.954 bits (328), Expect = 2.784e-30
Identity = 182/819 (22.22%), Postives = 356/819 (43.47%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG-----IIHINEGDSIG-PHNIKALGTD--FTLSWWMKRQS--KLKTEIFC-------LKDDHNSISILLENCQLS-IMNNLQNVQIEIPTE-KCQINK-----WQFFTISQQWIMLSTLGISIDGSLL--TTVSRESNLFQFQIV-RIFVGGCMRKSAAHTHLRGHKRSP----IAKLGVISLATEKPQTQDVIECLSTCGEAIV--ASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSES---IRIFPNFRFIS------ETNAES-------VAKDI--KLETCTVRLFQRNL-VANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQ------VDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVANN-ENPLNDLAHHQ 2317
            T Y G +  N   V + P L A      +  + +ICGF++     + VPF   ++D  +G G   ++ + + D +++  Y F+++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V++  K ++++   +    AD   ++S     ++     PF I + G I   + LI  K+  + + V A +  K    +  +LV + ++P C+     +  +++Y   +G  ++            P + + +   P+  +T  + L++  + +         C  D  + +    +CG++ D ++L             L T+ G     +   N   ++  P     L  D  F +S WM+  +  K K  + C       L+   +   + + NC+L  +++ + + +I  P E   ++N+     W  + ++   + L+T+ + +DG L   + V+ +  +  + I  ++ VG C   + A     G +R         L  + + + K + + VI+CL TC E +     D I    K+N+  + S + L+   I +   +  ++ Y+N+     T  ++ F      I  S+ C ++E  I++P     I  + P++      I ++ + +   + ++ ES   + +FP    IS      E++ E        V+++I   L+TC V +    L    E + L    +T L   ++EI S+ Y  ++ G  S E YE LL  ++      V + D  +KF +IC+   G Y S         +  +IH A++ E P + +A  Q
Sbjct:   27 TAYHGIVTENDNAVLLDPPLIALDKDSPLQYAGEICGFKIHD---QDVPFEALVVDRSTGEG--LIRSTKQLDCEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVREGKKYDNILR--VEAVDADCSPQFSQICSYEIVTPDVPFTIDKDGFIKNTEKLIYEKEHQYKLTVTAYDCGKKRAAED-ILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF-----------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLPSPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLNFDEPFVISVWMRHGTGGKEKESVLCFSGKTGILEISQHHYFLYIHNCKLGFLLHQVASEEIYKPAEFNWKLNQACDKEWHHYVLN---VELTTVTLYVDGVLFEPSAVTEDYPMHPYPIYSQLVVGACWEANKA-CKKSGDERQMGQFFSGNLAGLMIHSGKLENKKVIDCLYTCKEGLELHTVDGIGEAVKINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNS-RQFPTPGMRRF-----TITTSVRCFNEETCITIPDVEGYIIVLQPEEP----RISIKGIDHFARSASEFESNGGVPLFPELHIISTITREIESDGEDPTVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLD---VTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD--RKFKLICSELNGRYISNE----FHVEVNVIHTASHVEVPNHIMAQPQ 795          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 129.028 bits (323), Expect = 1.038e-29
Identity = 179/814 (21.99%), Postives = 351/814 (43.12%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-----SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG-----IIHINEGDSIG-PHNIKALGTD--FTLSWWMKRQS--KLKTEIFCLKD----DHNSISILLENCQLS-IMNNLQNVQIEIPTE-KCQINK-----WQFFTISQQWIMLSTLGISIDGSLL--TTVSRESNLFQFQIV-RIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSES---IRIFPNFRFIS------ETNAES-------VAKDI--KLETCTVRLFQRNL-VANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQ------VDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVANN-ENPLNDLAHHQ 2317
            T Y G +  N   V + P L A      +   V    +ICGF++     + VPF   ++D  +G G   ++ + + D +++  Y F+++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V++  K ++++   +    AD   ++S     ++     PF I + G I   + LI  K+  + + V A +  K    +  +LV + ++P C+     +  +++Y   +G  ++            P + + +   P+  +T  + L++  + +         C  D  + +    +CG++ D ++L             L T+ G     +   N   ++  P     L  D  F +S WM+  +  K K  + C         +   + + NC+L  +++ + + +I  P E   ++N+     W  + ++   + L+T+ + +DG L   + V+ +  +  + I  ++ VG C          R   +     L  + + + K + + VI+CL TC E +    S+  L  +N+  + S + L+   I +   +  ++ Y+N+     T  ++ F      I  S+ C ++E  I++P     I  + P++      I ++ + +   + ++ ES   + +FP    IS      E++ E        V+++I   L+TC V +    L    E + L    +T L   ++EI S+ Y  ++ G  S E YE LL  ++      V + D  +KF +IC+   G Y S         +  +IH A++ E P + +A  Q
Sbjct:   27 TAYHGIVTENDNAVLLDPPLIALDKDSPLQYAVFNLSEICGFKIHD---QDVPFEALVVDRSTGEG--LIRSTKQLDCEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVREGKKYDNILR--VEAVDADCSPQFSQICSYEIVTPDVPFTIDKDGFIKNTEKLIYEKEHQYKLTVTAYDCGKKRAAED-ILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF-----------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLPSPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLNFDEPFVISVWMRHGTGGKEKESVLCFSGKTEISQHHYFLYIHNCKLGFLLHQVASEEIYKPAEFNWKLNQACDKEWHHYVLN---VELTTVTLYVDGVLFEPSAVTEDYPMHPYPIYSQLVVGACWEGDE-----RQMGQFFSGNLAGLMIHSGKLENKKVIDCLYTCKEGLELHTSLDNLC-INLNTSRSDVTLEGNEIDKCDQAMQQVSYVNS-RQFPTPGMRRF-----TITTSVRCFNEETCITIPDVEGYIIVLQPEEP----RISIKGIDHFARSASEFESNGGVPLFPELHIISTITREIESDGEDPTVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLD---VTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD--RKFKLICSELNGRYISNE----FHVEVNVIHTASHVEVPNHIMAQPQ 785          
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Match: CLSTN1 (calsyntenin 3 [Source:NCBI gene;Acc:100145668])

HSP 1 Score: 126.716 bits (317), Expect = 5.101e-29
Identity = 179/822 (21.78%), Postives = 351/822 (42.70%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG-----IIHINEGDSIG-PHNIKALGTD--FTLSWWMKRQS--KLKTEIFCLKD----DHNSISILLENCQLS-IMNNLQNVQIEIPTE-KCQINK-----WQFFTISQQWIMLSTLGISIDGSLL--TTVSRESNLFQFQIV-RIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIV--ASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSES---IRIFPNFRFIS------ETNAES-----------------VAKDI--KLETCTVRLFQRNL-VANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQ------VDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVANN-ENPLNDLAHHQ 2317
            T Y G +  N   V + P L A      +  + +ICGF++     + VPF   ++D  +G G   ++ + + D +++  Y F+++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V++  K ++++   +    AD   ++S     ++     PF I + G I   + LI  K+  + + V A +  K    +  +LV + ++P C+     +  +++Y   +G  ++            P + + +   P+  +T  + L++  + +         C  D  + +    +CG++ D ++L             L T+ G     +   N   ++  P     L  D  F +S WM+  +  K K  + C         +   + + NC+L  +++ + + +I  P E   ++N+     W  + ++   + L+T+ + +DG L   + V+ +  +  + I  ++ VG C          R   +     L  + + + K + + VI+CL TC E +     D I    K+N+  + S + L+   I +   +  ++ Y+N+     T  ++ F      I  S+ C ++E  I++P     I  + P++      I ++ + +   + ++ ES   + +FP    IS      E++ E                  V+++I   L+TC V +    L    E + L    +T L   ++EI S+ Y  ++ G  S E YE LL  ++      V + D  +KF +IC+   G Y S         +  +IH A++ E P + +A  Q
Sbjct:   27 TAYHGIVTENDNAVLLDPPLIALDKDSPLQYAGEICGFKIHD---QDVPFEALVVDRSTGEG--LIRSTKQLDCEIQKDYTFSIQAYDCGKGPDSSSVKKSHKASVHIQVNDVNEYAPVFKEKSYKVTVREGKKYDNILR--VEAVDADCSPQFSQICSYEIVTPDVPFTIDKDGFIKNTEKLIYEKEHQYKLTVTAYDCGKKRAAED-ILVKVSVKPTCKVSWQGWNKRIEYEPGSGSLSLF-----------PGMHLETCDEPITSITAHVQLETSHIGKG--------CDRDTYSEKSIHKLCGSSSDVVELLPSPSMTTNWTLGLPTDNGHESDQVFEFNGTQAVKIPDEFVTLNFDEPFVISVWMRHGTGGKEKESVLCFSGKTEISQHHYFLYIHNCKLGFLLHQVASEEIYKPAEFNWKLNQACDKEWHHYVLN---VELTTVTLYVDGVLFEPSAVTEDYPMHPYPIYSQLVVGACWEGDE-----RQMGQFFSGNLAGLMIHSGKLENKKVIDCLYTCKEGLELHTVDGIGEAVKINLNTSRSDVTLEGNEIDKCDQAMQQVSYVNS-RQFPTPGMRRF-----TITTSVRCFNEETCITIPDVEGYIIVLQPEEP----RISIKGIDHFARSASEFESNGGVPLFPELHIISTITREIESDGEDPTELSGYDDPCCVQESLVSEEIVHDLDTCEVVVMGEELNPGEESLQLD---VTHLQQTRIEISSSNYGISLTGIDSMENYEELLHLIRYRNWNTVSLFD--RKFKLICSELNGRYISNE----FHVEVNVIHTASHVEVPNHIMAQPQ 794          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn2 (calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897])

HSP 1 Score: 105.531 bits (262), Expect = 1.588e-22
Identity = 170/789 (21.55%), Postives = 311/789 (39.42%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEG---------------------DSIGPHNIKALGTDFTLSWWMKRQSKL-----KTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTT---VSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRA---IMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIR---IFPNFRFISETNAESVAKDIK-----------------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMID----ERKKFSIICTLKGGDYTS 2227
            T Y G +  N+ TV + P L A      V  + +IC F++ G   + +PF   +L++ SG G ++ K  +  D +L+  Y F ++A+DC + P       SH A V I V  VNEF P F   +Y   V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +  P     LV ++++PVC+    D+  +++Y   +G   +  S           L  C       +VT          +E   ++  + C  +  + +  + +CGA+   IDLL +     +   G                     D I P N   L   FT++ WMK          K  I C  D    + +  ++ + NC+L  +        +  +  +     ++    +W ++ I+ ++  + L   G + +  L+T    +       Q  +   + GG + K        G        L  +++   K ++Q VI CL  C E   I + +S+    K +   + S LV++   I  +  +  K+ YIN+     T  ++    S       ++C  +++ IS+P     IM +  I PQ       I ++          + ES R   +FP+ + +S       + D++                 L+ C + +   +L  + R        + L+   L+  ++   ++I G  S   YE +L H++         E ++F I C+   G YTS
Sbjct:   48 TSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHG---QELPFEAVVLNKTSGEGRLRAK--SPIDCELQKEYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDSILQ--VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQK-PAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIH---------LETCDGAVSSLQVT----------AELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKN---LTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHG-------SLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS-RQFPTAGVRRLRLSS-----KVQCFGEDVCISIPDVDAYIMVLQAIEPQ-------ITLQGTERFWRPAAQFESARGVTLFPDIKIVSTFAKTEASGDMRATGTAPKSAVLEEMLHNLDFCDILVLGGDL--DPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMNRYEQVLHHLRYRNWHPTSLETRRFRIKCSELNGRYTS 784          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn2 (calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897])

HSP 1 Score: 105.145 bits (261), Expect = 1.894e-22
Identity = 170/789 (21.55%), Postives = 311/789 (39.42%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEG---------------------DSIGPHNIKALGTDFTLSWWMKRQSKL-----KTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTT---VSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRA---IMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIR---IFPNFRFISETNAESVAKDIK-----------------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMID----ERKKFSIICTLKGGDYTS 2227
            T Y G +  N+ TV + P L A      V  + +IC F++ G   + +PF   +L++ SG G ++ K  +  D +L+  Y F ++A+DC + P       SH A V I V  VNEF P F   +Y   V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +  P     LV ++++PVC+    D+  +++Y   +G   +  S           L  C       +VT          +E   ++  + C  +  + +  + +CGA+   IDLL +     +   G                     D I P N   L   FT++ WMK          K  I C  D    + +  ++ + NC+L  +        +  +  +     ++    +W ++ I+ ++  + L   G + +  L+T    +       Q  +   + GG + K        G        L  +++   K ++Q VI CL  C E   I + +S+    K +   + S LV++   I  +  +  K+ YIN+     T  ++    S       ++C  +++ IS+P     IM +  I PQ       I ++          + ES R   +FP+ + +S       + D++                 L+ C + +   +L  + R        + L+   L+  ++   ++I G  S   YE +L H++         E ++F I C+   G YTS
Sbjct:   48 TSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHG---QELPFEAVVLNKTSGEGRLRAK--SPIDCELQKEYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDSILQ--VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQK-PAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIH---------LETCDGAVSSLQVT----------AELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKN---LTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHG-------SLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS-RQFPTAGVRRLRLSS-----KVQCFGEDVCISIPDVDAYIMVLQAIEPQ-------ITLQGTERFWRPAAQFESARGVTLFPDIKIVSTFAKTEASGDMRATGTAPKSAVLEEMLHNLDFCDILVLGGDL--DPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMNRYEQVLHHLRYRNWHPTSLETRRFRIKCSELNGRYTS 784          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn3 (calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323])

HSP 1 Score: 105.145 bits (261), Expect = 2.116e-22
Identity = 172/823 (20.90%), Postives = 322/823 (39.13%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL--------LTEGGIIHINEGDSI---------------GPHNIKALGTD-----FTLSWWMKRQ---SKLKTE---IFC----LKDDHNSISILLENCQLS-----IMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQ--FQIVRIFVGGCMRKSAAHTHLRGHKRSPIAK-------------LGVISLATEKPQTQDVIECLSTCGEAIVASD--SIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTK-------SESIRIFPNFRFISETNAESVAK----------DIK--------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDE----RKKFSIICTLKGGDYTSQTI---VEVIQTKFRIIH 2272
            Y+G ++ N  TV + P L A      +  + +ICGF L G     VPF   +LD+ +G G ++ K     D + +  + F ++A+DC   P       SH A V + V  VNEF P+F  + Y  +V +    + ++  V A     +P    + + E L    PF I   G I   + L  + +  +   V A +  K         V I+++P C+     +  +++Y    G   +            P + + +   PL  +   I L++  +++         C  D  + R  R +CGA    +DLL         T G  +H ++  S+               GP  + +   D     FTLS+WMK     SK K E   I C     +D ++  S+ +  C+++     ++ + + V+     E+   ++W  + ++ ++  + L T GIS D +L+     ++ L     +   + +G C  +        G   +  A              L   S+ + + ++++VIECL  C E +   D  S+    KV+V  + S L L+   +     +   + Y+N    + T  ++        +  +++C S+E  +S+P     +  + P           +I+ + T    +        E + +FP+ +     + +  AK          D +        L+ C + L   +L       L    +  L    LE+ +      I G  +  +YE +LR  +  +        +KF + C+   G Y+S      V V+ +  R+ H
Sbjct:   33 YQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHG---SGVPFEAVILDKATGEGLIRAK--EPVDCEAQKEHTFTIQAYDCGEGPDGTNTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRIL-RVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCGKKRAADD-AEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALF-----------PGIRLETCDEPLWNIQATIELQTSHVAKG--------CDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPAGLGSGPQDGFSDHFTLSFWMKHSVTPSKGKKEEETIVCNTVQNEDGYSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALI----HDNGLIHPPRREPALMIGACWTEEKNKEKKGGENSTDTASGDPLLIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFA-TPGVRPLR-----LTTAVKCFSEESCVSIPEVEGYVVVLQPDAP--------QILLSGTAHFARPAVDFEGPEGVPLFPDLQITCSISHQVEAKADESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLL--LDMASLQQRGLELTNTSAYLTIAGVETITVYEEILRQARYQLRHGAALYARKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAH 809          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn3 (calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323])

HSP 1 Score: 100.138 bits (248), Expect = 8.037e-21
Identity = 170/818 (20.78%), Postives = 318/818 (38.88%), Query Frame = 2
Query:  140 LSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL--------LTEGGIIHINEGDSI---------------GPHNIKALGTD-----FTLSWWMKRQ---SKLKTE---IFC----LKDDHNSISILLENCQLS-----IMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQ--FQIVRIFVGGCMRKSAAHTHLRGHKRSPIAK-------------LGVISLATEKPQTQDVIECLSTCGEAIVASD--SIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTK-------SESIRIFPNFRFISETNAESVAK----------DIK--------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDE----RKKFSIICTLKGGDYTSQTI---VEVIQTKFRIIH 2272
            + N  TV + P L A      +  + +ICGF L G     VPF   +LD+ +G G ++ K     D + +  + F ++A+DC   P       SH A V + V  VNEF P+F  + Y  +V +    + ++  V A     +P    + + E L    PF I   G I   + L  + +  +   V A +  K         V I+++P C+     +  +++Y    G   +            P + + +   PL  +   I L++  +++         C  D  + R  R +CGA    +DLL         T G  +H ++  S+               GP  + +   D     FTLS+WMK     SK K E   I C     +D ++  S+ +  C+++     ++ + + V+     E+   ++W  + ++ ++  + L T GIS D +L+     ++ L     +   + +G C  +        G   +  A              L   S+ + + ++++VIECL  C E +   D  S+    KV+V  + S L L+   +     +   + Y+N    + T  ++        +  +++C S+E  +S+P     +  + P           +I+ + T    +        E + +FP+ +     + +  AK          D +        L+ C + L   +L       L    +  L    LE+ +      I G  +  +YE +LR  +  +        +KF + C+   G Y+S      V V+ +  R+ H
Sbjct:    1 MENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHG---SGVPFEAVILDKATGEGLIRAK--EPVDCEAQKEHTFTIQAYDCGEGPDGTNTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRIL-RVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCGKKRAADD-AEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALF-----------PGIRLETCDEPLWNIQATIELQTSHVAKG--------CDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPAGLGSGPQDGFSDHFTLSFWMKHSVTPSKGKKEEETIVCNTVQNEDGYSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALI----HDNGLIHPPRREPALMIGACWTEEKNKEKKGGENSTDTASGDPLLIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFA-TPGVRPLR-----LTTAVKCFSEESCVSIPEVEGYVVVLQPDAP--------QILLSGTAHFARPAVDFEGPEGVPLFPDLQITCSISHQVEAKADESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLL--LDMASLQQRGLELTNTSAYLTIAGVETITVYEEILRQARYQLRHGAALYARKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAH 772          
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Match: Clstn1 (calsyntenin 1 [Source:MGI Symbol;Acc:MGI:1929895])

HSP 1 Score: 85.1149 bits (209), Expect = 3.314e-16
Identity = 125/561 (22.28%), Postives = 222/561 (39.57%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKA-----------SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYS-------LQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG-----IIHINEGDSIG-PHNIKALGTD--FTLSWWMKRQ--SKLKTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQWIMLSTLGISIDG--SLLTTVSRESNLFQFQI-VRIFVGGC-----------------MRKSAAHTHLRGHKRSPIAKLGVIS--LATEKPQTQDVIECLSTCGEAI 1561
            Y G +  N  TV + P L A           S    V+K  +ICGF++ G   ++VPF   ++D+ +G G ++ K   + D +L+  Y F ++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V +  + +S++   +    AD   ++S       L  D  +PF + + G I   + L   K+  + + V A +  K    +  VLV I ++P C      +  +++Y    G   +            P + + +   P+  V   + L++  + +         C  D  + +    +CGA   T +L             L T+ G     +   N   ++  P  +  L     FT+S WM+     + K  I C  D    + +  S+ +  C+L  +           +  +      +     W  F ++   + + ++ + +DG      +V+ +  L   +I  ++ VG C                 M  +    H+    R  +A L V S  LA +K     VI+CL TC E +
Sbjct:   42 YHGIVTENDNTVLLDPPLIALDKDSPLRFAESFEVTVTKEGEICGFKIHG---QNVPFDAVVVDKSTGEGIIRSK--EKLDCELQKDYTFTIQAYDCGKGPDGTGVKKSHKATVHIQVNDVNEYAPVFKEKSYKAAVVEGKQHSSILR--VEAVDADCSPQFSQICSYEILTPD--VPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATED-VLVKISVKPTCSPGWQGWSSRIEYEPGTGALAVF-----------PSIHLETCDEPVASVQATVELETSHIGKG--------CDRDTYSEKSLHRLCGAAAGTSELLPSPSSSFNWTVGLPTDNGHDSDQVFEFNGTQAVRIPDGVVTLDPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLVFLLRQDPSEEKKYRPAEFHWKLNQVCDEDWHHFVLN---VEVPSVTLYVDGIPHEPFSVTEDYPLHPTKIETQLVVGACWQEYSGVESGNETEPATMASAGGDLHMTQFFRGNLAGLTVRSGKLADKK-----VIDCLYTCKEGL 565          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q9H4D0|CSTN2_HUMAN (Calsyntenin-2 OS=Homo sapiens OX=9606 GN=CLSTN2 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 8.467e-23
Identity = 188/863 (21.78%), Postives = 342/863 (39.63%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEG---------------------DSIGPHNIKALGTDFTLSWWMKRQSKL-----KTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTT---VSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRA---IMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIR---IFPNFRFISETNAESVAKDIK---------------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMID----ERKKFSIICTLKGGDYTSQTI-VEV-------IQTKFRIIHVANNENPLNDLAHHQSRNERAMFQEKSSDESLN--LLNISKSKFIAVIIMAVF 2425
            T Y G +  N+ TV + P L A      V  + +IC F++ G   + +PF   +L++ SG G ++ K  +  D +L+  Y F ++A+DC + PH      SH A V I V  VNEF P F   +Y   V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +  P     LV ++++PVC+    D+  +++Y   +G   +  S  L         T     S L+ VT           E   ++  + C  +  + +  + +CGA+   IDLL +     +   G                     D I P N   L   FT++ WMK          K  I C  D    + +  ++ + NC+L  +        +  +  +     ++    +W ++ I+ ++  + L   G + +  L+T    +       Q  +   + GG + K        G        L  +++   K ++Q VI CL  C E   I + +S+    K +   + S LV++   I  +  +  K+ YIN+     T  ++  + S       ++C  +++ IS+P     +M +  I P+       I +    +      + ES R   +FP+ + +S         D+K               L+ C + +   +L  + R        + L+   L+  ++   ++I G  S   YE +L H++         E ++F I C+   G YTS    +EV       +  K  + H+      L  + H +SR+     Q  S   S+   ++ IS    + V+ M V+
Sbjct:   46 TSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHG---QELPFEAVVLNKTSGEGRLRAK--SPIDCELQKEYTFIIQAYDCGAGPHETAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAVVTEGKIYDSILQ--VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQK-PAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIHL--------ETCDGAVSSLQIVT-----------ELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKVPDGIVPKN---LTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVTKPQFAQFFHG-------SLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGQGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS-RQFPTAGVRRLKVSS-----KVQCFGEDVCISIPEVDAYVMVLQAIEPR-------ITLRGTDHFWRPAAQFESARGVTLFPDIKIVSTFAKTEAPGDVKTTDPKSEVLEEMLHNLDFCDILVIGGDL--DPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLHHIRYRNWRPASLEARRFRIKCSELNGRYTSNEFNLEVSILHEDQVSDKEHVNHLIVQPPFLQSVHHPESRSS---IQHSSVVPSIATVVIIISVCMLVFVVAMGVY 853          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q9ER65|CSTN2_MOUSE (Calsyntenin-2 OS=Mus musculus OX=10090 GN=Clstn2 PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.325e-21
Identity = 170/789 (21.55%), Postives = 311/789 (39.42%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEG---------------------DSIGPHNIKALGTDFTLSWWMKRQSKL-----KTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTT---VSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRA---IMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIR---IFPNFRFISETNAESVAKDIK-----------------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMID----ERKKFSIICTLKGGDYTS 2227
            T Y G +  N+ TV + P L A      V  + +IC F++ G   + +PF   +L++ SG G ++ K  +  D +L+  Y F ++A+DC + P       SH A V I V  VNEF P F   +Y   V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +  P     LV ++++PVC+    D+  +++Y   +G   +  S           L  C       +VT          +E   ++  + C  +  + +  + +CGA+   IDLL +     +   G                     D I P N   L   FT++ WMK          K  I C  D    + +  ++ + NC+L  +        +  +  +     ++    +W ++ I+ ++  + L   G + +  L+T    +       Q  +   + GG + K        G        L  +++   K ++Q VI CL  C E   I + +S+    K +   + S LV++   I  +  +  K+ YIN+     T  ++    S       ++C  +++ IS+P     IM +  I PQ       I ++          + ES R   +FP+ + +S       + D++                 L+ C + +   +L  + R        + L+   L+  ++   ++I G  S   YE +L H++         E ++F I C+   G YTS
Sbjct:   48 TSYHGVITENNDTVILDPPLVALDKDAPVPFAGEICAFKIHG---QELPFEAVVLNKTSGEGRLRAK--SPIDCELQKEYTFIIQAYDCGAGPREAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDSILQ--VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQHQYEILVTAYDCGQK-PAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLFPSIH---------LETCDGAVSSLQVT----------AELQTNYIGKGCDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKN---LTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHG-------SLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINRALQKVSYINS-RQFPTAGVRRLRLSS-----KVQCFGEDVCISIPDVDAYIMVLQAIEPQ-------ITLQGTERFWRPAAQFESARGVTLFPDIKIVSTFAKTEASGDMRATGTAPKSAVLEEMLHNLDFCDILVLGGDL--DPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMNRYEQVLHHLRYRNWHPTSLETRRFRIKCSELNGRYTS 784          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q99JH7|CSTN3_MOUSE (Calsyntenin-3 OS=Mus musculus OX=10090 GN=Clstn3 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.480e-21
Identity = 172/823 (20.90%), Postives = 322/823 (39.13%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL--------LTEGGIIHINEGDSI---------------GPHNIKALGTD-----FTLSWWMKRQ---SKLKTE---IFC----LKDDHNSISILLENCQLS-----IMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQ--FQIVRIFVGGCMRKSAAHTHLRGHKRSPIAK-------------LGVISLATEKPQTQDVIECLSTCGEAIVASD--SIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTK-------SESIRIFPNFRFISETNAESVAK----------DIK--------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDE----RKKFSIICTLKGGDYTSQTI---VEVIQTKFRIIH 2272
            Y+G ++ N  TV + P L A      +  + +ICGF L G     VPF   +LD+ +G G ++ K     D + +  + F ++A+DC   P       SH A V + V  VNEF P+F  + Y  +V +    + ++  V A     +P    + + E L    PF I   G I   + L  + +  +   V A +  K         V I+++P C+     +  +++Y    G   +            P + + +   PL  +   I L++  +++         C  D  + R  R +CGA    +DLL         T G  +H ++  S+               GP  + +   D     FTLS+WMK     SK K E   I C     +D ++  S+ +  C+++     ++ + + V+     E+   ++W  + ++ ++  + L T GIS D +L+     ++ L     +   + +G C  +        G   +  A              L   S+ + + ++++VIECL  C E +   D  S+    KV+V  + S L L+   +     +   + Y+N    + T  ++        +  +++C S+E  +S+P     +  + P           +I+ + T    +        E + +FP+ +     + +  AK          D +        L+ C + L   +L       L    +  L    LE+ +      I G  +  +YE +LR  +  +        +KF + C+   G Y+S      V V+ +  R+ H
Sbjct:   33 YQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHG---SGVPFEAVILDKATGEGLIRAK--EPVDCEAQKEHTFTIQAYDCGEGPDGTNTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRIL-RVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCGKKRAADD-AEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALF-----------PGIRLETCDEPLWNIQATIELQTSHVAKG--------CDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPAGLGSGPQDGFSDHFTLSFWMKHSVTPSKGKKEEETIVCNTVQNEDGYSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALI----HDNGLIHPPRREPALMIGACWTEEKNKEKKGGENSTDTASGDPLLIHHYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFA-TPGVRPLR-----LTTAVKCFSEESCVSIPEVEGYVVVLQPDAP--------QILLSGTAHFARPAVDFEGPEGVPLFPDLQITCSISHQVEAKADESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLL--LDMASLQQRGLELTNTSAYLTIAGVETITVYEEILRQARYQLRHGAALYARKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAH 809          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q8VDA1|CSTN2_RAT (Calsyntenin-2 OS=Rattus norvegicus OX=10116 GN=Clstn2 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.598e-21
Identity = 166/789 (21.04%), Postives = 313/789 (39.67%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEG---------------------DSIGPHNIKALGTDFTLSWWMKRQSKL-----KTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTT---VSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRA---IMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIR---IFPNFRFISETNAESVAKDIK-----------------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMID----ERKKFSIICTLKGGDYTS 2227
            T Y G +  N+ TV + P + A      V  + +IC F++ G   + +PF   +L++ SG G ++ K  +  D +L+  Y F ++A+DC + P       SH A V I V  VNEF P F   +Y   V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +  P     LV ++++PVC+    D+  +++Y   +G   +            P + + +    +  + +   L+++ + +         C  +  + +  + +CGA+   IDLL +     +   G                     D I P N   L   FT++ WMK          K  I C  D    + +  ++ + NC+L  +        +  +  +     ++    +W ++ I+ ++  + L   G + +  L+T    +       Q  +   + GG + K        G        L  +++   K ++Q VI CL  C E   I + +S+    K +   + S LV++   I  +  +  K+ YIN+     T  ++    S       ++C  +++ IS+P     IM +  I PQ       I ++          + ES R   +FP+ + IS       + D++                 L+ C + +   +L  + R        + L+   L+  ++   ++I G  S   YE +L H++         E ++F I C+   G YTS
Sbjct:   48 TSYHGVITENNDTVILDPTIVALDKDAPVPFAGEICAFKIHG---QELPFEAVVLNKTSGEGRLRAK--SPIDCELQKEYTFIIQAYDCGAGPQEAAWKKSHKAVVHIQVKDVNEFAPTFKEPAYKAIVTEGKIYDSILQ--VEAIDEDCSPQYSQICNYEIVTTDVPFAIDRNGNIRNTEKLSYDKQRQYEILVTAYDCGQK-PAAQDTLVQVDVKPVCKPGWQDWTKRIEYQPGSGSMPLF-----------PGIHLETCDGAVSSLQVTAELQTNYIGKG--------CDRETYSEKSLQKLCGASSGIIDLLPSPSAATNWTAGLLVDSSEMIFKFDGRQGAKIPDGIVPKN---LTDQFTITMWMKHGPSPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQICDKEWHYYVINVEFPVVTLYMDGATYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVAKPRFAQFFHG-------SLASLTIRPGKMESQKVISCLQACKEGLDINSLESLGRGIKYHFNPSQSILVMEGDDIGNINQALQKVSYINS-RQFPTAGVRRLRLSS-----KVQCFGEDVCISIPDVDAYIMVLQAIEPQ-------ITLQGTERFWRPAAQFESARGVTLFPDIKIISTFAKTEASGDLRATGTAPKSAVLEEMLHNLDFCDILVLGGDL--DPRQECLELNHSELHQRHLDATNSTAGYSIYGVGSMSRYEQVLHHLRYRNWHPTSLETRRFQIKCSELNGRYTS 784          
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Match: sp|Q5R9Q9|CSTN3_PONAB (Calsyntenin-3 OS=Pongo abelii OX=9601 GN=CLSTN3 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.626e-21
Identity = 171/826 (20.70%), Postives = 324/826 (39.23%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL--------LTEGGIIHINEGDSI-----GPHNIK---------------ALGTDFTLSWWMK------RQSKLKTEIFC----LKDDHNSISILLENCQLS-----IMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQ--FQIVRIFVGGCMRKSAAHTHLRGH-------------KRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASD--SIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTK-------SESIRIFPNFRFISETNAESVAK----------DIK--------LETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDE----RKKFSIICTLKGGDYTSQTI---VEVIQTKFRIIHVAN 2281
            Y+G ++ N  TV + P L A      +  + +ICGF L G     VPF   +LD+ +G G ++ K     D + +  + F ++A+DC   P       SH A V + V  VNEF P+F  + Y  +V +    + ++  V A     +P    + + E L    PF I   G I   + L  + +  +   V A +  K         V I+++P C+     +  +++Y    G   +            P + + +   PL  +   I L++  +++         C  D  + R  R +CGA    +DLL         T G  +H ++  S      G   ++               +L   FTLS+WMK      +  K +  I C     +D  +  S+ +  C+++     ++ + + V+     E+   ++W  + ++ ++  + L T GIS D +L+     ++ L     +   + +G C  +       +G              +R     L   S+ + + ++++VIECL  C E +   D  S+    KV+V  + S L L+   +     +   + Y+N    + T  ++        +  +++C S+E  +S+P     +  + P           +I+ + T    +       +E + +FP+ +     + +  AK          D +        L+ C + L   +L       L  T  T L    LE+ +      I G  S  +YE +LR  +  +        +KF + C+   G Y+S      V V+ +  R+ H ++
Sbjct:   33 YQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHG---SGVPFEAVILDKATGEGRIRAK--EPMDCEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRIL-RVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADD-AEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALF-----------PGIRLETCDEPLWNIQATIELQTSHVAKG--------CDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSQIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYTDGISFDPALI----HDNGLIHPPRREPALMIGACWTEGKNKEKEKGDNSTDTTQGDPLSIQRYFHGYLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLRFA-TPGVRPLR-----LTTAVKCFSEESCVSIPEVEGYVVVLQPDAP--------QILLSGTAHFARPAVDFEGTEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLLLDT--TSLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYARKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSH 812          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: A0A4E0R9X6 (Calsyntenin-3 OS=Fasciola hepatica OX=6192 GN=D915_006402 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.349e-34
Identity = 205/900 (22.78%), Postives = 352/900 (39.11%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASV--VKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIA--------KSLADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTK-QSDFLIRVVAKERSKGIPKQSLVLVNIEI-EPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTE------------------------------GGIIHINEGDS---IGPHNIKALGTDFTLSWWMKRQ-----------SKLKTEIFCLKDDHNS----ISILLENCQL--SIMNNL---------------QNVQIEIPTEKCQINKWQFFTIS---QQWIMLSTL-GISIDG----------------SLLTTVSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASDSIATL-SKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDIL-IDLSIECESKEIISVPRAIMRINFIGPQKETG-----------NDTIDVEIVTNSTI----------------------------------------TTTKSESIRIFPNFRF------ISETNAESVAKDIKLETCTVRLF------------QRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQV---------DMIDERKKFSII--------------CTLKGGD-YTSQTIVEVI 2248
            Y GYL  +S  V + P L+A    VKGV    +ICG    G T  ++PF V +LD  +G+GE+++K ++  + + +    F+VEA+DC   P++S  APV +H++N  GP+F + SY F+V + +   +V+G V A           A    +Y +     LPF I + GVI + D L   +    ++ +V+A++  +  P ++ V V + + +  CQ      P  ++Y   + +     S +L  +  +PVL  C+       + LR+ L+S        +     C  D      QR +C  NP+T+  LL +                              G  + + E D       + I A  T+FTLS+WM+R              ++  + C +D + +    +SI    CQL   IM +                Q +   +P   C   +W  + I+     W + + L  + IDG                 +     R+++       RI +G C       T  R H     A+L  ++L  ++ ++  V+ C++ CGE++   + +  L   +NV     ++ +  ++I  + D  T I YI        D +     S +L +    +C  ++ IS+P  I+ +N +  Q+E             N    V I  NS+                                          +T    I +F + +F      +++ +AES+A  + L++C + L             + N    ERI  P  ++ I N       +N Y   I G    E Y  LLR  +            +  R K SII              CTL  G+  TS+ IV+V+
Sbjct:   55 YRGYLWKDSNRVHLRPVLQAFADDVKGVKG--EICGIVPHGFTGNNLPFYVEVLDRKTGLGEIKLKNNSSINFKEEQTIAFDVEAYDCQEPPNFSKRAPVSVHILNRHGPVFDSLSYQFTVSQHSPTGTVVGQVAAIAEFNSRDSDAATKICDYQIS-PVNLPFSIDRYGVIRVGDGLEGLRVNRPYVFQVIAEDCHRPTPLRAWVDVQVGLLKQGCQQGWEGLPLDIEYQSPSDV-----SERLFWRA-KPVLETCTRKCLDPIIQLRLELRSAMDETLVQTANSRACLHDPEHLNRQRKLCRTNPNTMINLLPDPDQDLAAQLVRPSLGSAPRVLAPAQIMRFSGASLSVWELDPKHLTTENGINAFDTNFTLSFWMRRHMGQTHPPTANSEDIEETVICSQDQNLAQWRFLSISFRGCQLIVRIMASFRPGDGVSEPEPRRASQWIFESLPEHYCSAMQWHHYVITFNRAPWALTTQLVSLLIDGYNPDLNDPTEILSVPNPVYIPSERKAD------PRITIGACFDPETRLT--RQHLN---AELTGMTLLLDEVESPSVLRCMAQCGESLYVPNVLKFLRPDINVTLESDAITIIGQNIAHVTDMLTAITYIRPQPGISKDYVATVAQSRLLRLQTLYQCPKEKAISLPNTIILLNVLPEQREVKHRVEQGYPVDVNTAGSVWIPENSSSQPNQPSNTVGDLEGRAKKQDVDHPEVPPLRISGPNVIVADPSTIGPGIPLFSDIKFKLWDKRMTKVSAESIAASVPLDSCNIWLASTGDPKTPVSRPKFNAAQGERIEWP-NIMAINNG--FSSHTNEYGVEIRGRKPAEEYARLLREFRYWPPSTLRARKPVLLRSKSSIIVENDVSYMANVELVCTLDAGNQRTSEFIVKVL 931          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: A0A0P4W2K2 (Uncharacterized protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.177e-29
Identity = 172/780 (22.05%), Postives = 325/780 (41.67%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLT-----------------EGGIIHINEGDSIGP--------HNIKALGTDFTLSWWMKRQS------KLKTEIFCLKDDH----NSISILLENCQLSI----------MNNLQNVQIEIPTEKCQINKWQFFTISQQWIMLSTLGISIDGSLLTTVSRES----NLFQFQIVR-----IFVGGCMRKS-AAHTH-LRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAI--VASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEIISVPRAIMRINFIGPQKETGNDTIDVEIVTN-STITTTKSESIRIFPNFR-FISETNAESVAKDI--KLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDER------KKFSIICTLKGGDYTSQTIVEVI 2248
            Y G +  ++  V M P ++A           +C F +  R     PF + L D+++G  E+  K+S   + + +  Y+F++ A  C  +   +    V++  VNE+ P+F   SY   V +      V+ T+ A     +P    +   E L    PF I   GVI   + L   K  + ++ VVA +   G+ +   V+V I++  VC+      PDQ++Y   +G   +  +           L +C++P  ++ V  R++L +  + +         C  D  +   QR +CGA+  +++LL                   EG +I+  EGD  G         HN+  +   FT+S W+K +S       +K  I C  DDH    +  ++ + NC+L +          +N  Q  +      +   N+W  +++    +    + + +DG L    + ES    + +     R     + VG C + S  +  H L G+    +A L V+    E P+   V+ CL+ C EA+   A + +    ++      + + ++  +IT +     +I YIN    SR        P  ++ +  I C+S +   V  A   +  + P +     +I++   TN +    +  + +R+FP+   ++S    E+ A     +L+ C V ++      +E + LP  L++ L  A    +       I G  +   Y+++LR  Q+   + +      + F + C+  GG +TS   V+ +
Sbjct:   36 YHGLVAEDTTLVEMQPPIRAL--------PDVCTFRIVNRHHGEAPFVIRLRDDMTGEAELMAKHS--LNCEKRKNYKFDITAISCTGVESQNVTVHVKVSDVNEYAPVFVEPSYVKDVDEGRLYEEVL-TLQADDQDCSPKYGDICRYELLTRDQPFTIDSEGVIRNTEPLDYEKSHNHILSVVAYD--CGMKRSQPVMVTIKVNRVCRIGWKGIPDQVEYSPGSGRQELFPAAS---------LELCNVPCRVERVQARVTLTTTHIGKG--------CDRDTYSVAAQRKMCGASSASVELLPAPGAGREWTAGLHSDEGHEGDLIYQFEGDHSGAVVPESVLHHNLTNI---FTISTWLKHKSHPGMDKHVKEHILCTADDHKMNRHHTALFVRNCRLILLLRRESTEANLNTFQPAEWRWKLSQVCDNEWHHYSLH---VNFPEVTLYVDGHLFRPENGESPEVIDDWPLHPTRGINTTMSVGACWQGSEGSMKHGLTGY----LAGLSVLVGGLESPR---VLSCLTRCQEALDTPAMELLQPSMELLTNNEMTQITIEGNNITNMETLIHRIAYIN----SRDFPTPGRRPISVVAN--ILCDSGKSFKVDPAQSFVMVMQPHQP----SIELNGTTNFAEEYESFRQGLRVFPDVSIYLSPAAEEATAPTPGGQLDECIVSVYPSLNPDHETLLLPDNLISELGLASSTTRQGA---TISGAHTTRHYQSILR--QIHYANRKPAYYLNRAFKLSCSELGGRFTSNEYVQTV 757          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: A0A3S3QCK7 (Calsyntenin-1-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_02372 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.478e-29
Identity = 178/813 (21.89%), Postives = 333/813 (40.96%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNP-----VEYSLQHDEKL--PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG------GIIHINEG-------------------DSIGPHNIKALGTDFTLSWWMKRQ-------SKLKTEIFCLKDDH----NSISILLENCQLSIM----NNLQNVQIEIPTEK-------CQINKWQFFTISQQWIMLSTLGISIDGSLLTTVSRESNLFQFQIVR--------IFVGGCM--RKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEIISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKS-----ESIRIFPNFRFI----SETNAESVAKD----------------------IKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDER------KKFSIICTLKGGDYTSQTIVEVI 2248
            Y   +  N +TV +TP +K  VV       + C  E+  +    VPF V L+DE  G  E  ++   E + + +  Y+F++ A  C+ L  +S  A V + V  VNE+ P+F  +SYT ++ +    + ++  V A     +P      +Y +   +KL  PF+I   G I     L      ++++ +VA +   G+ +   VLVNI++  VCQ    + P++++Y   +    +    +LI         +C +P   + V++R+SL +H + +         C  D  +   QR +CGA+ +++DLL + G        +  +EG                   +S   HN   L  +FT+S+WMK +         +K  I C  DDH    +  ++ + NC+L ++     N ++  +  P E        C  N+W  + +    +    + + +DG      S    +     +         + VG C   + S  + H RG     +A L ++   +E P   DV+ CL  C E   +  SD++   ++V++    + ++++ K    + D  ++I YIN    SR           IL   S++C S + + +P     I  + P++ +        I  N T    +      + I +F     +    +E + E    D                       KL+TCTV+++      +E   LP   +  L     E K  + ++   G  +   Y+++LR  Q+   + +      + F + C+   G + S   ++ +
Sbjct:   19 YRAIVNENDRTVMVTPRIK--VVDA-----RACSMEIVNKHHGEVPFEVRLVDEEKG--EAVIEAKRELNCEKRRTYKFSIRAIGCNKL--HSQNATVHLTVEDVNEYAPVFRQESYTVTINEGRLVDPIV-QVEAIDHDCSPKYSKICKYEIIGGDKLASPFEIDANGNIKNTQPLSWKVSHNYILEIVAYD--CGMKRSKPVLVNIKVNKVCQVGWKEMPERIEYIPGSAQRTLFPDAELI---------LCEVPCETENVSVRLSLATHHIGKG--------CDRDTYSVASQRKLCGASDESVDLLPSPGIGTEWTRDLPTDEGHESDQIYEFDGATNSVVIPESTLNHN---LTDNFTISFWMKHEPPADHNNKHIKEHIICNADDHKKNRHHYALFVRNCRLILLLRRECNQEDRNVFKPAEWRWKLADVCD-NEWHHYAVI---VNFPDVVLYVDGQRFKNSSNNPEIVDDWPLHPMKDVNTTLVVGACWEGKSSKMNFHFRGF----LAGLSILRGKSENP---DVLACLHRCKEGLQLPPSDTLDPGTEVSINSAATEILVEGKDAIDVEDMLSQISYIN----SREFPTPGRRSLRILT--SVKCMSGKALKIPPVDAYIMVLPPEQPS--------ITLNGTPNLAREYEAFIQGIELFSTVSVLVNHEAEPDEEQQQADDNVNGKQSLAYNNNNENKLQNVHKLDTCTVQVYPPLNPDHEYFRLPLNFMKHLGVRHKETKDGIVIY---GADTVHNYQSILR--QIVYFNRKPAYYLNRAFKLTCSELNGRFVSNDYIQTL 767          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: A0A443SUR0 (Calsyntenin-1-like protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_09668 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 9.020e-29
Identity = 177/825 (21.45%), Postives = 349/825 (42.30%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPV--------EYSLQHDEKL--PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG-GI-----IHINEG-------------------DSIGPHNIKALGTDFTLSWWMKRQ-------SKLKTEIFCLKDDH----NSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFFTI-SQQW------IMLSTLGISIDGSLLTTVSRESNL---FQFQIVR-----IFVGGCM--RKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEIISVPRAIMRINFIGPQKE--TGNDTIDVE---------IVTNSTITTTKSESIRIFPNFRFISETNAESVAKDI----KLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDER------KKFSIICTLKGGDYTSQTIVE---VIQTKFRIIHVANNENPLNDLAH--HQS 2320
            Y   +  N +TV +TP +K  VV       ++C  E+  +    VPF V ++D+ +G   ++ K   E + + +  Y+F++ A  C+ L  +S  A V + V  VNE+ P+F  +SYT ++ +      ++  ++     D+          +Y +   +KL  PF+I   G I     L      ++++ +VA +   G+ +   VLVNI++  VCQ    + P++++Y   +    +    +L          +C +P   + V++R+SL +H + +         C  D  +   QR +CGA+ +++DLL + G G      +  +EG                   +S   HN   L  +FT+++WMK +         +K  I C  DDH    +  ++ + NC+L ++   +  Q +    K    +W+   +   +W      +    + + +DG      S    +   +    ++     + VG C   + S  + H RG     +A L ++   +E P   DV+ CL  C E   +  SD++   +++++  + + +V++ K    + D  ++I Y+N      +          + I  SI+C S + + +P     I  + P++   T N T ++          I   ST++   +  +    + +  SE    S    +    KL+TCTV+++      +E   LP   +  L     E K  + ++   G  +   Y+++LR  Q+   + +      + F + C+   G + S   ++   VI  K       + ++ +N + H  HQS
Sbjct:   11 YRAVVNENERTVIVTPRIK--VVDA-----RVCSIEVVNKHHGEVPFEVRIVDQENGEAILEAK--RELNCEKRRTYKFSIRAIGCNKL--HSQNASVHLTVEDVNEYAPMFRKESYTVTINE----GRLVDPIVQVEAVDHDCSPKYSKICKYEIIAGDKLAAPFEIDGNGNIKNTQPLSWKISHNYILEIVAYD--CGMKRSKPVLVNIKVNKVCQVGWKEIPERIEYIPGSAQRVLFPDAEL---------QLCDVPCDTENVSVRVSLATHHIGKG--------CDRDTYSVASQRKLCGASDESVDLLPSPGIGTEWTRDLPTDEGHESDQIYEFDGATNSVVIQESTLHHN---LTDNFTIAFWMKHEPPADHNNKHIKEHIICNADDHKKNRHHYALFVRNCRLILLLRREYNQEKHTVFKPAEWRWKLAEVCDNEWHHYAVIVNFPDVILFVDGQRFKNSSNNPEIVDDWPLHAMKDVNTTLVVGACWEGKSSKMNFHFRGF----LAGLSILRGKSENP---DVLACLHRCKEGLQLPPSDTLDPGTELSINSDATEIVVEGKDAIDVEDMLSQISYLN------SREFPTPGRRSLRISTSIKCISGKSLKIPAGDSYIMVLPPEQPSITLNGTPNLAREYEAFVQGIELFSTVSVLVNHELEPEDDQQADSENERVSAINKLMNGHKLDTCTVQVYPPLNPDHEYFRLPINFMKHLGVRHKETKDGIVIY---GADTVHNYQSILR--QIVYFNRKPAYYLNRAFKLTCSELNGRFVSNDYIQTLTVIHPKSDSQATLSQKHSINSIEHSGHQS 780          
BLAST of Calsyntenin 1 vs. TrEMBL
Match: A0A2D0SI56 (calsyntenin-1 isoform X3 OS=Ictalurus punctatus OX=7998 GN=clstn1 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.190e-28
Identity = 185/810 (22.84%), Postives = 333/810 (41.11%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-----------SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTE-------GGIIHINEGDSI------GPHNIK--------ALGTDFTLSWWMKR--QSKLKTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQWIMLSTLGISIDGSLLTT--VSRESNLFQFQI-VRIFVGGCMRKSAAHT--HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS----ETNAESVAKD--------------IKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLL-----RHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVAN 2281
            T Y G +  N   V + P L A           S     +K  +ICGF + G   ++VPF   +LD+ +G G ++ K  ++ D +L+  + F ++A+DC   P       SH A V I V  +NE+ P+F  KSY  +  +    +S++   +    AD   ++S     ++     PF I + G I   + L  +K+  + + V A +  K    +  VLV I ++P C+     F  +++Y    G   +            P + + +   PL  +   I L+++ + +         C  D  + +    +CGA+  T++LL +         G+   N  DS       G   +K        +L   FT+S WM+    S+ K  I C  D    + +  S+ + NC+L ++         N +  +     ++    +W  + ++   I    + + +DG+      V+ +  L   +I  ++ +G C +  +AH   + RG+       L  + + T K + + VI+CL TC E   +   + +A+  KV+   N SSL L+   I         I Y+N+     T  I+      + +  +++C ++E  ISVP A   +  + P+ E       ++           +E + +FP  R +S    E  AE+  +D                L+TC V +   +L  N    L   L  +     LEI S+     I G  +   YE +L     R+   + + +R KF ++C+   G Y S       + +  +IH AN
Sbjct:   41 TTYHGIVTENDDKVLLDPPLIALDKDAPLRYAESFEVTFTKEGEICGFRIHG---QNVPFEAVMLDKSTGEGVIRAK--DKLDCELQKEHTFTIQAYDCGEGPDGANMKKSHKATVHIQVNDMNEYSPVFKEKSYKATGIEGKAYDSILK--VDAVDADCSFQFSQICSYEIVTPDVPFTIDKDGNIKNTEKLNYSKERAYKLTVTAFDCGKNRASED-VLVKINVKPTCKPSWQGFNKRIEYEPGTGSLALF-----------PSIRLETCEEPLTSIQASIELETNHIGKG--------CDRDTYSEKSLHRLCGASSGTVELLPSPSSATNWTAGLPTDNGHDSDQVFEFNGTQAVKVPEGMVSTSLKEPFTISVWMRHGPGSREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQDPSEAENYKPAEFHWKLDQVCDKEWHHYVLN---IEFPAVSLFVDGASFEPFLVTEDYPLHASKIETQLTIGACWQGGSAHMAQYFRGN-------LAGLMIRTGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVDFNPNQSSLSLEGDDIESFEKVMQHISYLNS-RQFPTPGIR-----HLCLTTTVKCFNEETCISVPDAEGYVMVLQPE-EPKISLSGIDHFARGAAEFESTEGVTLFPELRVVSTITREVEAEAEGEDEPTVQESVVSEEIMHNLDTCEVTVVGEDLDGNHE-SLEVDLAQVQQRG-LEISSSNMGMVITGVNTMANYEQVLHLIRYRNWHTEALFDR-KFKLVCSELNGRYISND----FKVEVSVIHTAN 799          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:103033297])

HSP 1 Score: 129.798 bits (325), Expect = 4.292e-30
Identity = 181/800 (22.62%), Postives = 329/800 (41.12%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG-------GIIHINEGDSI------GPHNIK--------ALGTDFTLSWWMKR--QSKLKTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQWIMLSTLGISIDGSLLTT--VSRESNLFQFQI-VRIFVGGCMRKSAAHT--HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS----ETNAESVAKD--------------IKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLL-----RHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVAN 2281
            T Y G +  N   V + P L A      +  + +ICGF + G   ++VPF   +LD+ +G G ++ K  ++ D +L+  + F ++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V +  K +S++   +    AD   ++S     ++     PF I + G I   + L  +K+  + + V A +  K    +  VLV I I+P C+     F  +++Y    G   +            P + + +   P+  +   I ++++ + +         C  D  + +    +CGA+  T++LL           G+   N  DS       G   IK        +L   FT+S WM+     + K  I C  D    + +  S+ + NC+L ++         N +  +     ++    +W  + ++   I    + + +DG+      V+ +  L   +I  ++ +G C +  +A    + RG+       L  + + + K + + VI+CL TC E   +   + +A+  KV    N SSL L+   I         I Y+N+     T  I+      + +  +++C ++E  ISVP A   +  + P+ E       ++           +E + +FP  R +S    E  AE+  +D                L+ C V +   +L  +    L   L  +     LEI S+     I G  +   YE +L     R+   + + +R KF ++C+   G Y S       + +  +IH AN
Sbjct:   43 TTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHG---QNVPFEAVMLDKSTGEGVIRAK--DKLDCELQKEHTFTIQAYDCGEGPDGTNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDSIMK--VEAVDADCSFQFSQICSYEIVTPDVPFSIDKDGNIKNTEKLNYSKERMYKLTVTAYDCGKNRASED-VLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALF-----------PSVRLETCEEPITSIQASIEVETNHIGKG--------CDRDTYSEKSLHRLCGASTGTVELLPAPSSATNWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTSLKDPFTVSVWMRHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQDPTESENYKPAEFHWKLDQVCDKEWHHYVLN---IEFPAVALFVDGASFEPFLVTEDYPLHASKIETQLTIGACWQGGSARMTQYFRGN-------LAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLTLEGDDIESFEKVMQHISYLNS-RQFPTPGIR-----HLRVTTTVKCFNEETCISVPDAEGYVMVLQPE-EPKISLSGIDHFARGAADFESAEGVTLFPELRIVSTITREVEAEAEGEDDPTVQETVVSEEIMHNLDMCEVTVVGDDLDGDHE-SLEVDLAQVQQRG-LEISSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFDR-KFKLVCSELNGRYVSND----FKVEVNVIHTAN 791          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:103033297])

HSP 1 Score: 126.331 bits (316), Expect = 4.934e-29
Identity = 180/810 (22.22%), Postives = 327/810 (40.37%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG-------GIIHINEGDSI------GPHNIK--------ALGTDFTLSWWMKR--QSKLKTEIFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQWIMLSTLGISIDGSLLTT--VSRESNLFQFQI-VRIFVGGCMRKSAAHTHLRGHKRSPI------------AKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS----ETNAESVAKD--------------IKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLL-----RHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVAN 2281
            T Y G +  N   V + P L A      +  + +ICGF + G   ++VPF   +LD+ +G G ++ K  ++ D +L+  + F ++A+DC   P       SH A V I V  VNE+ P+F  KSY  +V +  K +S++   +    AD   ++S     ++     PF I + G I   + L  +K+  + + V A +  K    +  VLV I I+P C+     F  +++Y    G   +            P + + +   P+  +   I ++++ + +         C  D  + +    +CGA+  T++LL           G+   N  DS       G   IK        +L   FT+S WM+     + K  I C  D    + +  S+ + NC+L ++         N +  +     ++    +W  + ++   I    + + +DG+      V+ +  L   +I  ++ +G C +  + H +       P+              L  + + + K + + VI+CL TC E   +   + +A+  KV    N SSL L+   I         I Y+N+     T  I+        +  +++C ++E  ISVP A   +  + P+ E       ++           +E + +FP  R +S    E  AE+  +D                L+ C V +   +L  +    L   L  +     LEI S+     I G  +   YE +L     R+   + + +R KF ++C+   G Y S       + +  +IH AN
Sbjct:   43 TTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHG---QNVPFEAVMLDKSTGEGVIRAK--DKLDCELQKEHTFTIQAYDCGEGPDGTNMKKSHKATVHIQVNDVNEYSPVFKEKSYKATVIEGKKYDSIMK--VEAVDADCSFQFSQICSYEIVTPDVPFSIDKDGNIKNTEKLNYSKERMYKLTVTAYDCGKNRASED-VLVKINIKPTCKPSWQGFNKRIEYEPGTGSLALF-----------PSVRLETCEEPITSIQASIEVETNHIGKG--------CDRDTYSEKSLHRLCGASTGTVELLPAPSSATNWTVGLPTDNGHDSDQVFEFNGTQAIKVPEGVVSTSLKDPFTVSVWMRHGPGGREKETILCNSDKTEMNRHHYSLYVHNCRLVLLLRQDPTESENYKPAEFHWKLDQVCDKEWHHYVLN---IEFPAVALFVDGASFEPFLVTEDYPLHASKIETQLTIGACWQDLSGHDNDTETVSEPLTGGSARMTQYFRGNLAGLMIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASAVKVEFNPNQSSLTLEGDDIESFEKVMQHISYLNS-RQFPTPGIRHLR-----VTTTVKCFNEETCISVPDAEGYVMVLQPE-EPKISLSGIDHFARGAADFESAEGVTLFPELRIVSTITREVEAEAEGEDDPTVQETVVSEEIMHNLDMCEVTVVGDDLDGDHE-SLEVDLAQVQQRG-LEISSSNVGMVITGVNTMANYEQVLHLIRYRNWHTEALFDR-KFKLVCSELNGRYVSND----FKVEVNVIHTAN 808          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn2 (calsyntenin 2 [Source:NCBI gene;Acc:103023918])

HSP 1 Score: 106.686 bits (265), Expect = 5.506e-23
Identity = 159/671 (23.70%), Postives = 276/671 (41.13%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL-------------LTEGG----IIHINEG-------DSIGPHNIKALGTDFTLSWWMKR--QSKLKTE---IFCLKD----DHNSISILLENCQL--------SIMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQFQI-VRIFVGGCMRKSAAHT-----HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS 1936
            T Y G +  N  TV + P L A      V  + +IC F++ G   +  PF   +L+  SG G ++ +     D + +  Y F ++A+DC S P       SH A V I V  VNEF P+F    Y  +V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +    +S V V+I+++PVC+     + +++DY    G      S QL  + H   L  C    PL  V   + L++  + +         C  +  + +  + +CGA   + DLL             LT+ G    +I   +G       + + P N   L   FT++ WMK      L+ E   + C  D    + +  S+ + NC+L        + M+  +  +     E+    +W ++ I+ ++  + L   G++ +  L+T    +  +   QI V++ VG C +     T     + RG        L  +++   K +TQ VI CL  C E   I + +S+    K +     S LV++   +  +  +  K+ YIN    SR           + +  +++C  ++  IS+P  I  +  + P  E       VE  T           I +F + R IS
Sbjct:   18 TSYHGVITENMDTVLLDPPLVALDKDAPVPYAGEICAFKIHG---QEAPFEAEVLNRTSGEGVLRAR--GPIDCEQQKEYTFIIQAYDCGSGPTGAGWKKSHKAVVHIQVDDVNEFSPVFREPVYRATVTEGKIYDSILQ--VEAWDQDCSPQYSQICNYEIVTQDTPFAIDRNGNIRNTERLSFDKQQHYKILVTAYDCGQKRASES-VPVHIDVKPVCKPGWQGWNNRVDYEPGTG------SKQLFPKMH---LETCD--GPLSSVRAMVELQTSHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLPAPSASTNWTASLLTDSGRDSDLIFRFDGRQAANIPERVVPQN---LTDQFTIATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFTQMDTFRPAEFHWKLEQICDKEWHYYVINVEFPAVTLFVDGVTYEPYLVTD---DWPIHPSQIDVQLTVGACWQGGEVTTPRFTQYFRG-------SLSGLTIRPGKIETQKVISCLQACKEGLDINSLESLGKGIKFHFNPAQSVLVMEGDDLDSINTAMAKVSYIN----SRQFPTPGLR--KLRVTTTVQCFGEDTCISIPD-IKAVVMVLPPSEPRITIAGVERATWPASELRTPAGITLFKDIRIIS 641          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn2 (calsyntenin 2 [Source:NCBI gene;Acc:103023918])

HSP 1 Score: 106.301 bits (264), Expect = 6.288e-23
Identity = 159/671 (23.70%), Postives = 276/671 (41.13%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL-------------LTEGG----IIHINEG-------DSIGPHNIKALGTDFTLSWWMKR--QSKLKTE---IFCLKD----DHNSISILLENCQL--------SIMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQFQI-VRIFVGGCMRKSAAHT-----HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS 1936
            T Y G +  N  TV + P L A      V  + +IC F++ G   +  PF   +L+  SG G ++ +     D + +  Y F ++A+DC S P       SH A V I V  VNEF P+F    Y  +V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +    +S V V+I+++PVC+     + +++DY    G      S QL  + H   L  C    PL  V   + L++  + +         C  +  + +  + +CGA   + DLL             LT+ G    +I   +G       + + P N   L   FT++ WMK      L+ E   + C  D    + +  S+ + NC+L        + M+  +  +     E+    +W ++ I+ ++  + L   G++ +  L+T    +  +   QI V++ VG C +     T     + RG        L  +++   K +TQ VI CL  C E   I + +S+    K +     S LV++   +  +  +  K+ YIN    SR           + +  +++C  ++  IS+P  I  +  + P  E       VE  T           I +F + R IS
Sbjct:   15 TSYHGVITENMDTVLLDPPLVALDKDAPVPYAGEICAFKIHG---QEAPFEAEVLNRTSGEGVLRAR--GPIDCEQQKEYTFIIQAYDCGSGPTGAGWKKSHKAVVHIQVDDVNEFSPVFREPVYRATVTEGKIYDSIL--QVEAWDQDCSPQYSQICNYEIVTQDTPFAIDRNGNIRNTERLSFDKQQHYKILVTAYDCGQKRASES-VPVHIDVKPVCKPGWQGWNNRVDYEPGTG------SKQLFPKMH---LETCD--GPLSSVRAMVELQTSHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLPAPSASTNWTASLLTDSGRDSDLIFRFDGRQAANIPERVVPQN---LTDQFTIATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFTQMDTFRPAEFHWKLEQICDKEWHYYVINVEFPAVTLFVDGVTYEPYLVTD---DWPIHPSQIDVQLTVGACWQGGEVTTPRFTQYFRG-------SLSGLTIRPGKIETQKVISCLQACKEGLDINSLESLGKGIKFHFNPAQSVLVMEGDDLDSINTAMAKVSYIN----SRQFPTPGLR--KLRVTTTVQCFGEDTCISIPD-IKAVVMVLPPSEPRITIAGVERATWPASELRTPAGITLFKDIRIIS 638          
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Match: clstn2 (calsyntenin 2 [Source:NCBI gene;Acc:103023918])

HSP 1 Score: 106.301 bits (264), Expect = 7.290e-23
Identity = 159/671 (23.70%), Postives = 276/671 (41.13%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLL-------------LTEGG----IIHINEG-------DSIGPHNIKALGTDFTLSWWMKR--QSKLKTE---IFCLKD----DHNSISILLENCQL--------SIMNNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQFQI-VRIFVGGCMRKSAAHT-----HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS 1936
            T Y G +  N  TV + P L A      V  + +IC F++ G   +  PF   +L+  SG G ++ +     D + +  Y F ++A+DC S P       SH A V I V  VNEF P+F    Y  +V +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  + I V A +  +    +S V V+I+++PVC+     + +++DY    G      S QL  + H   L  C    PL  V   + L++  + +         C  +  + +  + +CGA   + DLL             LT+ G    +I   +G       + + P N   L   FT++ WMK      L+ E   + C  D    + +  S+ + NC+L        + M+  +  +     E+    +W ++ I+ ++  + L   G++ +  L+T    +  +   QI V++ VG C +     T     + RG        L  +++   K +TQ VI CL  C E   I + +S+    K +     S LV++   +  +  +  K+ YIN    SR           + +  +++C  ++  IS+P  I  +  + P  E       VE  T           I +F + R IS
Sbjct:   34 TSYHGVITENMDTVLLDPPLVALDKDAPVPYAGEICAFKIHG---QEAPFEAEVLNRTSGEGVLRAR--GPIDCEQQKEYTFIIQAYDCGSGPTGAGWKKSHKAVVHIQVDDVNEFSPVFREPVYRATVTEGKIYDSIL--QVEAWDQDCSPQYSQICNYEIVTQDTPFAIDRNGNIRNTERLSFDKQQHYKILVTAYDCGQKRASES-VPVHIDVKPVCKPGWQGWNNRVDYEPGTG------SKQLFPKMH---LETCD--GPLSSVRAMVELQTSHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLPAPSASTNWTASLLTDSGRDSDLIFRFDGRQAANIPERVVPQN---LTDQFTIATWMKHGPSPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFTQMDTFRPAEFHWKLEQICDKEWHYYVINVEFPAVTLFVDGVTYEPYLVTD---DWPIHPSQIDVQLTVGACWQGGEVTTPRFTQYFRG-------SLSGLTIRPGKIETQKVISCLQACKEGLDINSLESLGKGIKFHFNPAQSVLVMEGDDLDSINTAMAKVSYIN----SRQFPTPGLR--KLRVTTTVQCFGEDTCISIPD-IKAVVMVLPPSEPRITIAGVERATWPASELRTPAGITLFKDIRIIS 657          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:101174913])

HSP 1 Score: 117.087 bits (292), Expect = 3.084e-26
Identity = 184/832 (22.12%), Postives = 338/832 (40.62%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-----------SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG-------GIIHINEGDSI------GPHNIKA--------LGTDFTLSWWMKR--QSKLKTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFFTI-SQQW------IMLSTLGISIDGSLLTT--VSRESNLFQFQI-VRIFVGGCMRKSAAHTHLRGHKRSPIA------------KLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSR---TDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS------ETNAESVAKDIKLETCTVRLFQRNLVANERIY-LPTTLLTI------------------LNAAKLEIKSNLYLWAIEGEASGEIYENLL-----RHVQVDMIDERKKFSIICTLKGGDYTSQTI---VEVIQTKFRIIHVAN 2281
            T Y G +  N   V + P L A           S    ++K  +ICGF + G   ++VPF   +LD+ +G G ++ K  ++ D +L+  + F ++A+DC   P       SH A V I V  +NE+ P+F  K+Y  +V +  K +S++   +    AD   ++S   + ++     PF I + G I   + L   K+  + + V A +  K    +  VLV I ++P C+     F  +++Y    G   +            P + + +   P+  +   + L+++ + +         C  D  + +    +CGA   T++LL           G+   N  DS       G   IK         L   FT+S WM+    +  K  I C  D    + +  S+ + NC+L  +  L+    E  T K     W+   +  ++W      +   T  + +DG+      V+ +  L   +I  ++ +G C ++++ H +       P +             L  + + + K + + VI+CL TC E   +   + +A+  KV    N SSL ++ + I    D+  K+    +Y +SR   T  I+      + +  +++C +++  +SVP A   +  + P+ E       ++    S       E + +FP  R +S      E + E  A D   +  TV   Q  +V+ E ++ L    +++                  L    LE+ S+     I G  +   YE +L     ++   + + +R KF ++C+   G Y S      V VI T   + H  N
Sbjct:   37 TTYHGIVTENDDKVLLDPPLIALDKDAPLRYAESFEVTLTKEGEICGFRIHG---QNVPFEAVVLDKSTGEGVIRAK--DKLDCELQKEHTFTIQAYDCGEGPDGANMKKSHKATVHIQVNDINEYSPVFKEKTYKATVLEGKKYDSILK--VEAVDADCSFQFSQICNYEIVTPDVPFTIDKDGFIKNTEKLSYGKEHMYKLTVTAYDCGKNRASED-VLVKISVKPTCKPSWQGFNKRIEYEPGTGSLALF-----------PSMHLETCDEPVSSIRASVELETNHIGKG--------CDRDTYSEKSLHKLCGATSGTVELLPAPSSSANWTIGLPTDNGHDSDQVFEFNGTQAIKVPNGVVSTNLKEPFTISVWMRHGPGAHEKETILCNSDKTDMNRHHYSLYVHNCRLIFL--LRQDPSEAETYKPAEFHWKLDQVCDKEWHHYVLNVEFPTASLFVDGTTFEPFLVTEDYPLHATKIETQLTIGACWQENSGHDNETETAPEPTSGGNARMAQFFRGNLAGLIIRSGKLENKKVIDCLYTCKEGLDVQLPEEVASSVKVEFNPNQSSLTVEGEDI----DAFDKVMQHISYLNSRQFPTPGIR-----HLRVATTVKCFNEDACVSVPDAEGYVMVLQPE-EPKISLSGIDHFARSAAEFESQEGVTLFPELRIVSTITREVEADTEPEAADGADDDPTV---QETVVSEEIMHNLDFCEVSVMGEELDGEHESLEMDPSQLQQRALEMSSSNLGLIITGVNTMANYEQVLHLIRYKNWHTEALFDR-KFKLVCSELNGRYISNDFKVEVNVIHTAVPVEHANN 825          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: clstn1 (calsyntenin 1 [Source:NCBI gene;Acc:101174913])

HSP 1 Score: 116.701 bits (291), Expect = 4.595e-26
Identity = 186/814 (22.85%), Postives = 333/814 (40.91%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEG-------GIIHINEGDSI------GPHNIKA--------LGTDFTLSWWMKR--QSKLKTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFFTI-SQQW------IMLSTLGISIDGSLLTT--VSRESNLFQFQI-VRIFVGGCMRKSAAHT--HLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSR---TDNIKAFEPSDILIDLSIECESKE-IISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFIS------ETNAESVAKDIKLETCTVRLFQRNLVANERIY-LPTTLLTI------------------LNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVD------MIDERKKFSIICTLKGGDYTSQTI---VEVIQTKFRIIHVANN 2284
            T Y G +  N   V + P L A      +  + +ICGF + G   ++VPF   +LD+ +G G ++ K  ++ D +L+  + F ++A+DC   P       SH A V I V  +NE+ P+F  K+Y  +V +  K +S++   +    AD   ++S   + ++     PF I + G I   + L   K+  + + V A +  K    +  VLV I ++P C+     F  +++Y    G   +            P + + +   P+  +   + L+++ + +         C  D  + +    +CGA   T++LL           G+   N  DS       G   IK         L   FT+S WM+    +  K  I C  D    + +  S+ + NC+L  +  L+    E  T K     W+   +  ++W      +   T  + +DG+      V+ +  L   +I  ++ +G C +   A      RG+    I + G       K + + VI+CL TC E   +   + +A+  KV    N SSL ++ + I    D+  K+    +Y +SR   T  I+      + +  +++C +++  +SVP A   +  + P+ E       ++    S       E + +FP  R +S      E + E  A D   +  TV   Q  +V+ E ++ L    +++                  L    LE+ S+     I G  +   YE +L  ++        + D  +KF ++C+   G Y S      V VI T   + H ANN
Sbjct:   37 TTYHGIVTENDDKVLLDPPLIALDKDAPLRYAGEICGFRIHG---QNVPFEAVVLDKSTGEGVIRAK--DKLDCELQKEHTFTIQAYDCGEGPDGANMKKSHKATVHIQVNDINEYSPVFKEKTYKATVLEGKKYDSILK--VEAVDADCSFQFSQICNYEIVTPDVPFTIDKDGFIKNTEKLSYGKEHMYKLTVTAYDCGKNRASED-VLVKISVKPTCKPSWQGFNKRIEYEPGTGSLALF-----------PSMHLETCDEPVSSIRASVELETNHIGKG--------CDRDTYSEKSLHKLCGATSGTVELLPAPSSSANWTIGLPTDNGHDSDQVFEFNGTQAIKVPNGVVSTNLKEPFTISVWMRHGPGAHEKETILCNSDKTDMNRHHYSLYVHNCRLIFL--LRQDPSEAETYKPAEFHWKLDQVCDKEWHHYVLNVEFPTASLFVDGTTFEPFLVTEDYPLHATKIETQLTIGACWQGGNARMAQFFRGNLAGLIIRSG-------KLENKKVIDCLYTCKEGLDVQLPEEVASSVKVEFNPNQSSLTVEGEDI----DAFDKVMQHISYLNSRQFPTPGIR-----HLRVATTVKCFNEDACVSVPDAEGYVMVLQPE-EPKISLSGIDHFARSAAEFESQEGVTLFPELRIVSTITREVEADTEPEAADGADDDPTV---QETVVSEEIMHNLDFCEVSVMGEELDGEHESLEMDPSQLQQRALEMSSSNLGLIITGVNTMANYEQVLHLIRYKNWHTEALFD--RKFKLVCSELNGRYISNDFKVEVNVIHTAVPVEH-ANN 798          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: clstn2 (calsyntenin-2 [Source:NCBI gene;Acc:101166581])

HSP 1 Score: 103.605 bits (257), Expect = 5.399e-22
Identity = 146/586 (24.91%), Postives = 251/586 (42.83%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLP-----HYSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG----IIHINEG-------DSIGPHNIKALGTDFTLSWWMKR--QSKLKTE---IFCLKD----DHNSISILLENCQLSIMNNLQNVQIEI--PTE------KCQINKWQFFTISQQW--IMLSTLGISIDGSLLTTVSRESNLFQFQI-VRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKP---QTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINN 1690
            T Y G +  N  TV + P L A      +  + +IC F++ G   +  PF   +L+  SG G ++   S+  D + +  Y F ++A+DC + P       SH A V + V  VNEF P+F    Y  SV +    +S++   +     D   +YS   + ++     PF I + G I   + L   KQ  F I V A +  +   +   V+V+IE++PVC+     +  ++DY    G      S QL  + H   L  C    PL  V   + L+++ + +         C  +  + +  + +CGA   + DL             LLT+ G    +I+  +G       D + P N   L   FT++ WMK      L+ E   + C  D    + +  S+ + NC+L  +      QI+   P E      +    +W ++ I+ ++  + L   G++ +  L+T    +  +   +I  ++ VG C +     T      R      G +S  T +P   +TQ VI CL  C E   I + +S+A   K +     S LV++ + +  +  + TK+ YIN+
Sbjct:   78 TSYHGVITENMDTVLLDPPLVALDKDSPLPFAGEICAFKVFG---QDAPFEAVVLNRTSGEGVLRA--SSPVDCESQKEYTFIIQAYDCGAGPDGADWKKSHKAVVHVQVDDVNEFSPVFRESLYKASVTEGKIYDSIL--QVEAWDQDCSPQYSQICNYEIVTPGTPFAIDRNGNIRNTERLSFDKQQSFRIMVSAFDCGQKRTEDD-VMVHIEVKPVCKPGWQGWNKRVDYEPGTG------SKQLFPKMH---LETCG--GPLSGVKAMVELQTNHIGKG--------CDRETYSEKSLQKLCGAASGSTDLLPAPSPSANWTASLLTDSGRESDLIYRFDGHQAANVPDHVVPQN---LTDQFTIATWMKHGPSPGLRAEKETLLCSSDKTEMNRHHYSLYVHNCRLVFLLRRDFTQIDTFRPAEFHWKLDQICDKEWHYYVINVEFPAVTLFVDGVTYEPYLVTD---DWPIHASKIDTQLTVGACWQGGEVET-----PRYTQYFHGSLSGLTIRPGRIETQKVISCLQACKEGLDINSLESLAKDIKFHFNPAQSVLVVEGEDVDSINTAMTKVSYINS 625          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: ENSORLT00000019547.3 (calsyntenin 2 [Source:NCBI gene;Acc:101159373])

HSP 1 Score: 102.064 bits (253), Expect = 1.451e-21
Identity = 183/817 (22.40%), Postives = 330/817 (40.39%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSL--VLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG----IIHINEG-------DSIGPHNIKALGTDFTLSWWMKRQ--SKLKTE---IFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLT---TVSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEI-ISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFISE-TNAESVAKDIK-----LETCTVRLFQRNLVANE---RIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQV-----DMIDERKKFSIICTLKGGDYTSQTI---VEVIQTKFRIIHVANNENPLN--DLAHHQS 2320
            T Y G +  N+  V + P L A      V  + +IC F + G      PF   +L+  SG G+++ +  +  D +L+  Y F ++A DC S P       SH A V I V  VNEF P+F    Y  +V +    +S++   +  +  D   +YS   + ++     PF I + G I   + L    Q  + I V A +  +   K++L  V V+I+++PVC+        ++DY    G      S QL  + H   L  C    PL  V   + L++  + +         C  +  + +  + +CGA+  + DL             LL++ G    +I   +G       D + P N   L   FT++ WMK      L+ E   + C  D    + +  S+ + NC+L  +        +  +  +     E+    +W ++ I+ ++  + L   G++ D  L+T    +       Q  +   + GG + K     + RG        L  +++   K ++Q VI CL  C E   I + +S+    K +     S LV+++  +  +  +  K+ YIN+     T  I+  +     +  +++C  ++  I++P     +  + P  E        E ++        S  I +F +   IS  T A++    ++     L+ C V +    L       +++  + L   L+A       ++Y     G  S   YE ++R V+      +   ER +F + C+   G YTS      V V+     + HV +   P     + HH S
Sbjct:   38 TSYHGVITENTDVVLLDPPLVALDKDAPVPYAGEICAFNIHGL---DAPFEAVVLNGTSGEGQLRAR--SLVDCELQKEYTFIIQAHDCGSGPRGTEGKKSHKAVVHIQVDDVNEFAPVFREPQYHAAVTEGKIYDSILQ--VEATDQDCSPQYSQICNYQITTTNSPFAIDRNGNIRNTEKLSYDSQQHYEILVTAWDCGQ---KRALHPVPVHIDVKPVCKPGWQGLNKRVDYEPGTG------SKQLFPKMH---LETCG--EPLSSVRTTVELQTSHIGKG--------CDRETYSEKSLQKLCGASSGSTDLLPAPSAATNWTASLLSDNGRDSDLIFRFDGHQAAKIPDWVVPQN---LTDQFTIATWMKHGPIPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFIQADAFRPAEFHWKLEQICDKEWHYYVINVEFPAVTLFVDGVTYDPYLVTDDWPIHPSQIDVQLTVGACWQGGEVTKPRFTQYFRG-------SLSGLTVRPGKIESQKVISCLQACKEGLDINSLESLDKSIKFHFNPAQSILVMEADDLQNMNTAVRKVAYINS-RQFPTPGIRRLK-----VSTAVQCFGEDTCITIPDMDAVVMVLQP-SEPRITISGAERLSRPAADFRASGGIFLFQDLHIISTVTRADTTGGVLEEIIHNLDYCDVLVLGEELSPEHESLQLHRSSMLGKHLDATNSTSGMSIY-----GVDSMSTYEQVIRQVRYYNWKPEQQTER-RFRLTCSELNGRYTSNEFNLEVSVLHRSANMEHVNHMVAPPQYMQVVHHPS 802          
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Match: ENSORLT00000036418.1 (calsyntenin 2 [Source:NCBI gene;Acc:101159373])

HSP 1 Score: 99.3673 bits (246), Expect = 8.573e-21
Identity = 138/587 (23.51%), Postives = 245/587 (41.74%), Query Frame = 2
Query:  119 TYYEGYLLSNSKTVFMTPELKA-SVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPH-----YSHGAPVRIHV--VNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKL-----PFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSL--VLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDL-------------LLTEGG----IIHINEG-------DSIGPHNIKALGTDFTLSWWMKRQ--SKLKTE---IFCLKD----DHNSISILLENCQLSIM--------NNLQNVQIEIPTEKCQINKWQFFTISQQW--IMLSTLGISIDGSLLT---TVSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEA--IVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINN 1690
            T Y G +  N+  V + P L A      V  + +IC F + G      PF   +L+  SG G+++ +  +  D +L+  Y F ++A DC S P       SH A V I V  VNEF P+F    Y  +V +    +S++   +  +  D   +YS   + ++     PF I + G I   + L    Q  + I V A +  +   K++L  V V+I+++PVC+        ++DY    G      S QL  + H   L  C    PL  V   + L++  + +         C  +  + +  + +CGA+  + DL             LL++ G    +I   +G       D + P N   L   FT++ WMK      L+ E   + C  D    + +  S+ + NC+L  +        +  +  +     E+    +W ++ I+ ++  + L   G++ D  L+T    +       Q  +   + GG + K     + RG        L  +++   K ++Q VI CL  C E   I + +S+    K +     S LV+++  +  +  +  K+ YIN+
Sbjct:   40 TSYHGVITENTDVVLLDPPLVALDKDAPVPYAGEICAFNIHGL---DAPFEAVVLNGTSGEGQLRAR--SLVDCELQKEYTFIIQAHDCGSGPRGTEGKKSHKAVVHIQVDDVNEFAPVFREPQYHAAVTEGKIYDSILQ--VEATDQDCSPQYSQICNYQITTTNSPFAIDRNGNIRNTEKLSYDSQQHYEILVTAWDCGQ---KRALHPVPVHIDVKPVCKPGWQGLNKRVDYEPGTG------SKQLFPKMH---LETCG--EPLSSVRTTVELQTSHIGKG--------CDRETYSEKSLQKLCGASSGSTDLLPAPSAATNWTASLLSDNGRDSDLIFRFDGHQAAKIPDWVVPQN---LTDQFTIATWMKHGPIPGLRAEKETLLCNSDKTEMNRHHYSLYVHNCRLVFLLRRDFIQADAFRPAEFHWKLEQICDKEWHYYVINVEFPAVTLFVDGVTYDPYLVTDDWPIHPSQIDVQLTVGACWQGGEVTKPRFTQYFRG-------SLSGLTVRPGKIESQKVISCLQACKEGLDINSLESLDKSIKFHFNPAQSILVMEADDLQNMNTAVRKVAYINS 587          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000068054.1 (SMESG000068054.1)

HSP 1 Score: 1854.72 bits (4803), Expect = 0.000e+0
Identity = 914/918 (99.56%), Postives = 915/918 (99.67%), Query Frame = 2
Query:   29 MRVXXXXXXXXXXXXGCQPGVLLSVENSPNTYYEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEGDSIGPHNIKALGTDFTLSWWMKRQSKLKTEIFCLKDDHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFFTISQQWIMLSTLGISIDGSLLTTVSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEIISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFISETNAESVAKDIKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVANNENPLNDLAHHQSRNERAMFQEKSSDESLNLLNISKSKFIAVIIMAVFGGAAWALVTAAITCFVLRKREITKDRKRYNNSKNYSKTNDSNNQQPSLMSTRDVFIDYEFEEDRISMADIPDDEEQNLDNISCETCNMTDPEVIITSSKSIKDIPRSKTITFPIIHKKF 2782
            MRVLLILIS+IFDFIGCQPGVLLSVENSPNTYYEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEGDSIGPHNIKALGTDFTLSWWMKRQSKLKTEIFCLKDDHNSISILLENCQLSIMNNLQNV IEIPTEKCQINKWQFFTISQQWIMLSTLGISIDGSLLTTVSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEIISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFISETNAESVAKDIKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVANNEN LNDLAHHQSRNERAMFQEKSSDESLNLLNISKSKFI VIIMAVFGGAAWALVTAAITCFVLRKREITKDRKRYNNSKNYSKTNDSNNQQPSLMSTRDVFIDYEFEEDRISMADIPDDEEQNLDNISCETCNMTDPEVIITSSKSIKDIPRSKTITFPIIHKKF
Sbjct:    1 MRVLLILISIIFDFIGCQPGVLLSVENSPNTYYEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEGDSIGPHNIKALGTDFTLSWWMKRQSKLKTEIFCLKDDHNSISILLENCQLSIMNNLQNVHIEIPTEKCQINKWQFFTISQQWIMLSTLGISIDGSLLTTVSRESNLFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDILIDLSIECESKEIISVPRAIMRINFIGPQKETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFISETNAESVAKDIKLETCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGEIYENLLRHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVANNENHLNDLAHHQSRNERAMFQEKSSDESLNLLNISKSKFIGVIIMAVFGGAAWALVTAAITCFVLRKREITKDRKRYNNSKNYSKTNDSNNQQPSLMSTRDVFIDYEFEEDRISMADIPDDEEQNLDNISCETCNMTDPEVIITSSKSIKDIPRSKTITFPIIHKKF 918          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000002834.1 (SMESG000002834.1)

HSP 1 Score: 120.553 bits (301), Expect = 7.765e-28
Identity = 132/574 (23.00%), Postives = 240/574 (41.81%), Query Frame = 2
Query:  131 GYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAK-----SLADNPVEYSLQHD----EKLPFQISQLGVISIR--DSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEGDSIGPHNIK---------------ALGTDFTLSWWMKRQSKL----KTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPTEKCQINKWQFFTISQ----QWIMLSTLGIS---------IDGSLLTT-----VSRESNLFQFQI--VRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVASDSIATLSK-VNVKRNGSSLVLKSKSITQLLDSPTKIYYIN 1687
            G+L  N + V +TPEL+  + + +S S +ICG  +        PF   + D+  G  ++++K +  + + L   Y F +E +DCD  PH+S    V + + +  GP F   SY F+V       + IG + A      S +  P +   ++D      +PF I + G +  +  + L N  ++ +   V A +  K  P+ + VLV +++   C       P  + Y   +G+  +        Q   P L VCS       ++  I   +  + +       E C  D+ +   +  +C A P  ++LL    G     +   IG H                    G  F+L++WMK  + L    K +I C  D    + +  S+ L NC+L ++  ++N   E   +K   ++W+F  + Q    +W      GI+         IDG + +      V R+       I   R+ VG C      H+    + ++    L  + L  +  +  + + CL+TCGE+++    +  L+K  +V      ++++S +I  L    +K+ YIN
Sbjct:   39 GHLNENERIVKLTPELRIILAENISHSMEICGVYIHHEIYSLFPFVHEITDKKRGSIQIKLKDNVNYAD-LMDRYTFQIEVYDCDQPPHFSEKKYVLVEIGSVNGPRFLESSYHFTVNYSVPEGTKIGEISAYERPGISQSSQPNQGICKYDILPVNSVPFFIDKYGSLHTQKVEYLPNVMRT-YKFYVRATDCDKYQPRIASVLVIVDVRDSCTVHWEGLPKSIKYIRNSGVMPLFS-----MQSTSPSLHVCSSNC----LSFNIFFTARIVGKNIKFAAPELCKHDLNSIHRREVLCDAYPGAVNLL---KGAPDSMKDHQIGGHRFSFSYVSVENTFDNTNYLFGKRFSLTFWMKHGNMLLNDPKQQILCNSDLKVMNRHHTSVFLHNCKLILLIRVENGGSE--QDKFMPSEWRFGPLRQVCDNEW---HHYGITMNDGNPILQIDGEIWSKPPEVLVERQLKKLPENITGTRLTVGSCY-----HSKSNEYTQNFFGHLAGMRLIRDFVEAVNTVRCLATCGESLLLPHIVEALAKDSSVTMFSDYVIVRSININDLKLMFSKLSYIN 588          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000057121.1 (SMESG000057121.1)

HSP 1 Score: 89.3521 bits (220), Expect = 9.932e-18
Identity = 135/640 (21.09%), Postives = 256/640 (40.00%), Query Frame = 2
Query:  122 YYEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIA----KSLADNPVEYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRPVLTVCSLPS---PLKEVTLRISLKSHSLSEKDHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLT---------------------EGGIIHINEGDSIGPHNIKALGTDFTLSWWMKRQ------SKLKTEIFCLKD----DHNSISILLENCQLSIMNNLQNVQIEIPT-----------EKCQINKWQFFTI---------------SQQWIMLSTL---GIS----IDGSLLTTVSRESNLFQFQIVRIFVGGCMRKSAAH--THLRGHKRSPIAKLGVISLATEKPQTQDVIECLSTCGEAIVAS--DSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIYYINNYYSSRTDNIKAFEPSDIL-IDLSIECE-SKEIISVPRAIMRI 1810
            ++ G++  +S  V +TP +K      +    K+C F L     + +PF V L     G+G + +      DN     YEF ++A  CD    YS    V +  +    PI+    Y   V  D    S +  + A    ++  ++  +Y +      PF I   GV+   + L   K  ++++RV+A +     P+ S V VNIE++ VC+        Q++Y   +GI  +         G       C   +     KE +++++LK+            + C  DI + R Q   CG N  T +LL +                     +G   H     ++ P N   LG +FT+S+WMK           K +I C  D    + +  S+ L NC+L  +   + +  +  T           E C    W  +++                Q  I  + L   GIS    +D   +   S    + Q    ++ +G C +   ++   H RG       +L  +++   + ++  VI+C++ C E +  +  D +A  + +++    SS+++ +  I  +     +I + N+        ++ F    ++ +D +I+C  S+++ +VP+ ++ I
Sbjct:   34 HFTGFIDEHSDFVKVTPGIKLKTKPDL----KLCNFILTSENGQELPFLVNLESSTKGIGFIHITGPVHMDN-----YEFYIKAKTCDQ-DIYSKELKVILKKIKGEVPIWERLVYNAVVNDDIHPGSEVIRLKAYEPGRTTGNSICDYKIVVPIDAPFDIDGNGVVRSTNYLDARKHRNYVLRVMAIDCWIPKPRNSSVSVNIEVKRVCRFGWNGIFQQINYVPGSGIRLL---------GKDIKFDACDKTTDECETKESSVQLTLKNSDT---------KMCDKDIESLRSQWDTCGVNNQTTELLPSAEQFTREAHGSADSLTGVYSFDGKNTHWEIPTNVIPQN-HFLGENFTISFWMKHDKFDGDTKHKKEQILCNSDGDGKNRHHYSLFLHNCKLIFLYRTEPLTKQTSTLTPAEWRFKSIEFCD-GGWHHYSLVVKMKYIDNLAEVDAQQNQIHRTQLFIDGISFQNDVDNPDIIDDSPMHEIPQVHFTKLVIGACWKSKTSNYIQHFRG-------QLSGMTVLRGQLESTSVIQCINKCHEHLTFTGVDKMAPGTSLSINSVMSSMIITASRIKDIERIIEQIGFTNS-------RLRPFPGKRVIQVDTTIKCLISQKVYNVPQKMINI 629          
BLAST of Calsyntenin 1 vs. Planmine SMEST
Match: SMESG000007793.1 (SMESG000007793.1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.559e-17
Identity = 99/420 (23.57%), Postives = 182/420 (43.33%), Query Frame = 2
Query:  125 YEGYLLSNSKTVFMTPELKASVVKGVSKSEKICGFEL-----RGRTIESVPFAVYLLDELSGVGEMQVKYSNEFDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFSVKKDAKRNSVIGTVIAKSLA--------DNPV-EYSLQHDEKLPFQISQLGVISIRDSLINTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDYYIKNGIANMMESGQLIQQGHRP------VLTVCSLPSPLKEVTLRISLKSHSL-SEKDHSFKEEFCPTDIPANRIQRAICGANPD-TIDLL----LTEGGIIHINEGDSIGPHNIKALGTDFTLSWWMKRQS---KLKTEIFCLKDDHNSI--SILLENCQLSI-MNNLQNVQIEIPTEKCQINKWQF 1288
            Y+G++ ++S    ++P L+  +  G    E+IC F+L        T++  PF   +     G+GE+++  +    N         +    C +   ++  A + I V++   P++   SY  ++  DA    +IG+ + K  A        DN + +Y +++    PF I   G IS R +L+N+  +  ++ V A++ S    +QS V V I I P+C+   T F     Y   +G+  + +  +       P      ++  C L    + VT+ I  K   L S++  +   + C  D  + ++QR IC  N +  +DLL      + G+I      ++ P         F+L +WM R++        I C   +   I  S+ +  C L I +N+  NVQ     E  Q+  W++
Sbjct:   32 YKGFIYTDSSVAVISPNLQVILKSG----EEICNFQLTKSDYNRETLDYNPFRAVVKSAHLGLGEIELLANINLSNFTNADINLIITGQACHNPDSWTEPAEISIKVIDPPEPLWTKSSYVATITNDA----IIGSPVIKVTAYLPPLADPDNKICQYHIENSSNSPFTIDGSGTISTRQNLLNSDVTLVILDVTAEDCSLPTHRQSTVKVFITITPICKIGWTGFYKIFQYLSGSGVIPIGKKLEFRFCSKNPKNNLNQIIENCKLKKKFR-VTVSIEFKDLFLFSQESTTNDNDICYLDYKSLKLQRKICDINDNKAVDLLNALAKQKTGVIKFPLETNMFPGLSMVKQDKFSLLFWMLRKTPEENFDEFIVCHLHESGDILFSVSISFCNLRIFLNSSSNVQ-----ENSQLFFWEY 437          
The following BLAST results are available for this feature:
BLAST of Calsyntenin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLSTN21.763e-2321.78calsyntenin 2 [Source:HGNC Symbol;Acc:HGNC:17448][more]
CLSTN33.080e-2120.61calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371][more]
CLSTN33.080e-2120.61calsyntenin 3 [Source:HGNC Symbol;Acc:HGNC:18371][more]
CLSTN12.302e-1721.71calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447][more]
CLSTN18.728e-1721.57calsyntenin 1 [Source:HGNC Symbol;Acc:HGNC:17447][more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
casy-12.005e-1124.27CAlSYntenin/Alcadein homolog; Calsyntenin [Source... [more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cals6.133e-1223.02gene:FBgn0039928 transcript:FBtr0333700[more]
Cals6.731e-1223.42gene:FBgn0039928 transcript:FBtr0089207[more]
Cals6.731e-1223.42gene:FBgn0039928 transcript:FBtr0089208[more]
Cals6.731e-1223.42gene:FBgn0039928 transcript:FBtr0345193[more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn15.853e-2722.98calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-106... [more]
clstn16.856e-2722.94calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-106... [more]
clstn12.948e-2622.58calsyntenin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-106... [more]
clstn24.533e-2223.98calsyntenin 2 [Source:ZFIN;Acc:ZDB-GENE-070911-2][more]
si:ch211-276c2.22.262e-2121.88si:ch211-276c2.2 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLSTN15.084e-3122.21calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
CLSTN12.136e-3022.04calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
CLSTN12.784e-3022.22calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
CLSTN11.038e-2921.99calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
CLSTN15.101e-2921.78calsyntenin 3 [Source:NCBI gene;Acc:100145668][more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clstn21.588e-2221.55calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897][more]
Clstn21.894e-2221.55calsyntenin 2 [Source:MGI Symbol;Acc:MGI:1929897][more]
Clstn32.116e-2220.90calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323][more]
Clstn38.037e-2120.78calsyntenin 3 [Source:MGI Symbol;Acc:MGI:2178323][more]
Clstn13.314e-1622.28calsyntenin 1 [Source:MGI Symbol;Acc:MGI:1929895][more]
back to top
BLAST of Calsyntenin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H4D0|CSTN2_HUMAN8.467e-2321.78Calsyntenin-2 OS=Homo sapiens OX=9606 GN=CLSTN2 PE... [more]
sp|Q9ER65|CSTN2_MOUSE1.325e-2121.55Calsyntenin-2 OS=Mus musculus OX=10090 GN=Clstn2 P... [more]
sp|Q99JH7|CSTN3_MOUSE1.480e-2120.90Calsyntenin-3 OS=Mus musculus OX=10090 GN=Clstn3 P... [more]
sp|Q8VDA1|CSTN2_RAT1.598e-2121.04Calsyntenin-2 OS=Rattus norvegicus OX=10116 GN=Cls... [more]
sp|Q5R9Q9|CSTN3_PONAB2.626e-2120.70Calsyntenin-3 OS=Pongo abelii OX=9601 GN=CLSTN3 PE... [more]
back to top
BLAST of Calsyntenin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R9X61.349e-3422.78Calsyntenin-3 OS=Fasciola hepatica OX=6192 GN=D915... [more]
A0A0P4W2K22.177e-2922.05Uncharacterized protein OS=Scylla olivacea OX=8555... [more]
A0A3S3QCK72.478e-2921.89Calsyntenin-1-like protein OS=Dinothrombium tincto... [more]
A0A443SUR09.020e-2921.45Calsyntenin-1-like protein (Fragment) OS=Leptotrom... [more]
A0A2D0SI561.190e-2822.84calsyntenin-1 isoform X3 OS=Ictalurus punctatus OX... [more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn14.292e-3022.63calsyntenin 1 [Source:NCBI gene;Acc:103033297][more]
clstn14.934e-2922.22calsyntenin 1 [Source:NCBI gene;Acc:103033297][more]
clstn25.506e-2323.70calsyntenin 2 [Source:NCBI gene;Acc:103023918][more]
clstn26.288e-2323.70calsyntenin 2 [Source:NCBI gene;Acc:103023918][more]
clstn27.290e-2323.70calsyntenin 2 [Source:NCBI gene;Acc:103023918][more]
back to top
BLAST of Calsyntenin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calsyntenin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calsyntenin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calsyntenin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn13.084e-2622.12calsyntenin 1 [Source:NCBI gene;Acc:101174913][more]
clstn14.595e-2622.85calsyntenin 1 [Source:NCBI gene;Acc:101174913][more]
clstn25.399e-2224.91calsyntenin-2 [Source:NCBI gene;Acc:101166581][more]
ENSORLT00000019547.31.451e-2122.40calsyntenin 2 [Source:NCBI gene;Acc:101159373][more]
ENSORLT00000036418.18.573e-2123.51calsyntenin 2 [Source:NCBI gene;Acc:101159373][more]
back to top
BLAST of Calsyntenin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000068054.10.000e+099.56SMESG000068054.1[more]
SMESG000002834.17.765e-2823.00SMESG000002834.1[more]
SMESG000057121.19.932e-1821.09SMESG000057121.1[more]
SMESG000007793.11.559e-1723.57SMESG000007793.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017636 ID=SMED30017636|Name=Calsyntenin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3071bp
CTTGACATTAGATCATTTTTGAAATTAAATGAGAGTATTGTTGATTTTAA
TTTCGCTAATTTTTGATTTCATAGGCTGTCAGCCGGGGGTCCTGCTGTCG
GTGGAGAATTCACCAAATACCTATTACGAAGGCTATCTGTTGAGCAACAG
TAAAACGGTTTTCATGACACCAGAATTGAAAGCGAGTGTGGTAAAAGGTG
TCAGCAAATCTGAGAAAATCTGCGGATTTGAATTGCGTGGTCGGACAATT
GAGAGTGTCCCATTCGCTGTTTATCTACTGGATGAGTTGTCGGGCGTCGG
AGAAATGCAGGTAAAATACAGCAATGAATTCGACAATCAACTGAAACCGT
TATACGAATTCAATGTCGAGGCATTCGACTGTGACAGTTTGCCACATTAT
TCTCATGGGGCTCCAGTGCGTATCCACGTGGTCAATGAATTTGGACCGAT
ATTTTACAATAAATCCTACACATTCTCTGTGAAAAAGGATGCGAAAAGAA
ATTCGGTCATAGGAACGGTGATAGCGAAATCCCTTGCCGATAATCCCGTC
GAGTATTCCTTACAACATGACGAGAAATTGCCTTTCCAAATCAGCCAATT
GGGTGTAATATCAATTCGGGACTCTTTAATCAACACGAAGCAATCGGATT
TCTTGATTAGGGTCGTTGCAAAGGAAAGGAGCAAAGGCATTCCAAAGCAA
TCATTGGTTCTTGTCAATATCGAAATCGAGCCGGTTTGCCAAAATAAACT
TACCGATTTTCCTGACCAACTTGATTACTATATCAAAAACGGAATAGCCA
ATATGATGGAATCTGGCCAACTTATCCAGCAAGGTCACAGGCCAGTGTTG
ACTGTGTGTAGTTTACCGTCGCCGTTGAAGGAAGTCACATTACGAATCTC
CTTAAAATCTCATTCATTATCCGAGAAAGATCACTCATTTAAAGAAGAAT
TTTGCCCAACAGATATACCGGCTAATAGGATTCAGAGGGCAATCTGTGGT
GCTAATCCGGATACAATAGATCTTTTATTAACGGAAGGGGGTATTATTCA
TATTAATGAAGGAGATTCTATTGGACCGCACAATATCAAGGCGCTAGGAA
CGGATTTTACTCTTAGCTGGTGGATGAAAAGACAAAGTAAATTAAAAACG
GAAATTTTTTGTCTTAAAGATGATCATAATTCGATATCCATATTACTTGA
AAATTGTCAGCTATCGATTATGAATAATTTACAGAATGTTCAAATTGAAA
TTCCTACAGAAAAGTGCCAGATCAATAAATGGCAATTTTTCACAATTAGC
CAACAATGGATCATGTTGTCAACTTTGGGGATATCAATTGATGGATCACT
GTTGACAACTGTCAGTAGGGAATCCAATCTCTTTCAGTTTCAAATTGTAA
GGATATTTGTTGGTGGCTGTATGAGAAAATCTGCTGCTCACACTCATTTG
AGAGGCCATAAGAGGAGTCCTATTGCAAAACTGGGAGTCATATCTCTAGC
GACCGAGAAGCCCCAAACACAAGATGTTATCGAATGCTTATCAACTTGCG
GAGAAGCTATAGTTGCATCTGATTCAATTGCGACTTTGTCTAAAGTAAAT
GTTAAGAGAAATGGTTCTTCACTTGTCTTAAAAAGCAAAAGCATAACTCA
ATTGCTGGATTCCCCGACGAAAATTTATTACATAAACAACTATTATTCGT
CAAGAACCGACAATATCAAAGCATTTGAGCCCTCAGATATTTTGATAGAT
CTTTCAATTGAGTGTGAATCGAAAGAAATAATCAGTGTACCTCGTGCGAT
AATGAGAATCAACTTTATTGGGCCCCAGAAAGAAACCGGAAACGACACGA
TAGATGTGGAAATAGTTACCAACTCCACAATCACCACCACAAAATCGGAA
TCTATTCGAATATTTCCAAATTTTCGATTTATTAGTGAAACAAATGCGGA
GTCGGTTGCAAAGGACATAAAGTTGGAAACGTGTACGGTCCGTTTGTTTC
AACGTAACCTCGTGGCAAATGAAAGGATATATTTACCAACAACTCTTTTG
ACAATATTAAATGCAGCGAAACTAGAAATCAAATCAAATCTCTATTTATG
GGCTATTGAAGGGGAAGCAAGCGGAGAAATTTATGAAAACCTTCTTAGAC
ATGTCCAAGTCGATATGATTGATGAAAGGAAAAAATTTAGCATTATTTGC
ACCTTGAAGGGGGGCGATTATACAAGTCAAACAATTGTAGAAGTCATTCA
AACAAAGTTTCGGATAATTCATGTTGCAAACAACGAAAATCCTCTCAACG
ACCTCGCTCACCATCAATCGAGAAACGAAAGAGCGATGTTCCAAGAAAAA
TCCTCGGATGAATCTCTAAATTTGTTGAATATTAGCAAGTCAAAATTCAT
TGCTGTCATAATTATGGCAGTTTTCGGTGGGGCAGCTTGGGCATTAGTTA
CAGCTGCGATCACCTGTTTTGTTCTACGGAAAAGAGAAATAACAAAAGAT
CGAAAAAGATATAATAATTCAAAAAATTACTCGAAAACAAATGATTCAAA
CAATCAGCAGCCTTCGTTAATGAGTACTCGAGACGTTTTTATAGATTATG
AGTTCGAAGAAGACCGCATCTCAATGGCTGATATTCCAGATGACGAGGAA
CAGAATCTTGACAACATATCCTGTGAAACATGCAACATGACAGATCCAGA
AGTCATCATAACTTCATCAAAGTCCATCAAAGATATACCTCGTTCAAAAA
CGATTACCTTTCCCATTATTCATAAGAAATTTTAGAAGTCAAACGAAAGG
AAATAACAAATTTATTTATTTTACTGATTCTCGTTTGAATTTTATTTTAA
TTTTCAGTTCATTTATTTTGTTTTGTTTAAATGTTACCATTTACTTTTCA
TTATGAGTTGTTGGCATTTTGTGAGAGGATCATACGCTTTTATGTTTGAT
ATTCATTGCGTTTGTACGTATCCATACTTTCTTCTATGCTTGGACTGGCA
ACGTATTAATATCATTTGTAATACGATTACTTATTGAACTAATACATTGT
TTCGAAGTTGTTCAAATTCTG
back to top

protein sequence of SMED30017636-orf-1

>SMED30017636-orf-1 ID=SMED30017636-orf-1|Name=SMED30017636-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=919bp
MRVLLILISLIFDFIGCQPGVLLSVENSPNTYYEGYLLSNSKTVFMTPEL
KASVVKGVSKSEKICGFELRGRTIESVPFAVYLLDELSGVGEMQVKYSNE
FDNQLKPLYEFNVEAFDCDSLPHYSHGAPVRIHVVNEFGPIFYNKSYTFS
VKKDAKRNSVIGTVIAKSLADNPVEYSLQHDEKLPFQISQLGVISIRDSL
INTKQSDFLIRVVAKERSKGIPKQSLVLVNIEIEPVCQNKLTDFPDQLDY
YIKNGIANMMESGQLIQQGHRPVLTVCSLPSPLKEVTLRISLKSHSLSEK
DHSFKEEFCPTDIPANRIQRAICGANPDTIDLLLTEGGIIHINEGDSIGP
HNIKALGTDFTLSWWMKRQSKLKTEIFCLKDDHNSISILLENCQLSIMNN
LQNVQIEIPTEKCQINKWQFFTISQQWIMLSTLGISIDGSLLTTVSRESN
LFQFQIVRIFVGGCMRKSAAHTHLRGHKRSPIAKLGVISLATEKPQTQDV
IECLSTCGEAIVASDSIATLSKVNVKRNGSSLVLKSKSITQLLDSPTKIY
YINNYYSSRTDNIKAFEPSDILIDLSIECESKEIISVPRAIMRINFIGPQ
KETGNDTIDVEIVTNSTITTTKSESIRIFPNFRFISETNAESVAKDIKLE
TCTVRLFQRNLVANERIYLPTTLLTILNAAKLEIKSNLYLWAIEGEASGE
IYENLLRHVQVDMIDERKKFSIICTLKGGDYTSQTIVEVIQTKFRIIHVA
NNENPLNDLAHHQSRNERAMFQEKSSDESLNLLNISKSKFIAVIIMAVFG
GAAWALVTAAITCFVLRKREITKDRKRYNNSKNYSKTNDSNNQQPSLMST
RDVFIDYEFEEDRISMADIPDDEEQNLDNISCETCNMTDPEVIITSSKSI
KDIPRSKTITFPIIHKKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR026914Calsyntenin
IPR002126Cadherin-like_dom
IPR013320ConA-like_dom_sf
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 139..233
e-value: 1.3E-9
score: 40.5
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 143..244
score: 8.533
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 146..236
e-value: 1.45421E-8
score: 51.1602
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.746
NoneNo IPR availableTMHMMTMhelixcoord: 794..816
IPR026914CalsynteninPANTHERPTHR14139CALSYNTENINcoord: 23..797
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 130..240