AP-2 complex subunit mu

Overview
NameAP-2 complex subunit mu
Smed IDSMED30017634
Length (bp)1935
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AP-2 complex subunit mu (SMED30017634) t-SNE clustered cells

Violin plots show distribution of expression levels for AP-2 complex subunit mu (SMED30017634) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AP-2 complex subunit mu (SMED30017634) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AP-2 complex subunit mu (SMED30017634) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017634

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017634SMESG000032693.1 Contig424GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30017634SMESG000032693.1 SMESG000032694.1 dd_Smed_v4_1271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017634SMESG000032693.1 SMESG000032694.1 dd_Smed_v4_1271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017634SMESG000032693.1 SMESG000032694.1 dd_Smed_v4_1271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AP-2 complex subunit mu vs. Ensembl Human
Match: AP2M1 (adaptor related protein complex 2 subunit mu 1 [Source:HGNC Symbol;Acc:HGNC:564])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 337/442 (76.24%), Postives = 392/442 (88.69%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 433          
BLAST of AP-2 complex subunit mu vs. Ensembl Human
Match: AP2M1 (adaptor related protein complex 2 subunit mu 1 [Source:HGNC Symbol;Acc:HGNC:564])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 337/442 (76.24%), Postives = 392/442 (88.69%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 433          
BLAST of AP-2 complex subunit mu vs. Ensembl Human
Match: AP2M1 (adaptor related protein complex 2 subunit mu 1 [Source:HGNC Symbol;Acc:HGNC:564])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 337/443 (76.07%), Postives = 392/443 (88.49%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKST-TKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS  TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 434          
BLAST of AP-2 complex subunit mu vs. Ensembl Human
Match: AP2M1 (adaptor related protein complex 2 subunit mu 1 [Source:HGNC Symbol;Acc:HGNC:564])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 337/444 (75.90%), Postives = 392/444 (88.29%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS   TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 435          
BLAST of AP-2 complex subunit mu vs. Ensembl Human
Match: AP2M1 (adaptor related protein complex 2 subunit mu 1 [Source:HGNC Symbol;Acc:HGNC:564])

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 337/469 (71.86%), Postives = 392/469 (83.58%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLS-------------------------RNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKST--TKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+                          RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS   TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGSRQAADSAVFSSSGPFPGEWLEANRRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 460          
BLAST of AP-2 complex subunit mu vs. Ensembl Celegans
Match: dpy-23 (AP-2 complex subunit mu [Source:UniProtKB/Swiss-Prot;Acc:P35603])

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 340/443 (76.75%), Postives = 394/443 (88.94%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGD-RQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG F+YNHKGEVLISRI+R+D++RN VDAFRVNVIHARQQVRSPVTN+ARTSFFHVKRG++W+CAV R NVNA MVF+FL R  D M  YFGK+NEEN+KNNFVLIYELLDEILD+GYPQNTD G+LKT+ITQ G+++ TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDVIE VNLLM+ QGQ+LSAHVAGKV MKS+LSGMP+CKFG NDK+++E K++    D         NK+S +++AIDDCQFHQCVKL +FETEH ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+ +++MEVK+VVK+NFKP+  AQK+EVRIPTP NTSGVQ+ICMKGKAKYKA ENAIVWKIKRMAGMK+ Q+SAEIDLL+ G+  +K+W RPP+SMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SGLYETRC
Sbjct:    1 MIGGLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHVKRGNVWICAVTRQNVNAAMVFEFLKRFADTMQSYFGKLNEENVKNNFVLIYELLDEILDFGYPQNTDPGVLKTFITQQGVRTATKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVIEYVNLLMNQQGQVLSAHVAGKVAMKSYLSGMPECKFGINDKITIEGKSKPGSDD--------PNKASRAAVAIDDCQFHQCVKLTKFETEHAISFIPPDGEYELMRYRTTKDIQLPFRVIPLVREVSRNKMEVKVVVKSNFKPSLLAQKLEVRIPTPPNTSGVQLICMKGKAKYKAGENAIVWKIKRMAGMKESQISAEIDLLSTGNVEKKKWNRPPVSMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGLYETRC 435          
BLAST of AP-2 complex subunit mu vs. Ensembl Celegans
Match: dpy-23 (AP-2 complex subunit mu [Source:UniProtKB/Swiss-Prot;Acc:P35603])

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 340/449 (75.72%), Postives = 394/449 (87.75%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKST------TKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGD-RQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG F+YNHKGEVLISRI+R+D++RN VDAFRVNVIHARQQVRSPVTN+ARTSFFHVKRG++W+CAV R NVNA MVF+FL R  D M  YFGK+NEEN+KNNFVLIYELLDEILD+GYPQNTD G+LKT+ITQ G+++       TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDVIE VNLLM+ QGQ+LSAHVAGKV MKS+LSGMP+CKFG NDK+++E K++    D         NK+S +++AIDDCQFHQCVKL +FETEH ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+ +++MEVK+VVK+NFKP+  AQK+EVRIPTP NTSGVQ+ICMKGKAKYKA ENAIVWKIKRMAGMK+ Q+SAEIDLL+ G+  +K+W RPP+SMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SGLYETRC
Sbjct:    1 MIGGLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHVKRGNVWICAVTRQNVNAAMVFEFLKRFADTMQSYFGKLNEENVKNNFVLIYELLDEILDFGYPQNTDPGVLKTFITQQGVRTADAPVPVTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVIEYVNLLMNQQGQVLSAHVAGKVAMKSYLSGMPECKFGINDKITIEGKSKPGSDD--------PNKASRAAVAIDDCQFHQCVKLTKFETEHAISFIPPDGEYELMRYRTTKDIQLPFRVIPLVREVSRNKMEVKVVVKSNFKPSLLAQKLEVRIPTPPNTSGVQLICMKGKAKYKAGENAIVWKIKRMAGMKESQISAEIDLLSTGNVEKKKWNRPPVSMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGLYETRC 441          
BLAST of AP-2 complex subunit mu vs. Ensembl Celegans
Match: unc-101 (AP-1 complex subunit mu-1-I [Source:UniProtKB/Swiss-Prot;Acc:P35602])

HSP 1 Score: 324.709 bits (831), Expect = 7.646e-105
Identity = 170/442 (38.46%), Postives = 254/442 (57.47%), Query Frame = 2
Query:   74 GGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRS--PVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
               FI + KG+ +ISR +R D+    +D F ++++  +++  S  PV     T+F  +K  +I+L +  R+NVN  M+  FL++ ++V  +YF  V EE++++NFV+IYELLDE++D+G+PQ T++ IL+ YITQ G K  +          VT  + WR EGIKYR+NE+FLDVIESVN+L S  G +L + + G V M+ +L+GMP+ + G NDK+  E   R                     + ++D +FHQCV+L RF+T+ TISFIPPDG FELM YR T  +     +   +     SR+   +  K+ FK    A  VE+ IP P++    +     G  KY   ++A VW IK   G K+  L+A + L +V   +    RPPI + FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G YE R
Sbjct:    4 SAMFILDLKGKTIISRNYRGDIDMTAIDKF-IHLLMEKEEEGSAAPVLTYQDTNFVFIKHTNIYLVSACRSNVNVTMILSFLYKCVEVFSEYFKDVEEESVRDNFVVIYELLDEMMDFGFPQTTESRILQEYITQEGQKLISAPRPPM---AVTNAVSWRSEGIKYRKNEVFLDVIESVNMLASANGTVLQSEIVGSVKMRVYLTGMPELRLGLNDKVLFEGSGRGKSKS----------------VELEDVKFHQCVRLSRFDTDRTISFIPPDGAFELMSYRLTTVVKPLIWIETSIERHSHSRVSFIIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGSVKYTPEQSAFVWTIKNFPGGKEYLLTAHLSLPSVMSEESE-GRPPIKVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGEYEMR 420          
BLAST of AP-2 complex subunit mu vs. Ensembl Celegans
Match: unc-101 (AP-1 complex subunit mu-1-I [Source:UniProtKB/Swiss-Prot;Acc:P35602])

HSP 1 Score: 324.709 bits (831), Expect = 7.646e-105
Identity = 170/442 (38.46%), Postives = 254/442 (57.47%), Query Frame = 2
Query:   74 GGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRS--PVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
               FI + KG+ +ISR +R D+    +D F ++++  +++  S  PV     T+F  +K  +I+L +  R+NVN  M+  FL++ ++V  +YF  V EE++++NFV+IYELLDE++D+G+PQ T++ IL+ YITQ G K  +          VT  + WR EGIKYR+NE+FLDVIESVN+L S  G +L + + G V M+ +L+GMP+ + G NDK+  E   R                     + ++D +FHQCV+L RF+T+ TISFIPPDG FELM YR T  +     +   +     SR+   +  K+ FK    A  VE+ IP P++    +     G  KY   ++A VW IK   G K+  L+A + L +V   +    RPPI + FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G YE R
Sbjct:    4 SAMFILDLKGKTIISRNYRGDIDMTAIDKF-IHLLMEKEEEGSAAPVLTYQDTNFVFIKHTNIYLVSACRSNVNVTMILSFLYKCVEVFSEYFKDVEEESVRDNFVVIYELLDEMMDFGFPQTTESRILQEYITQEGQKLISAPRPPM---AVTNAVSWRSEGIKYRKNEVFLDVIESVNMLASANGTVLQSEIVGSVKMRVYLTGMPELRLGLNDKVLFEGSGRGKSKS----------------VELEDVKFHQCVRLSRFDTDRTISFIPPDGAFELMSYRLTTVVKPLIWIETSIERHSHSRVSFIIKAKSQFKRRSTANNVEIIIPVPSDADSPKFKTSIGSVKYTPEQSAFVWTIKNFPGGKEYLLTAHLSLPSVMSEESE-GRPPIKVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGEYEMR 420          
BLAST of AP-2 complex subunit mu vs. Ensembl Celegans
Match: apm-1 (AdaPtin, Mu/medium chain (Clathrin associated complex) [Source:UniProtKB/TrEMBL;Acc:O01755])

HSP 1 Score: 319.316 bits (817), Expect = 1.084e-102
Identity = 170/446 (38.12%), Postives = 260/446 (58.30%), Query Frame = 2
Query:   71 IGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKL----SLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
            I G FI + KG V+ISR +R D+  + ++ F   ++    +   SPV      S+ ++K  +++L  +++ N N ++V   L+++++V  +YF  + EE +++NFV+IYEL DE+LD+GYPQ T++ IL+ +ITQ G     + ET +    VT  + WR EGIKYR+NE+FLDVIESVN+L + QG +L + + G +  +  LSGMP+ + G NDK+    S  S  R + G                 + ++D +FHQCV+L RF++E TISFIPPDGEFELM YR T ++     V   V     SR+E  +  K+ FK    A  VEV IP P++ S  +     G AKY    NAIVW I+   G ++  + +   L ++G  +    RPPI++ FE+P +  SG +VRYLK+ E     S ++ + WVRY+ ++G Y+ R
Sbjct:    3 ISGLFILDLKGNVVISRNYRGDVDMSCIEKFMPLLVEKEDEGSASPVLVHQGISYTYIKYMNVYLVTISKKNTNVILVLSALYKIVEVFCEYFKTLEEEAVRDNFVIIYELFDEMLDFGYPQTTESKILQEFITQQG----NRLETVRPPMAVTNAVSWRSEGIKYRKNEVFLDVIESVNMLANAQGTVLRSEIVGSIRFRVVLSGMPELRLGLNDKVFFQQSGASSRRGNSGK---------------GVELEDIKFHQCVRLSRFDSERTISFIPPDGEFELMSYRLTTQVKPLIWVEAAVERHAHSRVEYMVKAKSQFKRQSVANHVEVIIPVPSDVSAPKFKTGAGTAKYVPELNAIVWSIRSFPGGREYIMRSSFMLPSIGSEELE-GRPPINVKFEIPYYTTSGLQVRYLKIIEK----SGYQALPWVRYVTQNGDYQMR 424          
BLAST of AP-2 complex subunit mu vs. Ensembl Fly
Match: AP-2mu (gene:FBgn0263351 transcript:FBtr0084252)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 340/442 (76.92%), Postives = 395/442 (89.37%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG F+YNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFH+KR +IWL AV + NVNA MVF+FL ++++VM  YFGK++EENIKNNFVLIYELLDEILD+GYPQNTD+G LKT+ITQ GIKS TKEE  QIT+QVTGQIGWRREGIKYRRNELFLDV+E VNLLMSPQGQ+LSAHVAGKV+MKS+LSGMP+CKFG NDK+ +ESK R   G+      +  ++S    + IDDCQFHQCVKL +FETEH+ISFIPPDGEFELMRYRTTK+I+LPFRVIPLVRE+G+++MEVK+V+K+NFKP+   QK+EV+IPTP NTSGVQ+IC+KGKAKYKA+ENAIVWKIKRMAGMK+ QLSAEI+LL   D +K+WTRPPISMNFEVPFAPSGFKVRYLKVFE KLNYSDH+V+KWVRYIG+SGLYETRC
Sbjct:    1 MIGGLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANIWLAAVTKQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGYPQNTDSGTLKTFITQQGIKSATKEEQMQITSQVTGQIGWRREGIKYRRNELFLDVLEYVNLLMSPQGQVLSAHVAGKVVMKSYLSGMPECKFGINDKIVMESKGRGLSGN----SEAETSRSGKPVVVIDDCQFHQCVKLSKFETEHSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRTKMEVKVVLKSNFKPSLLGQKIEVKIPTPLNTSGVQLICLKGKAKYKASENAIVWKIKRMAGMKETQLSAEIELLET-DTKKKWTRPPISMNFEVPFAPSGFKVRYLKVFEPKLNYSDHDVVKWVRYIGRSGLYETRC 437          
BLAST of AP-2 complex subunit mu vs. Ensembl Fly
Match: AP-2mu (gene:FBgn0263351 transcript:FBtr0084253)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 340/442 (76.92%), Postives = 395/442 (89.37%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG F+YNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFH+KR +IWL AV + NVNA MVF+FL ++++VM  YFGK++EENIKNNFVLIYELLDEILD+GYPQNTD+G LKT+ITQ GIKS TKEE  QIT+QVTGQIGWRREGIKYRRNELFLDV+E VNLLMSPQGQ+LSAHVAGKV+MKS+LSGMP+CKFG NDK+ +ESK R   G+      +  ++S    + IDDCQFHQCVKL +FETEH+ISFIPPDGEFELMRYRTTK+I+LPFRVIPLVRE+G+++MEVK+V+K+NFKP+   QK+EV+IPTP NTSGVQ+IC+KGKAKYKA+ENAIVWKIKRMAGMK+ QLSAEI+LL   D +K+WTRPPISMNFEVPFAPSGFKVRYLKVFE KLNYSDH+V+KWVRYIG+SGLYETRC
Sbjct:    1 MIGGLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANIWLAAVTKQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGYPQNTDSGTLKTFITQQGIKSATKEEQMQITSQVTGQIGWRREGIKYRRNELFLDVLEYVNLLMSPQGQVLSAHVAGKVVMKSYLSGMPECKFGINDKIVMESKGRGLSGN----SEAETSRSGKPVVVIDDCQFHQCVKLSKFETEHSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRTKMEVKVVLKSNFKPSLLGQKIEVKIPTPLNTSGVQLICLKGKAKYKASENAIVWKIKRMAGMKETQLSAEIELLET-DTKKKWTRPPISMNFEVPFAPSGFKVRYLKVFEPKLNYSDHDVVKWVRYIGRSGLYETRC 437          
BLAST of AP-2 complex subunit mu vs. Ensembl Fly
Match: AP-2mu (gene:FBgn0263351 transcript:FBtr0301866)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 340/442 (76.92%), Postives = 395/442 (89.37%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG F+YNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFH+KR +IWL AV + NVNA MVF+FL ++++VM  YFGK++EENIKNNFVLIYELLDEILD+GYPQNTD+G LKT+ITQ GIKS TKEE  QIT+QVTGQIGWRREGIKYRRNELFLDV+E VNLLMSPQGQ+LSAHVAGKV+MKS+LSGMP+CKFG NDK+ +ESK R   G+      +  ++S    + IDDCQFHQCVKL +FETEH+ISFIPPDGEFELMRYRTTK+I+LPFRVIPLVRE+G+++MEVK+V+K+NFKP+   QK+EV+IPTP NTSGVQ+IC+KGKAKYKA+ENAIVWKIKRMAGMK+ QLSAEI+LL   D +K+WTRPPISMNFEVPFAPSGFKVRYLKVFE KLNYSDH+V+KWVRYIG+SGLYETRC
Sbjct:    1 MIGGLFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRANIWLAAVTKQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGYPQNTDSGTLKTFITQQGIKSATKEEQMQITSQVTGQIGWRREGIKYRRNELFLDVLEYVNLLMSPQGQVLSAHVAGKVVMKSYLSGMPECKFGINDKIVMESKGRGLSGN----SEAETSRSGKPVVVIDDCQFHQCVKLSKFETEHSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRTKMEVKVVLKSNFKPSLLGQKIEVKIPTPLNTSGVQLICLKGKAKYKASENAIVWKIKRMAGMKETQLSAEIELLET-DTKKKWTRPPISMNFEVPFAPSGFKVRYLKVFEPKLNYSDHDVVKWVRYIGRSGLYETRC 437          
BLAST of AP-2 complex subunit mu vs. Ensembl Fly
Match: AP-1mu (gene:FBgn0024833 transcript:FBtr0082114)

HSP 1 Score: 328.946 bits (842), Expect = 2.296e-106
Identity = 175/445 (39.33%), Postives = 256/445 (57.53%), Query Frame = 2
Query:   74 GGFFIYNHKGEVLISRIFRND-LSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVA--RTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
               F+ + KG+VLISR +R D +   V+D F   ++   ++ + +P+   A T+F ++K  ++++ +      NVN  +VF FLH++  V  +YF ++ EE+I++NFV+IYELLDE+LD+GYPQ TD+ IL+ YITQ G K    E   +I   VT  + WR EGIKYR+NE+FLDVIESVNLL +  G +L + + G + M+ +LSGMP+ + G NDK+  ES  R                     + ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++     SR+E  +  K+ FK    A  VE+ IP P +    +     G  KY   +NAI+W IK   G K+  + A   L +V        +PPI + FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G Y+ R 
Sbjct:    4 SAIFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGLITPILQTAETTFAYIKTNNLYIVSTTPRNKNVNIALVFVFLHKIAQVFVEYFKELEEESIRDNFVIIYELLDELLDFGYPQTTDSKILQEYITQEGHKL---ELQPRIPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANANGNVLRSEIVGAIKMRVYLSGMPELRLGLNDKVLFESTGRGKSKS----------------VELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIVIPVPADADSPKFKTTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNTEGKPPIQVRFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLRT 425          
BLAST of AP-2 complex subunit mu vs. Ensembl Fly
Match: cm (gene:FBgn0000330 transcript:FBtr0071033)

HSP 1 Score: 180.259 bits (456), Expect = 3.752e-50
Identity = 128/452 (28.32%), Postives = 204/452 (45.13%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVT----GQIG---WRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGF-NDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKE--INLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
            MI   FI N  GEV + + +R+ +SR+V + F ++   A      PV          V+R ++ L A  +  V  + V +FLHR++D    YFG  +E  IK+N+V++YELLDE+LD G+P  T++ ILK  I    I  T     T  +N  T    GQ+    WRR G++Y  NE + DVIE V+ ++   G  + A + G +     LSGMPD    F N +L                               DD  FH CV+  R+E E  +SFIPPDG F LM Y  + +  + +P  +          +  + L +           KV++ +  P       +   +GK  + +    + W + R+   K   +   +  +T G        P +++ F++   A SG KV  L ++  K     ++  K V+Y+ K+G ++ R
Sbjct:    1 MIHSLFIVNSGGEVFLEKHWRSVVSRSVCEYF-LDAQRAAPYDVPPVIATPHYYLITVQRDTVSLVAACKQEVPPLFVIEFLHRVVDTFQDYFGDCSESVIKDNYVVVYELLDEMLDNGFPLATESNILKELIKPPNILRTIANTVTGKSNVSTTLPSGQLSAVRWRRSGVRYTNNEAYFDVIEEVDAIIDKSGSTVFAEIQGHIDCCIKLSGMPDLTLSFMNPRL------------------------------FDDVSFHPCVRYKRWEAERLLSFIPPDGNFRLMSYHISSQSVVAIPIYIRHNFSIKTGEQGRLDLTIGPRNTLGRTVDKVKLELTMPRCVLNCLLTPNQGKYTFDSVTKTLSWDVGRIDVSKLPNIRGSVS-ITPGTTNID-ANPSVNVQFQISQLAVSGLKVNRLDMYGEK-----YKPFKGVKYLTKAGKFQVR 414          
BLAST of AP-2 complex subunit mu vs. Ensembl Zebrafish
Match: ap2m1b (adaptor related protein complex 2 subunit mu 1b [Source:NCBI gene;Acc:394001])

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 337/446 (75.56%), Postives = 392/446 (87.89%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNR----DDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    DD G            S   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGTTDDTGK-----------SGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 434          
BLAST of AP-2 complex subunit mu vs. Ensembl Zebrafish
Match: ap2m1a (adaptor related protein complex 2 subunit mu 1a [Source:NCBI gene;Acc:321051])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 338/448 (75.45%), Postives = 393/448 (87.72%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNR----DDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIK    TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    DD G       S    S   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFESKLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKGQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGTTDDAGK------SELGGSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFESKLNYSDHDVIKWVRYIGRSGIYETRC 441          
BLAST of AP-2 complex subunit mu vs. Ensembl Zebrafish
Match: ap2m1a (adaptor related protein complex 2 subunit mu 1a [Source:NCBI gene;Acc:321051])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 338/448 (75.45%), Postives = 393/448 (87.72%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNR----DDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIK    TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    DD G       S    S   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFESKLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKGQPQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGTTDDAGK------SELGGSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFESKLNYSDHDVIKWVRYIGRSGIYETRC 441          
BLAST of AP-2 complex subunit mu vs. Ensembl Zebrafish
Match: ap2m1a (adaptor related protein complex 2 subunit mu 1a [Source:NCBI gene;Acc:321051])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 337/448 (75.22%), Postives = 392/448 (87.50%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNR----DDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIK    TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    DD G            S   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFESKLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKGQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGTTDDAGK-----------SGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFESKLNYSDHDVIKWVRYIGRSGIYETRC 436          
BLAST of AP-2 complex subunit mu vs. Ensembl Zebrafish
Match: ap2m1a (adaptor related protein complex 2 subunit mu 1a [Source:NCBI gene;Acc:321051])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 337/448 (75.22%), Postives = 392/448 (87.50%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNR----DDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIK    TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    DD G            S   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFESKLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKGQPQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGTTDDAGK-----------SGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFESKLNYSDHDVIKWVRYIGRSGIYETRC 436          
BLAST of AP-2 complex subunit mu vs. Ensembl Xenopus
Match: ap2m1 (adaptor related protein complex 2 subunit mu 1 [Source:NCBI gene;Acc:394572])

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 321/451 (71.18%), Postives = 374/451 (82.93%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKST--TKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQ----ILSAHVAGKVIMKSFLSGMPDC---KFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS   TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQG+     L+ H++  +  +SFLS +  C      F    SL+S         ++             IAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQVRTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGEAQGTALTVHISTFLGFRSFLSILMICLIYSIFFKSVTSLDSTQATPGWGKQS-------------IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 437          
BLAST of AP-2 complex subunit mu vs. Ensembl Xenopus
Match: lipa (lipase A, lysosomal acid, cholesterol esterase [Source:Xenbase;Acc:XB-GENE-952977])

HSP 1 Score: 321.242 bits (822), Expect = 4.369e-103
Identity = 171/439 (38.95%), Postives = 253/439 (57.63%), Query Frame = 2
Query:   83 FIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            ++ + KG+VLI R +R D+  + V+ F   ++   ++   SP+       F  +K  +++L A ++ N    +VF FL++++ V  +YF ++ EE+I++NFV+IYELLDE++D+GYPQ TD+ IL+ YITQ G K  T       T  VT  + WR EGIKYR+NE+FLDVIESVNLL+S  G +L + + G + M+ FLSGMP+ + G NDK+  E+  R                    S+ ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++ +   SR+E  +  K+ FK    A  VE+ IP P +    +     G  K+    + IVW IK   G K+  + A   L +V    K   +PPIS+ FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G Y+ R 
Sbjct:    7 YVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGALSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFENTGRGKS----------------KSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKE-GKPPISVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLRT 422          
BLAST of AP-2 complex subunit mu vs. Ensembl Xenopus
Match: lipa (lipase A, lysosomal acid, cholesterol esterase [Source:Xenbase;Acc:XB-GENE-952977])

HSP 1 Score: 310.071 bits (793), Expect = 2.077e-98
Identity = 166/426 (38.97%), Postives = 244/426 (57.28%), Query Frame = 2
Query:  104 EVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSG 1375
            +VLI R +R D+  + V+ F   ++   ++   SP+       F  +K  +++L A ++ N    +VF FL++++ V  +YF ++ EE+I++NFV+IYELLDE++D+GYPQ TD+ IL+ YITQ G K  T       T  VT  + WR EGIKYR+NE+FLDVIESVNLL+S  G +L + + G + M+ FLSGMP+ + G NDK+  E+  R                     + ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++ +   SR+E  +  K+ FK    A  VE+ IP P +    +     G  K+    + IVW IK   G K+  + A   L +V    K   +PPIS+ FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G
Sbjct:   35 KVLICRNYRGDVDMSEVEHFMPILMEKEEEGALSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFENTGRGKSKS----------------VELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKE-GKPPISVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNG 437          
BLAST of AP-2 complex subunit mu vs. Ensembl Xenopus
Match: ap1m2 (adaptor related protein complex 1 subunit mu 2 [Source:NCBI gene;Acc:448603])

HSP 1 Score: 307.375 bits (786), Expect = 9.547e-98
Identity = 159/444 (35.81%), Postives = 262/444 (59.01%), Query Frame = 2
Query:   74 GGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVR-SPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNF---FAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
               +I + KG+ LI R ++ D+    +D F   ++   ++   +P+    +  F  +K  +++L A+   N NA +V+ FL+++++V  +YF ++ EE+I++NFV++YELLDEI+D+G+PQ T++ IL+ YITQ G K  T +  +++   VT  + WR EGIKY++NE+F+DVIESVN+L++  G +L + + G V +K FLSGMP+ + G ND++  E   R+                   ++ ++D +FHQCV+L RFE + TISFIPPDG+FELM YR   ++      I ++ ++ +    V+L+  A     F    A  VE+ +P P++    +     G AKY   +N ++W IK   G K+  + A   L +V + ++   +PPIS+ FE+P F  SG +VRY+K+ E     S ++ + WVRYI +SG Y+ R
Sbjct:    4 SAVYILDLKGKPLICRNYKGDIDMLEIDHFMPLLVQKEEESNLTPLLTHGKVHFMWIKHSNLYLVALTNKNANASLVYSFLYKLIEVFTEYFKELEEESIRDNFVIVYELLDEIMDFGFPQTTESKILQEYITQQGNKLDTGK--SRVPTTVTNAVSWRSEGIKYKKNEVFIDVIESVNILVNSNGSVLRSEIVGSVKLKVFLSGMPELRLGLNDRVLFELTGRNKN----------------KTVELEDVKFHQCVRLSRFENDRTISFIPPDGDFELMSYRLNTQVLHCPTGISVIVQLQQVICIVELINIAALNSQFKQSVANNVEISVPVPSDADSPKFKTSVGSAKYVPEKNVVIWTIKSFPGGKEYLMRAHFGLPSV-ETEELEGKPPISVKFEIPYFTVSGIQVRYMKIIEK----SGYQALPWVRYITQSGDYQLR 424          
BLAST of AP-2 complex subunit mu vs. Ensembl Xenopus
Match: lipa (lipase A, lysosomal acid, cholesterol esterase [Source:Xenbase;Acc:XB-GENE-952977])

HSP 1 Score: 305.449 bits (781), Expect = 9.422e-97
Identity = 166/429 (38.69%), Postives = 244/429 (56.88%), Query Frame = 2
Query:  104 EVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLM---SPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSG 1375
            +VLI R +R D+  + V+ F   ++   ++   SP+       F  +K  +++L A ++ N    +VF FL++++ V  +YF ++ EE+I++NFV+IYELLDE++D+GYPQ TD+ IL+ YITQ G K  T       T  VT  + WR EGIKYR+NE+FLDVIESVNLL+   S  G +L + + G + M+ FLSGMP+ + G NDK+  E+  R                     + ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++ +   SR+E  +  K+ FK    A  VE+ IP P +    +     G  K+    + IVW IK   G K+  + A   L +V    K   +PPIS+ FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G
Sbjct:   24 KVLICRNYRGDVDMSEVEHFMPILMEKEEEGALSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIESVNLLVNAVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFENTGRGKSKS----------------VELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKE-GKPPISVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNG 429          
BLAST of AP-2 complex subunit mu vs. Ensembl Mouse
Match: Ap2m1 (adaptor-related protein complex 2, mu 1 subunit [Source:MGI Symbol;Acc:MGI:1298405])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 337/442 (76.24%), Postives = 392/442 (88.69%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 433          
BLAST of AP-2 complex subunit mu vs. Ensembl Mouse
Match: Ap2m1 (adaptor-related protein complex 2, mu 1 subunit [Source:MGI Symbol;Acc:MGI:1298405])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 337/444 (75.90%), Postives = 392/444 (88.29%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS   TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 435          
BLAST of AP-2 complex subunit mu vs. Ensembl Mouse
Match: Ap1m2 (adaptor protein complex AP-1, mu 2 subunit [Source:MGI Symbol;Acc:MGI:1336974])

HSP 1 Score: 323.553 bits (828), Expect = 3.969e-104
Identity = 164/439 (37.36%), Postives = 263/439 (59.91%), Query Frame = 2
Query:   83 FIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            FI + KG+ LISR ++ D+    +D F   ++   ++ V +P+ +  R  F  +K  +++L A    N NA +V+ FL++ ++V  +YF ++ EE+I++NFV++YELLDE++D+G+PQ TD+ IL+ YITQ G K  T +  +++   VT  + WR EGIKY++NE+F+DVIESVNLL++  G +L + + G + +K FLSGMP+ + G ND++  E   R                    S+ ++D +FHQCV+L RF+ + TISFIPPDG+FELM YR + ++     +  ++ +   SR+E+ +  K  FK    A  VE+ +P P++    +     G AKY   +N ++W IK   G K+  + A   L +V + ++   RPPI + FE+P F  SG +VRY+K+ E     S ++ + WVRYI +SG Y+ R 
Sbjct:    7 FILDVKGKPLISRNYKGDVPMTEIDHFMPLLMQREEEGVLAPLLSHGRVHFLWIKHSNLYLVATTLKNANASLVYSFLYKTVEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQGNKLETGK--SRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKN----------------KSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSV-ETEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEK----SGYQALPWVRYITQSGDYQLRT 422          
BLAST of AP-2 complex subunit mu vs. Ensembl Mouse
Match: Ap1m2 (adaptor protein complex AP-1, mu 2 subunit [Source:MGI Symbol;Acc:MGI:1336974])

HSP 1 Score: 322.398 bits (825), Expect = 1.084e-103
Identity = 165/445 (37.08%), Postives = 265/445 (59.55%), Query Frame = 2
Query:   83 FIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLE------SKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            FI + KG+ LISR ++ D+    +D F   ++   ++ V +P+ +  R  F  +K  +++L A    N NA +V+ FL++ ++V  +YF ++ EE+I++NFV++YELLDE++D+G+PQ TD+ IL+ YITQ G K  T +  +++   VT  + WR EGIKY++NE+F+DVIESVNLL++  G +L + + G + +K FLSGMP+ + G ND++  E      SKN+                     + ++D +FHQCV+L RF+ + TISFIPPDG+FELM YR + ++     +  ++ +   SR+E+ +  K  FK    A  VE+ +P P++    +     G AKY   +N ++W IK   G K+  + A   L +V + ++   RPPI + FE+P F  SG +VRY+K+ E     S ++ + WVRYI +SG Y+ R 
Sbjct:    7 FILDVKGKPLISRNYKGDVPMTEIDHFMPLLMQREEEGVLAPLLSHGRVHFLWIKHSNLYLVATTLKNANASLVYSFLYKTVEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQGNKLETGK--SRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGLSGSKNKS--------------------VELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPEKNVVIWSIKSFPGGKEYLMRAHFGLPSV-ETEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEK----SGYQALPWVRYITQSGDYQLRT 424          
BLAST of AP-2 complex subunit mu vs. Ensembl Mouse
Match: Ap1m1 (adaptor-related protein complex AP-1, mu subunit 1 [Source:MGI Symbol;Acc:MGI:102776])

HSP 1 Score: 318.161 bits (814), Expect = 5.767e-102
Identity = 168/439 (38.27%), Postives = 254/439 (57.86%), Query Frame = 2
Query:   83 FIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            ++ + KG+VLI R +R D+  + V+ F   ++   ++ + SP+       F  +K  +++L A ++ N    +VF FL++++ V  +YF ++ EE+I++NFV+IYELLDE++D+GYPQ TD+ IL+ YITQ G K  T       T  VT  + WR EGIKYR+NE+FLDVIE+VNLL+S  G +L + + G + M+ FLSGMP+ + G NDK+  ++  R                    S+ ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++ +   SR+E  +  K+ FK    A  VE+ IP P +    +     G  K+    + IVW +K   G K+  + A   L +V    K   +PPIS+ FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G Y+ R 
Sbjct:    7 YVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIEAVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKS----------------KSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHFGLPSVEAEDKE-GKPPISVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLRT 422          
BLAST of AP-2 complex subunit mu vs. UniProt/SwissProt
Match: sp|P35603|AP2M_CAEEL (AP-2 complex subunit mu OS=Caenorhabditis elegans OX=6239 GN=dpy-23 PE=2 SV=2)

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 340/449 (75.72%), Postives = 394/449 (87.75%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKST------TKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGD-RQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG F+YNHKGEVLISRI+R+D++RN VDAFRVNVIHARQQVRSPVTN+ARTSFFHVKRG++W+CAV R NVNA MVF+FL R  D M  YFGK+NEEN+KNNFVLIYELLDEILD+GYPQNTD G+LKT+ITQ G+++       TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDVIE VNLLM+ QGQ+LSAHVAGKV MKS+LSGMP+CKFG NDK+++E K++    D         NK+S +++AIDDCQFHQCVKL +FETEH ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+ +++MEVK+VVK+NFKP+  AQK+EVRIPTP NTSGVQ+ICMKGKAKYKA ENAIVWKIKRMAGMK+ Q+SAEIDLL+ G+  +K+W RPP+SMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SGLYETRC
Sbjct:    1 MIGGLFVYNHKGEVLISRIYRDDVTRNAVDAFRVNVIHARQQVRSPVTNMARTSFFHVKRGNVWICAVTRQNVNAAMVFEFLKRFADTMQSYFGKLNEENVKNNFVLIYELLDEILDFGYPQNTDPGVLKTFITQQGVRTADAPVPVTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVIEYVNLLMNQQGQVLSAHVAGKVAMKSYLSGMPECKFGINDKITIEGKSKPGSDD--------PNKASRAAVAIDDCQFHQCVKLTKFETEHAISFIPPDGEYELMRYRTTKDIQLPFRVIPLVREVSRNKMEVKVVVKSNFKPSLLAQKLEVRIPTPPNTSGVQLICMKGKAKYKAGENAIVWKIKRMAGMKESQISAEIDLLSTGNVEKKKWNRPPVSMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGLYETRC 441          
BLAST of AP-2 complex subunit mu vs. UniProt/SwissProt
Match: sp|Q5ZMP6|AP2M1_CHICK (AP-2 complex subunit mu OS=Gallus gallus OX=9031 GN=AP2M1 PE=2 SV=1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 338/445 (75.96%), Postives = 392/445 (88.09%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNR---DDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +   D+ G            S   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETGK-----------SGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 433          
BLAST of AP-2 complex subunit mu vs. UniProt/SwissProt
Match: sp|P84092|AP2M1_RAT (AP-2 complex subunit mu OS=Rattus norvegicus OX=10116 GN=Ap2m1 PE=1 SV=1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 337/444 (75.90%), Postives = 392/444 (88.29%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS   TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 435          
BLAST of AP-2 complex subunit mu vs. UniProt/SwissProt
Match: sp|P84091|AP2M1_MOUSE (AP-2 complex subunit mu OS=Mus musculus OX=10090 GN=Ap2m1 PE=1 SV=1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 337/444 (75.90%), Postives = 392/444 (88.29%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS   TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 435          
BLAST of AP-2 complex subunit mu vs. UniProt/SwissProt
Match: sp|Q4R706|AP2M1_MACFA (AP-2 complex subunit mu OS=Macaca fascicularis OX=9541 GN=AP2M1 PE=2 SV=1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 337/444 (75.90%), Postives = 392/444 (88.29%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS   TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ +E + +    +         +KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGEFELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADE--------TSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 435          
BLAST of AP-2 complex subunit mu vs. TrEMBL
Match: A5HUF2 (Adaptor-related protein complex 2 mu 2 subunit OS=Dugesia japonica OX=6161 GN=Djmu2 PE=2 SV=1)

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 439/442 (99.32%), Postives = 441/442 (99.77%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS +KEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLE+KNRDDKGDFRTSGASSGNKSSGSSIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC
Sbjct:    1 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSASKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLETKNRDDKGDFRTSGASSGNKSSGSSIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 442          
BLAST of AP-2 complex subunit mu vs. TrEMBL
Match: A0A504Y5I9 (AP-2 complex subunit mu-A OS=Fasciola gigantica OX=46835 GN=FGIG_03599 PE=3 SV=1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 355/442 (80.32%), Postives = 402/442 (90.95%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISRIFR+D+SRN  DAFRVNVIHARQQVRSP+T IARTSFFHVKR +IW+CAVAR NVNAVMVFQ LH +L VM +YFG+V EENIKNNFVLIYE+LDE++DYGY QNTDTG LK+ ITQAG KS +KEET QITNQVTGQIGWRREGIKYRRNELFLD++ESVNLLMSPQGQ+LSAHVAG+V+MKS+LSGMP+CKFGFNDK+SLE+K R   GD           ++   IAIDDCQFHQCVKLGRF+TEHTISF+PPDGEFELMRYRTTKEI+LPFRVIPLVRE+GK++M+VK+VVKANF+P+ FAQK+EVRIPTPTNTSGVQV+CMKG+AKYKAAENAI+WKI+R++GMKDCQLSAE++LL   D+ KRWTRPPISMNFEVPFAPSGFKVR+LKVFESKLNYSDH+V+KWVRYIGKSGLYETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRIFRDDVSRNAADAFRVNVIHARQQVRSPITIIARTSFFHVKRANIWICAVARRNVNAVMVFQLLHALLTVMKEYFGRVTEENIKNNFVLIYEILDEVIDYGYAQNTDTGTLKSLITQAGTKSASKEETAQITNQVTGQIGWRREGIKYRRNELFLDIMESVNLLMSPQGQVLSAHVAGRVVMKSYLSGMPECKFGFNDKVSLENKQRAPAGD-------DSAANTSGGIAIDDCQFHQCVKLGRFDTEHTISFVPPDGEFELMRYRTTKEISLPFRVIPLVRELGKTKMDVKVVVKANFRPSLFAQKIEVRIPTPTNTSGVQVVCMKGRAKYKAAENAIIWKIRRISGMKDCQLSAEVELLQTSDKHKRWTRPPISMNFEVPFAPSGFKVRFLKVFESKLNYSDHDVLKWVRYIGKSGLYETRC 435          
BLAST of AP-2 complex subunit mu vs. TrEMBL
Match: A0A4S2M2B6 (MHD domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003238 PE=3 SV=1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 355/442 (80.32%), Postives = 398/442 (90.05%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISRIFR+D+SRN  DAFRVNVIHARQQVRSP+T IARTSFFHVKR +IW+CAVAR NVNA MVFQ LH +L VM +YFG+V EENIKNNFVLIYE+LDE++DYGY QNTDTG L+T ITQAG +S TKEET QITNQVTGQIGWRREGIKYRRNELFLD++ESVNLLMSPQGQ+LSAHVAG+VIMKS+LSGMP+CKFGFND+LSLE+K R   G            +S   IAIDDCQFHQCVKLGRF+TEHTISFIPPDGEFELMRYRTTKEI+LPFRVIPLVRE+GK+ M+V++VVKANF+PN FAQK+EVRIPTPTNTSGVQVICMKG+AKYKAAENAIVWKI+R++GMKDC+L+A+I+LL   ++ KRWTRPPISMNFEVPFAPSGFKVR+LKVFE KLNYSDH+VIKWVRYIGKSGLYETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRIFRDDVSRNAADAFRVNVIHARQQVRSPITIIARTSFFHVKRANIWVCAVARRNVNAAMVFQLLHALLCVMKEYFGRVTEENIKNNFVLIYEILDEVIDYGYAQNTDTGTLRTLITQAGTRSATKEETAQITNQVTGQIGWRREGIKYRRNELFLDIMESVNLLMSPQGQVLSAHVAGRVIMKSYLSGMPECKFGFNDRLSLENKQRTTAGG------EDNAVTSTGGIAIDDCQFHQCVKLGRFDTEHTISFIPPDGEFELMRYRTTKEISLPFRVIPLVRELGKTNMDVQVVVKANFRPNLFAQKIEVRIPTPTNTSGVQVICMKGRAKYKAAENAIVWKIRRISGMKDCKLAAQIELLQTSEKHKRWTRPPISMNFEVPFAPSGFKVRFLKVFEPKLNYSDHDVIKWVRYIGKSGLYETRC 436          
BLAST of AP-2 complex subunit mu vs. TrEMBL
Match: A0A0B7A027 (MHD domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF90149 PE=3 SV=1)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 352/442 (79.64%), Postives = 400/442 (90.50%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR+FR+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFH+KR +IW+ AV R NVNA MVF+FLH+M +VM  YFGK++EENIKNNFVLIYE+LDEILD+GYPQNTDTG+LKT+ITQ G+KS TKEET QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHVAG+++MKS+LSGMP+CKFG NDK+ +ESK +    D     +  G  +  +SIAIDDCQFHQCVKL +FETEH+ISFIPPDGEFELMRYRTTK+I+LPFRVIPLVRE+G+ +MEVK+VVK+NFKP+  AQKVEVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRM GMK+CQLSAEI+LL   D+ K+WTRPPISMNFEVPFAPSGFKVRYLKVFESK+NYSDH+VIKWVRYIG+SGLYETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVFRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRSNIWVAAVTRQNVNAAMVFEFLHKMCEVMAAYFGKISEENIKNNFVLIYEILDEILDFGYPQNTDTGVLKTFITQQGVKSQTKEETAQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVAGRIVMKSYLSGMPECKFGINDKVLMESKGKSSLDD----SSRGGVTAGKTSIAIDDCQFHQCVKLSKFETEHSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRQKMEVKVVVKSNFKPSLLAQKVEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMGGMKECQLSAEIELLNTSDKGKKWTRPPISMNFEVPFAPSGFKVRYLKVFESKINYSDHDVIKWVRYIGRSGLYETRC 438          
BLAST of AP-2 complex subunit mu vs. TrEMBL
Match: A0A094ZXX7 (AP-2 complex subunit mu OS=Schistosoma haematobium OX=6185 GN=MS3_08208 PE=3 SV=1)

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 352/453 (77.70%), Postives = 399/453 (88.08%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLD-----------EILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISRIFR+D+SRN  DAFRVNVIHARQQVRSP++ +ARTSFFHVKR +IW+CAVAR NVNA MVFQ LH +L++M  YFG+V EENIKNNFVLIYE+LD           E++DYGY QNTDTGILK+ ITQAG ++ TKEET QITNQVTGQIGWRREGIKYRRNELFLD++ESVNLLMSPQGQ+LSAHVAG+VIMKS+LSGMP+CKFGFNDK+SLE+K R   G           + S   IAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEI+LPFRVIPLVRE+GK++M+VK+++KANF+PN FAQK+EV IPTP NTSGVQV+CMKG+AKYKAAENAI+WKI+R++GMKDCQLSAEI+LL   D+QKRW RPPISMNFEVPFAPSGFKVR+LKVFESKLNYSDH+V+KWVRYIGKSGLYETRC
Sbjct:    1 MIGGVFIYNHKGEVLISRIFRDDVSRNAADAFRVNVIHARQQVRSPISIVARTSFFHVKRANIWICAVARRNVNAAMVFQLLHALLNLMKDYFGRVTEENIKNNFVLIYEILDGKLTFYLIFVTEVIDYGYGQNTDTGILKSLITQAGTRTATKEETAQITNQVTGQIGWRREGIKYRRNELFLDIMESVNLLMSPQGQVLSAHVAGRVIMKSYLSGMPECKFGFNDKVSLENKQRSTAG----------TEDSSGGIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEISLPFRVIPLVRELGKTKMDVKVILKANFRPNLFAQKIEVHIPTPMNTSGVQVVCMKGRAKYKAAENAIIWKIRRISGMKDCQLSAEIELLQASDKQKRWMRPPISMNFEVPFAPSGFKVRFLKVFESKLNYSDHDVVKWVRYIGKSGLYETRC 443          
BLAST of AP-2 complex subunit mu vs. Ensembl Cavefish
Match: ap2m1b (adaptor related protein complex 2 subunit mu 1b [Source:NCBI gene;Acc:394001])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 338/446 (75.78%), Postives = 394/446 (88.34%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNR----DDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    DD G      +  G  S   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGTTDDAGK-----SELGGSSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 440          
BLAST of AP-2 complex subunit mu vs. Ensembl Cavefish
Match: ap2m1b (adaptor related protein complex 2 subunit mu 1b [Source:NCBI gene;Acc:394001])

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 337/446 (75.56%), Postives = 392/446 (87.89%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNR----DDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIKS TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    DD G            S   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFE KLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGTTDDAGK----------SSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC 435          
BLAST of AP-2 complex subunit mu vs. Ensembl Cavefish
Match: ap2m1a (adaptor related protein complex 2 subunit mu 1a [Source:NCBI gene;Acc:321051])

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 274/366 (74.86%), Postives = 323/366 (88.25%), Query Frame = 2
Query:  296 MVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIK  TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    D          KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFESKLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKGQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGASD-------DAGKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFESKLNYSDHDVIKWVRYIGRSGIYETRC 358          
BLAST of AP-2 complex subunit mu vs. Ensembl Cavefish
Match: ap1m2 (adaptor related protein complex 1 subunit mu 2 [Source:NCBI gene;Acc:103044159])

HSP 1 Score: 323.939 bits (829), Expect = 2.051e-104
Identity = 163/442 (36.88%), Postives = 264/442 (59.73%), Query Frame = 2
Query:   74 GGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
               F+ + KG+VLI R ++ D+    +D F   ++   ++ +  PV +     F  +K  +++L A    N NA +V+ FL+++++V  +YF ++ EE+I++NFV++YELLDE++D+G+PQ TD+ IL+ YITQ G K    +  T++   VT  + WR EGIKY++NE+F+DVIES+N+L++  G ++S+ + G + +K+ LSGMP+ + G ND++      RD KG                ++ ++D +FHQCV+L RFE++ TISFIPPDGE ELM YR   ++     +  ++ +   SR+E+ +  K  FK    A  VEVR+P P++    +     G AKY   +N +VW IK   G K+  + A   L +V + +    +PPI++ FE+P F  SG +VRY+K+ E     S ++ + WVRYI +SG Y+ R 
Sbjct:    4 SAVFVLDLKGKVLICRNYKGDVDMAEIDHFLPLLMQQEEEGLMCPVISHGSVHFMWIKHSNLYLVATTNKNSNASLVYSFLYKLVEVFTEYFKELEEESIQDNFVVVYELLDELMDFGFPQTTDSKILQEYITQEGNKLEVAK--TKVPTTVTNAVSWRSEGIKYKKNEVFIDVIESINVLVNANGSVMSSDIVGSIKLKTMLSGMPELRLGLNDRVLFALTGRD-KG---------------KTVTMEDVKFHQCVRLSRFESDRTISFIPPDGESELMSYRINTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANNVEVRVPVPSDADSPKFKTSTGHAKYVPEKNLVVWTIKSFPGGKEFLMRAHFGLPSVENDEME-GKPPITVKFEIPYFTVSGIQVRYMKIIEK----SGYQALPWVRYITQSGDYQLRT 422          
BLAST of AP-2 complex subunit mu vs. Ensembl Cavefish
Match: ap1m1 (adaptor related protein complex 1 subunit mu 1 [Source:NCBI gene;Acc:103043463])

HSP 1 Score: 323.168 bits (827), Expect = 5.213e-104
Identity = 171/439 (38.95%), Postives = 254/439 (57.86%), Query Frame = 2
Query:   83 FIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            ++ + KG+VLI R +R D+  + ++ F   ++   ++   SP+       F  +K  +++L A ++ N    +VF FL++++ V  +YF ++ EE+I++NFV+IYELLDE++D+GYPQ TD+ IL+ YITQ G K  T       T  VT  + WR EGIKYR+NE+FLDVIESVNLL+S  G +L + + G + M+ FLSGMP+ + G NDK+  E+  R                    S+ ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++ +   SR+E  +  K+ FK    A  VE+ IP PT+    +     G  K+    + IVW IK   G K+  + A   L +V    K   +PPIS+ FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G Y+ R 
Sbjct:    7 YVLDLKGKVLICRNYRGDVDMSEIEHFMTLLMDKEEEGTLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKIVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLDTGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFENTGRGKS----------------KSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPTDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKE-GKPPISVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLRT 422          
BLAST of AP-2 complex subunit mu vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000083.1 (pep scaffold:Pmarinus_7.0:GL480685:11363:20932:-1 gene:ENSPMAG00000000072.1 transcript:ENSPMAT00000000083.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 328.946 bits (842), Expect = 5.544e-107
Identity = 178/441 (40.36%), Postives = 254/441 (57.60%), Query Frame = 2
Query:   77 GFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ--VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
            G +I + KG+ LISR +R D+  + VDAF  +++  R++    +PV +     F  +K  +I++ A    N N  +VF FL++ + V  +YF ++ EE+I++NFV++YELLDEI+D+GYPQ T++ +L+ YITQ G K          T  VT  + WR EGIKYR+NE+FLDVIESVNLL+S  G +L + + G V M+ FLSGMP+ + G NDK+  E   R DK                  + ++D +FHQCV+L RF+ + TISFIPPDGEFELM YR    +  P   I    E    R+E  +  K+ FK    A  VE+R+P P +    +     G   +   E  +VW IK M G K+  L A   L +VG  +    R PI++ FE+P F  SG +VRYLK+ E     S ++ + WVRYI +SG Y+ R
Sbjct:    5 GVYILDLKGKTLISRNYRGDVPTSAVDAF-FSLLTEREEEGTLNPVLSHGGVRFMWIKHNNIYIVATTNKNANVALVFAFLYKTVQVFNEYFKELEEESIRDNFVIVYELLDEIMDFGYPQTTESRVLQEYITQEGHKLEVGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSATGSVLRSEIVGTVKMRVFLSGMPELRLGLNDKVLFEQTGRGDKSK---------------GVELEDVKFHQCVRLSRFDNDRTISFIPPDGEFELMSYRLYTHVK-PLVWIESAIERHSGRIEYIVKAKSQFKRKSTASGVEIRVPVPADADSPKFRVSTGTTAWIPEEGVLVWTIKSMPGGKEYLLRAHFGLPSVGAEESD-GRAPITVKFEIPYFTTSGIQVRYLKIMEK----SGYQALPWVRYITQSGDYQLR 421          
BLAST of AP-2 complex subunit mu vs. Ensembl Sea Lamprey
Match: ap1m1 (adaptor related protein complex 1 subunit mu 1 [Source:ZFIN;Acc:ZDB-GENE-110126-1])

HSP 1 Score: 247.284 bits (630), Expect = 1.587e-77
Identity = 122/286 (42.66%), Postives = 180/286 (62.94%), Query Frame = 2
Query:   83 FIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEIN 937
            FI + KG+VLI R +R D+  + ++ F   ++   ++ + SPV       F  +K  +++L A ++ N N  +VF FL++M+ V  +YF ++ EE+I++NFV+IYEL+DE++D+G+PQ TD+ IL+ YITQ G K        Q+   VT  + WR EGIKYR+NE+FLDVIESVNLL+S  G +L + + G + M+ FLSGMP+ + G NDK+  E+  R                    S+ ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    ++
Sbjct:    7 FILDLKGKVLICRNYRGDVEMSEIEHFLPALMEREEEGMVSPVLAHGPVRFLWIKHNNLYLVATSKKNANVALVFAFLYKMVQVFCEYFKELEEESIRDNFVIIYELMDEVMDFGFPQTTDSRILQEYITQEGHKLEVG--APQLPATVTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGCIKMRVFLSGMPELRLGLNDKVLFENTGRGKS----------------KSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVS 274          
BLAST of AP-2 complex subunit mu vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005159.1 (pep scaffold:Pmarinus_7.0:GL484914:6202:12019:-1 gene:ENSPMAG00000004692.1 transcript:ENSPMAT00000005159.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.72 bits (587), Expect = 5.133e-71
Identity = 128/313 (40.89%), Postives = 177/313 (56.55%), Query Frame = 2
Query:  461 YITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRD-DKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            YITQ G K          T  VT  + WR EGIKYR+NE+F+DVIESVNLL+S  G +L + + G V M+  LSGMP+ + G NDK+  E   RD  KG                 + ++D +FHQCV+L RF+ + TISFIPPDGEFELM YR    +     +  ++ +   SR+E+ +  K+ FK    A  VEVRIP P++    +     G AK+   E+ IVW IK   G K+  L A   L +V + ++   RPP+++ FE+P F  SG +VRYLK+ E     S ++ + WVRYI +SG Y+ R 
Sbjct:    1 YITQEGHKLEVGAPRPPAT--VTNAVSWRSEGIKYRKNEVFMDVIESVNLLVSATGSVLRSEIVGTVKMRVILSGMPELRLGLNDKVLFEQTGRDKSKG-----------------VELEDVKFHQCVRLSRFDNDRTISFIPPDGEFELMNYRLYTHVKPLIWIESVIEKFSHSRVEIMVKAKSQFKHRSTANNVEVRIPVPSDADSPKFKSSSGSAKWVPEESVIVWTIKSFPGGKEFLLRAHFGLPSV-EAEELEGRPPVTVKFEIPYFTVSGIQVRYLKIIEK----SGYQALPWVRYITQSGDYQLRT 289          
BLAST of AP-2 complex subunit mu vs. Ensembl Sea Lamprey
Match: ap4m1 (adaptor related protein complex 4 subunit mu 1 [Source:ZFIN;Acc:ZDB-GENE-040718-421])

HSP 1 Score: 136.346 bits (342), Expect = 7.437e-35
Identity = 115/411 (27.98%), Postives = 189/411 (45.99%), Query Frame = 2
Query:  230 FFHVKRGSIWLCAVARTNVNAVMVFQFLHR-MLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKE-----------ETTQITNQVTGQIGWRR-EGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSL-ESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEI--NLPFRVIPLVR-EMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQ--VICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDR-QKRWTRPPISMNFEVP-FAPSGFKVRYLKVF---ESKLNYSDHEVIKWVRYIGKSGLYETR 1390
            + H++   ++     +   +  ++ QFL+R    ++  Y G V+EE I+ N  L+YELL+EILD+G  Q T   +L+ Y+    + +                 TQ    V      R     + + NE+F+DV+E + +L+   G ++ A + G + +KSF++G  +    FN  L++  S+NR   G  R                +D+C+FH  V +  FET+  I   P  GE  LM+Y    +    LPFR+ P V  +  KSR+ V L ++ +  P   A  + VR+P P +T  +   V      A  +   +++VWK+ R+ G    QLSA   L   G R   R    P+++ F++P  A SG ++  L+           S     +W+RY   SG Y  R
Sbjct:   57 YVHMRHNGLYFGLTCKPQASPFILIQFLNRRFAAIVKDYCGSVSEEAIRQNLPLLYELLEEILDFGVVQTTRLDVLRNYVQSEAVNTQPSSLFDMSTIGLFGADTQQKTLVPASASIRSLSHQRSKTNEIFVDVLERLTVLIGANGNVVQAELNGDINLKSFVNGCSEIFMTFNHDLAIGSSQNRGYGGAVR----------------LDECRFHANVNVTDFETKRAIRVSPGPGEMTLMQYTVLDDFPTPLPFRLFPTVEVQPDKSRLLVCLKLRCDLSPRSHATNMVVRLPIPKSTISLSRDVSSPDQTATLEPDSSSVVWKVPRITGGS--QLSAIFRLEVPGLRPSARLEVGPVALTFDLPSLAMSGLRIGCLRPTLGGRGGAALSGEPPKRWLRYSTSSGSYVVR 449          
BLAST of AP-2 complex subunit mu vs. Ensembl Sea Lamprey
Match: STON2 (stonin 2 [Source:HGNC Symbol;Acc:HGNC:30652])

HSP 1 Score: 53.1434 bits (126), Expect = 1.422e-7
Identity = 55/242 (22.73%), Postives = 97/242 (40.08%), Query Frame = 2
Query:  557 IKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDG-EFELMRYRTT-KEINLPFRVIPLVREMG-----KSRMEVKLVVKANFKPNFF--AQKVEVRIPTPTN----------------TSGV-------QVICMK---------GKAKYKAAENAIVWKIKRM 1159
            + Y  + + ++V +    +++ +  ++   V   +   +F+SG  DC   F++  +  ++    + D               S+A    QFH C K+  F     + F PPD  + EL+R+RT   E  LPF +  +    G     +S + +     +N  P+     + V VR P P +                T+ V        V C           G AKY+ A NAIVW+I+++
Sbjct:  247 VAYMEDMMLVEVSDEFQGILNVENDLVQHAVTTHIQTVAFISGNHDCCLNFHNCDTNSTETAFTEID---------------SMAFYGYQFHSCTKIVEFNASKMVKFTPPDACKIELLRFRTIFPEKGLPFLIKTIATVQGAFIELQSWLVMSTEFSSNQSPHLLVPCENVMVRYPIPADWVKIFRTENLIKQKSLTAKVNKSAKFGSVSCTGLEPLMQVTIGSAKYEHAFNAIVWRIEKL 473          
BLAST of AP-2 complex subunit mu vs. Ensembl Yeast
Match: APM1 (Mu1-like medium subunit of the AP-1 complex; binds clathrin; involved in clathrin-dependent Golgi protein sorting; the AP-1 complex is the clathrin-associated protein complex [Source:SGD;Acc:S000006180])

HSP 1 Score: 291.582 bits (745), Expect = 3.448e-92
Identity = 166/471 (35.24%), Postives = 257/471 (54.56%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVR--SPVTNIARTSFFHVKRGSIWLCAVART-NVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIK----STTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXX-----------------XXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQK-RWTRP---------PISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSG 1375
            M    +  +H G+ L+SR +R+D+  + +D F + +    +Q     P  N     +  ++   +++ A+  + + NA  +F FLH++++V+  Y   V EE+I++NFV+IYELLDE++DYG PQ T+T +LK YITQ   K    +  K   T+    +T  + WR EGI +++NE FLD++ES+N+LM+ +GQ+L + + G V + S LSGMPD K G NDK  + SK  DD  +  ++                  +SS       +I ++D +FHQCV+L +FE E  I+FIPPDG+F+LM YR +  I         V+    SR+E+    KA  K    A  VE+ IP P +          G  KY   ++AI+WKI+   G K+  +SAE+ L ++ + +    T P         P+ + F++P F  SG +VRYLK+ E KL Y  +    WVRYI +SG
Sbjct:    1 MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFIQHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDK-GIFSKYLDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYP---WVRYITQSG 467          
BLAST of AP-2 complex subunit mu vs. Ensembl Yeast
Match: APM4 (Cargo-binding mu subunit of AP-2; AP-2 is a heterotetrameric endocytic cargo-binding adaptor that facilitates uptake of membrane proteins during clathrin-mediated endocytosis; Apm4p is required for AP-2 function and localization, and binds cell wall stress receptor Mid2p; AP-2 is required for cell polarity responses to pheromone, nutritional status and cell wall damage in S. cerevisiae, and for hyphal growth in C. albicans; AP-2 complex is conserved in mammals [Source:SGD;Acc:S000005423])

HSP 1 Score: 265.388 bits (677), Expect = 6.027e-82
Identity = 158/501 (31.54%), Postives = 261/501 (52.10%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR---GSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILD-YGYPQNTDTGILKTYITQAGIKSTTK------------------------------EETTQITNQVTGQ------------IGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKN---------RDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGK-SRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQ---KRWTRPPISMNFEV-PFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
            MI G  +Y+ +GE+++++ F+N L R++ D FRV VI+    VRSPV  +  T+F H++     ++WL  + R+N N+  +++FL+++  VM  Y     EE +K  F++++E+LD +L   G P +T+   L + I Q  +K                                  +  T+ ++   GQ            I WR +GI ++++E+FL V E +N+L+S  G IL ++V G + + + LSG P C+FG ND L ++S++         R    DF          +    + ++DC+FH+CV L +F   H I F+PPDG  ELM+Y     INLPF+V P+V    + + ++ ++ +K+ F     A+ V + IP P +T   ++    G  K+   ENA++W+  +  G+ +  LSA + + T    Q   ++WTRPPIS+ FEV  F+ SG  VRY  +       S H  +KW++YI K+G YE R
Sbjct:    1 MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVIN-NLDVRSPVLTLGSTTFHHIRSRHGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLD-REEALKEEFMIVHEMLDIMLGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGS--VLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENTLSA-VTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKD---SKHRAVKWIKYISKAGSYEVR 490          
BLAST of AP-2 complex subunit mu vs. Ensembl Yeast
Match: APM2 (Protein of unknown function; homologous to the medium chain of mammalian clathrin-associated protein complex; involved in vesicular transport [Source:SGD;Acc:S000001011])

HSP 1 Score: 102.449 bits (254), Expect = 3.261e-23
Identity = 95/375 (25.33%), Postives = 144/375 (38.40%), Query Frame = 2
Query:  512 ITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMS-PQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFET--------------------EHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVR--------EMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMK--------GKAKYKAAENAIVWKIKRMAGMKD-------------------CQLSAEIDLLT--------------------------------VGDRQKRWTRPP---ISMNFEVPFAP-SGFKVRYLKVFESKLNYSDHEVIKWVRY 1360
            I   +   I WR +GI Y +NE FLDVIE V  LM   +G I    + G+++ + +LSGMP  K   N  L     NRD +                    + +  FHQCV L    T                       I FIPPDGEF L +Y   + +    +  P+VR        ++ K ++++   ++ NFKP     K+ VRIP        ++   K        GK  +  +++ ++W+I+ M G ++                     + AE  L                                  V D+Q     P    ++++FE+P+   SG KV YLKV E +L Y   +   WVRY
Sbjct:  250 IAKTIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISINKIL-----NRDPQ-------------------FMSNSSFHQCVSLDSINTIEKDEEKNSDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHV----KDAPMVRLKDFEIKPKLKKFKIQIVTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQY---QSFPWVRY 593          

HSP 2 Score: 51.9878 bits (123), Expect = 2.390e-7
Identity = 41/141 (29.08%), Postives = 71/141 (50.35%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRN--DLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVART----NVNAVMVFQFLHRMLDVMGQYFG-KVNEEN-IKNNFVLIYELLDEILDYGYPQNTDTGILKTYI 466
            M    FI +   E L+S+  R   +LS +V+ +F+            P+ +     F H+KR  +   +V  T    N++ + +  FL +   ++ +YF  +V  +N I +N +L+ EL+DE +D+G  Q TD  I+K YI
Sbjct:    1 MSSSLFILDENLEPLVSKNIRALPNLS-SVLSSFK----QCYHDGSPPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLELIDECIDFGIVQVTDPSIIKDYI 136          
BLAST of AP-2 complex subunit mu vs. Ensembl Nematostella
Match: EDO41835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S370])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 324/442 (73.30%), Postives = 380/442 (85.97%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGGFFIYNHKGEVLISR++R+D+ RN VDAFRVNVIHAR Q+RSPVTNIARTSFFH+++G++W+ AV R NVNA MVF+FL R +D+M  YFGKV EE IKNNFVLIYELLDEI DYGYPQ TDT ILKT+ITQ G+K+ T+EE  QIT+QVTGQIGWRR+GIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKSFLSGMP+CKFG NDKL +E ++             S +  + + IAIDDC FHQCVKL +FETE +ISFIPPDGEFELMRYRTTK+I+LPFRVIPLVRE+G+SRMEVK+V+K+NFKP+   QK+EVRIPTP  T+GVQV+C+KGKAKYK++ENAIVWKIKRM GMK+ Q+SAEI+L+   D  K+W RPPIS+NFEVPFA SG KVRYLKVFE KLNYSDH+ IKWVRYI +SGLYETRC
Sbjct:    1 MIGGFFIYNHKGEVLISRVYRDDIGRNTVDAFRVNVIHARGQIRSPVTNIARTSFFHIRQGNVWIAAVTRQNVNAAMVFEFLFRTVDIMMSYFGKVTEEGIKNNFVLIYELLDEIADYGYPQKTDTAILKTFITQQGVKTQTREEQAQITSQVTGQIGWRRDGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSFLSGMPECKFGMNDKLVVEKQS------------KSSSSDTSTGIAIDDCTFHQCVKLSKFETERSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRSRMEVKVVLKSNFKPSILGQKIEVRIPTPPTTAGVQVVCLKGKAKYKSSENAIVWKIKRMGGMKESQISAEIELMPTKD-AKKWARPPISLNFEVPFACSGLKVRYLKVFEPKLNYSDHDTIKWVRYISRSGLYETRC 429          
BLAST of AP-2 complex subunit mu vs. Ensembl Nematostella
Match: EDO45156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW3])

HSP 1 Score: 320.472 bits (820), Expect = 1.747e-103
Identity = 165/444 (37.16%), Postives = 257/444 (57.88%), Query Frame = 2
Query:   71 IGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ--VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            +   ++ + KG+V+ISR +R D+  + ++ F   V+   ++   +SP+      +F ++K  +++L    + N N  ++F FLHRM+ V   YF ++ EE+I++NFV+IYEL+DE++D+GYPQ T+T IL+ YITQ G K    E   +    +T  + WR + IKYR+NE+FLDVIESVNL++S  G +L + + G V M+ +L+GMP+ + G NDK+  E+  R                    ++ ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++     SR+E  +  K+ FK    A  VE+ IP P +    +     G  KY   +N ++W IK   G K+  + A  +L +V D ++   RPPI + FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G Y+ R 
Sbjct:    3 MSAVYVLDIKGKVIISRNYRGDIENSKIEKFMPLVLEKEEEGDTQSPICVHGDVTFVYIKYNNLYLVCTTKKNANVALIFVFLHRMVHVFIDYFKELEEESIRDNFVIIYELMDELVDFGYPQFTETKILQEYITQEGHKL---ELAPKPPPALTNAVSWRGDNIKYRKNEVFLDVIESVNLMVSSSGNVLRSEINGTVKMRCYLTGMPELRLGLNDKILFENTGRGKS----------------KAVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHSHSRVEYMIKAKSQFKRRSTANNVEIHIPVPADADSPKFKTTVGNIKYAPEQNVVIWNIKSFPGGKEFLMRAHFNLPSV-DSEETEGRPPIKLKFEIPYFTVSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLRT 422          
BLAST of AP-2 complex subunit mu vs. Ensembl Nematostella
Match: EDO33069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST88])

HSP 1 Score: 218.779 bits (556), Expect = 1.276e-64
Identity = 137/454 (30.18%), Postives = 236/454 (51.98%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTG------------QIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEI--NLPFRVIPLVREMGKSR-MEVKLVVKANFKPNFFAQKVEVRIPTPTNTS----GVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQK--RWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYI 1363
            M+  FFI + +G+ LI R +R + ++   + F   +   ++++  P+ N+   +F  +KR  ++    ++ N+++    + L R+ ++   Y G +NEE IK N  LIYELLDE+LD+GY Q T T  LK Y+     +    E + Q   Q +G                 +  + ++ NE+F+D++E + +L+SP G IL + + G + MKSFL+G PD +    + L++ + +   +              S   + + DC FH+ V L  FE+  T+S +PPDGEF +M YR   E+   LPF +I  V E  ++R +EV L ++ N   +  +  + VR+P P +T        V      A+YK AE  ++W++K + G  +  ++ ++ L    D+ K  R    P+S++FE+P +  SG ++R LKV+E +  Y      +WVRYI
Sbjct:    1 MLSEFFIISPRGDPLIYRDYRGETAKGSPEIFYKKIRSTKEKL-PPIFNVEGLNFIFIKRNGLFFVCTSKFNLSSAFAVEVLSRVCNLCKDYCGIINEEAIKCNLPLIYELLDEVLDFGYVQATSTEALKAYVFN---QPELVENSGQSVWQCSGGNVYGTERMSLPSTAANKPVVPHKTNEIFVDLLERLTVLISPNGSILRSDIDGCIQMKSFLTGSPDVRIALTEDLTVGNADMPSQ-------------VSSMGVKLADCNFHKSVNLDEFESSRTLSVLPPDGEFTVMSYRVAGELETTLPFSIITFVDENEEARYIEVMLKLRCNIPSSSSSNNIIVRVPVPKSTERYILSHDVGHAGHSAEYKTAEKLLLWQVKSIRGGAEVAINIKLKL---KDKAKSARKELGPVSLDFEIPMYICSGLQIRSLKVYEKEKAYHP---FRWVRYI 431          
BLAST of AP-2 complex subunit mu vs. Ensembl Nematostella
Match: EDO35794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKH6])

HSP 1 Score: 182.956 bits (463), Expect = 2.403e-51
Identity = 126/458 (27.51%), Postives = 212/458 (46.29%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSP--VTNIARTSFFH---VKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGI----KSTTKEETTQITNQVTGQIG---WRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGF-NDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYR-TTKEINLPFRVIPLV--REMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
            MI   FI N+ G++ + + +++ ++R++ D F      A+ +  SP  V  +  T  ++   + R  ++   V ++ V  + V +FLHR +D+   YF +  E +IK + V++YELL+E+LD G+P  T+  +LK  I    I     +T    +   T+  TGQ+    WRR G+KY  NE++ DVIE ++ ++   G ++   + G +     LSGMPD    F N +L                              +DD  FH CV+  R+E E  +SF+PPDG F L+ Y  TT  + +P  V   +   E G  R ++ +  K         + V V +P P     V +    G   +      + W++ ++   K   L   + L T        T   IS+ F++P  A SG KV  L ++    +   ++  K V+YI K+G ++ R
Sbjct:    1 MINSLFIINNTGDIFVEKHWKSVINRSICDHF----FEAQSKASSPEDVPPVISTPHYYLISIYRNHLFFVGVVQSEVPPLFVIEFLHRAVDIFQDYFNECTETSIKEHIVVVYELLEEMLDNGFPLATEPNVLKELIRPPSIVRQVVNTVTGSSHVSTHLPTGQLSNVPWRRTGVKYTNNEIYFDVIEEIDCIIDRHGSVVFTEIHGVIDSCCKLSGMPDLTMSFINPRL------------------------------LDDPSFHPCVRFKRWEAERLLSFVPPDGNFRLLSYHITTGTVAIPVYVKHQISYSEGGSGRFDLTVGPKQTMGKTI--ESVVVNVPFPKQVLNVNLTPSVGTYSFDPVRKELKWEVGKIIPQKLPTLKGSMSLQTGVPPPDESTT--ISVEFKIPQLASSGIKVSRLDLYGETSSGKKYKPFKGVKYITKAGRFQVR 420          
BLAST of AP-2 complex subunit mu vs. Ensembl Nematostella
Match: EDO44769 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUX4])

HSP 1 Score: 82.8037 bits (203), Expect = 5.028e-17
Identity = 67/276 (24.28%), Postives = 120/276 (43.48%), Query Frame = 2
Query:  443 TGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDG-EFELMRYRTTKEINLPFRVIPLVREMGKSRMEVK----------------------LVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMK--------------GKAKYKAAENAIVWKIKRM 1159
            T I+K   T   I    KE    + + +     +R  GI YR++E+F+DV ++ + L+   G +       +V +++F++G P+C+   ND +  E +    +G+ +        +     I +  CQFH+CV +  F   H+I F P D   FEL+R+R+  +  LP  V   +    + R+E++                      L +   + P F   K+  R  +  ++ G Q   +K              G AKY+   +AIVW+I ++
Sbjct:    9 TPIIKIGSTSNAI---MKEFIEAVGDSIRTLPAYRDRGITYRKDEVFVDVDDTCHALLDGTGNVKKLGGRVQVKIRAFVTGDPECQLVLNDIVVKEREEARLRGELKP-------QRIHHWINLQHCQFHKCVDVSAFNESHSIVFHPLDACTFELLRFRSNLKKPLPLYVKSSITLHSEQRIELRAEIQLCQETKMAKYARNNVVFQLPIPETWVPLFRTAKLFGREKSIKSSKGKQAAGIKSRLKHSRCSIAASLGTAKYEPEYSAIVWRIDKL 274          
BLAST of AP-2 complex subunit mu vs. Ensembl Medaka
Match: ap2m1a (adaptor related protein complex 2 subunit mu 1 [Source:NCBI gene;Acc:101157567])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 336/444 (75.68%), Postives = 391/444 (88.06%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIK    TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    D          KS   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFESKLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKGQFQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGATD-------DAAKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFESKLNYSDHDVIKWVRYIGRSGIYETRC 436          
BLAST of AP-2 complex subunit mu vs. Ensembl Medaka
Match: ap2m1a (adaptor related protein complex 2 subunit mu 1 [Source:NCBI gene;Acc:101157567])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 336/444 (75.68%), Postives = 393/444 (88.51%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKS--TTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGG FIYNHKGEVLISR++R+D+ RN VDAFRVNVIHARQQVRSPVTNIARTSFFHVKR +IWL AV + NVNA MVF+FL++M DVM  YFGK++EENIKNNFVLIYELLDEILD+GYPQN++TG LKT+ITQ GIK    TKEE +QIT+QVTGQIGWRREGIKYRRNELFLDV+ESVNLLMSPQGQ+LSAHV+G+V+MKS+LSGMP+CKFG NDK+ ++ + +    D   + +  G  S   SIAIDDC FHQCV+L +F++E +ISFIPPDGE+ELMRYRTTK+I LPFRVIPLVRE+G++++EVK+V+K+NFKP+  AQK+EVRIPTP NTSGVQVICMKGKAKYKA+ENAIVWKIKRMAGMK+ Q+SAEI+LL   D+ K+W RPPISMNFEVPFAPSG KVRYLKVFESKLNYSDH+VIKWVRYIG+SG+YETRC
Sbjct:    1 MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKGQFQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGATD-DAAKSDLGGGSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDK-KKWARPPISMNFEVPFAPSGLKVRYLKVFESKLNYSDHDVIKWVRYIGRSGIYETRC 442          
BLAST of AP-2 complex subunit mu vs. Ensembl Medaka
Match: ap1m1 (adaptor related protein complex 1 subunit mu 1 [Source:NCBI gene;Acc:101167487])

HSP 1 Score: 323.553 bits (828), Expect = 3.879e-104
Identity = 169/439 (38.50%), Postives = 255/439 (58.09%), Query Frame = 2
Query:   83 FIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            ++ + KG+VL+ R +R D+  + ++ F   ++   ++   SP+       F  +K  +++L A ++ N +  +VF FL++++ V  +YF ++ EE+I++NFV+IYEL+DE++D+GYPQ TD+ IL+ YITQ G K  T       T  VT  + WR EGIKYR+NE+FLDVIESVNLL+S  G +L + + G + M+ FLSGMP+ + G NDK+  E+  R                    S+ ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++ +   SR+E  +  K+ FK    A  VE+ IP PT+    +     G  K+    + IVW IK   G K+  + A   L +V    K   +PPIS+ FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G Y+ R 
Sbjct:    7 YVLDLKGKVLVCRNYRGDVDMSEIEHFMTLLMDKEEEGTLSPILAHGGVRFMWIKHNNLYLVATSKKNASVSLVFSFLYKIVQVFSEYFKELEEESIRDNFVIIYELMDELMDFGYPQTTDSKILQEYITQEGHKLDTGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFENTGRGKS----------------KSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPTDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKE-GKPPISVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLRT 422          
BLAST of AP-2 complex subunit mu vs. Ensembl Medaka
Match: ap1m2 (adaptor related protein complex 1 subunit mu 2 [Source:NCBI gene;Acc:101161534])

HSP 1 Score: 318.931 bits (816), Expect = 2.218e-102
Identity = 159/442 (35.97%), Postives = 263/442 (59.50%), Query Frame = 2
Query:   74 GGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
               F+ + KG+VLI R ++ D+    +D F   ++   ++ +  PV       F  +K  +++L A    N NA +V+ FL+++++V  +YF ++ EE+I++NFV++YELLDE++D+G+PQ TD+ IL+ YITQ G K    +  T++   VT  + WR EGIKY++NE+F+DVIES+N+L++  G ++S+ + G + +K+ LSGMP+ + G ND++      RD KG                ++ ++D +FHQCV+L RF+++ TISFIPPDGE ELM YR    +     +  ++ +   SR+E+ +  K  FK    A  VE+R+P P++    +     G AKY   ++ ++W IK   G K+  + A   L +V ++ +   +PPI++ FE+P F  SG +VRY+K+ E     S ++ + WVRYI +SG Y+ R 
Sbjct:    4 SAIFVLDLKGKVLICRNYKGDVDMAEIDHFIPLLMQQEEEGMICPVITRGTVHFMWIKHSNLYLVATTNKNSNASLVYSFLYKLVEVFTEYFKELEEESIQDNFVVVYELLDELMDFGFPQTTDSKILQEYITQEGTKLEVAK--TKVPTTVTNAVSWRSEGIKYKKNEVFIDVIESINVLVNANGSVMSSDIVGSIKLKTMLSGMPELRLGLNDRVLFSLTGRD-KG---------------KTVMMEDVKFHQCVRLSRFDSDRTISFIPPDGESELMSYRINTHVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANNVEIRVPVPSDADSPKFKTSTGSAKYVPEKDLVLWTIKSFPGGKEFLMRAHFGLPSV-EKDELEGKPPITVKFEIPYFTVSGIQVRYMKIIEK----SGYQALPWVRYITQSGDYQLRT 422          
BLAST of AP-2 complex subunit mu vs. Ensembl Medaka
Match: ap1m1 (adaptor related protein complex 1 subunit mu 1 [Source:NCBI gene;Acc:101167487])

HSP 1 Score: 318.931 bits (816), Expect = 1.028e-101
Identity = 166/436 (38.07%), Postives = 251/436 (57.57%), Query Frame = 2
Query:   74 GGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSG 1375
               ++ + KG+VL+ R +R D+  + ++ F   ++   ++   SP+       F  +K  +++L A ++ N +  +VF FL++++ V  +YF ++ EE+I++NFV+IYEL+DE++D+GYPQ TD+ IL+ YITQ G K  T       T  VT  + WR EGIKYR+NE+FLDVIESVNLL+S  G +L + + G + M+ FLSGMP+ + G NDK+  E+  R                     + ++D +FHQCV+L RFE + TISFIPPDGEFELM YR    +     +  ++ +   SR+E  +  K+ FK    A  VE+ IP PT+    +     G  K+    + IVW IK   G K+  + A   L +V    K   +PPIS+ FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G
Sbjct:    4 SAVYVLDLKGKVLVCRNYRGDVDMSEIEHFMTLLMDKEEEGTLSPILAHGGVRFMWIKHNNLYLVATSKKNASVSLVFSFLYKIVQVFSEYFKELEEESIRDNFVIIYELMDELMDFGYPQTTDSKILQEYITQEGHKLDTGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFENTGRGKSKS----------------VELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPTDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKE-GKPPISVKFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNG 416          
BLAST of AP-2 complex subunit mu vs. Planmine SMEST
Match: SMESG000032693.1 (SMESG000032693.1)

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 442/442 (100.00%), Postives = 442/442 (100.00%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTSGASSGNKSSGSSIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC
Sbjct:    1 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTSGASSGNKSSGSSIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 442          
BLAST of AP-2 complex subunit mu vs. Planmine SMEST
Match: SMESG000032693.1 (SMESG000032693.1)

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 436/442 (98.64%), Postives = 436/442 (98.64%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 1393
            MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKG      ASSGNKSSGSSIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC
Sbjct:    1 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKG------ASSGNKSSGSSIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVPFAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC 436          
BLAST of AP-2 complex subunit mu vs. Planmine SMEST
Match: SMESG000078973.1 (SMESG000078973.1)

HSP 1 Score: 320.087 bits (819), Expect = 5.109e-103
Identity = 166/441 (37.64%), Postives = 261/441 (59.18%), Query Frame = 2
Query:   74 GGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQ-VRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
               +I + KG+VLISR +R+++  N+++ F  N++   ++ + SP+  +   +F  VK  ++++ A    N N  +VF F+++++++  +YF  + EE+I++NFV+IYELLDE++D+GYPQ TDT IL+ YITQ   +S   E   +    VT  + WR EG+KYR+NE+FLDVIESVNLL+S  G +L + + G + M+ +LSGMP+ + G NDK+  ++  R                +   S+ ++D +FHQCV+L RFE + TISFIPPDG+FELM YR +  +     V  ++ +   SR+E  +  K+ FK    A +VE+ IP P +    +     G  +Y    N ++W I+   G K+  + A   L +V        RPPIS+ FE+P F  SG +VRYLK+ E     S ++ + WVRYI ++G Y+ R
Sbjct:    4 SAIYILDLKGKVLISRNYRDNVDMNLIEKFLPNLLDREEEGLTSPIVQVNNVNFLFVKHNNVYVVAPTTKNANVALVFVFIYKIINIFIEYFKDLEEESIRDNFVIIYELLDEVIDFGYPQTTDTKILQEYITQ---ESHKLEIAPRPPMAVTNAVSWRPEGVKYRKNEVFLDVIESVNLLVSSSGNVLRSEIVGCIKMRVYLSGMPELRLGLNDKILFDNTGR----------------AKNKSVEMEDVRFHQCVRLTRFENDRTISFIPPDGDFELMSYRLSTHVKPLIWVESVIEKHPHSRVEYMIKAKSQFKRRSTANQVEIIIPVPPDVDSPKFKTAVGSCRYVPETNCVIWSIRSFPGGKEFIMRAHFGLPSVLSEDPE-NRPPISVKFEIPYFTVSGVQVRYLKIIEK----SGYQALPWVRYITQNGDYQLR 420          
BLAST of AP-2 complex subunit mu vs. Planmine SMEST
Match: SMESG000044931.1 (SMESG000044931.1)

HSP 1 Score: 171.785 bits (434), Expect = 8.906e-47
Identity = 124/430 (28.84%), Postives = 191/430 (44.42%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQ-QVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQITNQVTGQIG------------WRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVI---PLVREMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTP-TNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWT-RPPISMNFEV-PFAPSGFKVRYL 1300
            MI   F+ N    + + + +RN ++R+V D F  N    ++     PV         ++ R  ++  AV    V  + V +FLHR  D++  YF   +E  IK+N V +YE+LDE+LD G+P  T++ IL+  +  A    T    T  +T    G +G            WRR G+KY RNE + DVIE +N  +   G +++  + G +     LSGMPD    FN+                                IDD   H CV+  +++ E  ISFIPPDG F+L+ Y TT   N    V     +V +   S++E+ +  K          K  VR+P+  TN SG    C  G++ +       +W+I ++   K   L     ++TV   +   +  P + + F V  FA SG KV  L
Sbjct:    1 MILSLFMANSSRNIYVEKHWRNVINRSVCDYFFENESQNKKGHDILPVIQTPHHFLINILREKVYYIAVCTNEVPPLFVIEFLHRFADILIDYFSSASETTIKDNIVRVYEILDEMLDNGFPLATESNILQELVRPANFLRTI---TDTVTGNAAGSVGDSLPSGQLSNVYWRRSGVKYNRNEAYFDVIEEINASIDRSGILVNLEIVGYIDCLVKLSGMPDLTLTFNNPA-----------------------------IIDDVSLHPCVRYLKWDRERIISFIPPDGRFKLLSYHTTPSNNFSLPVTVRSSIVFQENNSKIEITMSSKKLIGKVIDQVKAVVRMPSSITNVSGN---CSIGRSSFDNQTKYFIWEIGKLEPSKVAILKG---VITVSSTESLPSCSPLVEVYFYVHQFAASGLKVSRL 392          
BLAST of AP-2 complex subunit mu vs. Planmine SMEST
Match: SMESG000025662.1 (SMESG000025662.1)

HSP 1 Score: 153.68 bits (387), Expect = 1.693e-40
Identity = 122/459 (26.58%), Postives = 211/459 (45.97%), Query Frame = 2
Query:   68 MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNV---IHARQQVRSPVTNIARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEENIKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGI-----KSTTKEETTQITNQVTGQIG---WRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIMKSFLSGMPDCKFGF-NDKLSLESKNRDDKGDFRTXXXXXXXXXXXXXIAIDDCQFHQCVKLGRFETEHTISFIPPDGEFELMRY--RTTKEINLPFRVIPLVREMGKSRMEVKLVV---KANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKYKAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP-FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETR 1390
            MI   +I + K  +++ + +++  ++++   F ++V   I  ++ + SP+    + +  H+K   I+  A+    V+ + V +FL R+  V+  YF  V+E  I+ N + IYE+LDE+LD G+P  T+  IL+  I    I         ++ TT  +    GQ+    WR+ G+K+  NE + D  E+++ ++   G  +S  + G V     LSG+PD    F N KL                              IDD   H CV+  ++E +  +SFIPP+G+FEL  Y  ++   INLP  +  L + + ++R  + L V   K N K +     + + +P     + V   C  GK KY   EN + W I R+       L   I +L         +   +   F++  ++ SG  V  +++F  K  YS +   K V+Y   +G Y+ R
Sbjct:    1 MINSMYIISLKNSIILEKHWKHVTNKSICQQF-LDVERNIKTKENI-SPIITNNKYTLIHLKESDIYYLAICEKEVSPLFVVEFLRRVNQVLEYYFVSVSELIIEENLIKIYEILDEMLDNGFPLITECNILEELIRPPNILRAIADQMNRQNTTISSVLPIGQLSVVPWRKVGVKHPNNEAYFDFFETIDAILDKNGNPISCDIVGSVKANIHLSGVPDLTMSFCNPKL------------------------------IDDVSLHSCVRYFKWEKDRILSFIPPEGQFELCTYYCQSNSNINLPVGIKSLSK-IDENRSYLDLTVIGNKINAKKSVENLCLTIHLPK-IACNVVPKTCSIGKTKYNTIENTLTWNIGRLDQCVVATLKGPI-ILHSNSFVDETSVIQVMAEFKIEQYSASGTNVNKVEIFNEK--YSPY---KGVKYTTSAGKYQLR 419          
The following BLAST results are available for this feature:
BLAST of AP-2 complex subunit mu vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AP2M10.000e+076.24adaptor related protein complex 2 subunit mu 1 [So... [more]
AP2M10.000e+076.24adaptor related protein complex 2 subunit mu 1 [So... [more]
AP2M10.000e+076.07adaptor related protein complex 2 subunit mu 1 [So... [more]
AP2M10.000e+075.90adaptor related protein complex 2 subunit mu 1 [So... [more]
AP2M10.000e+071.86adaptor related protein complex 2 subunit mu 1 [So... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpy-230.000e+076.75AP-2 complex subunit mu [Source:UniProtKB/Swiss-P... [more]
dpy-230.000e+075.72AP-2 complex subunit mu [Source:UniProtKB/Swiss-P... [more]
unc-1017.646e-10538.46AP-1 complex subunit mu-1-I [Source:UniProtKB/Swi... [more]
unc-1017.646e-10538.46AP-1 complex subunit mu-1-I [Source:UniProtKB/Swi... [more]
apm-11.084e-10238.12AdaPtin, Mu/medium chain (Clathrin associated comp... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AP-2mu0.000e+076.92gene:FBgn0263351 transcript:FBtr0084252[more]
AP-2mu0.000e+076.92gene:FBgn0263351 transcript:FBtr0084253[more]
AP-2mu0.000e+076.92gene:FBgn0263351 transcript:FBtr0301866[more]
AP-1mu2.296e-10639.33gene:FBgn0024833 transcript:FBtr0082114[more]
cm3.752e-5028.32gene:FBgn0000330 transcript:FBtr0071033[more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap2m1b0.000e+075.56adaptor related protein complex 2 subunit mu 1b [S... [more]
ap2m1a0.000e+075.45adaptor related protein complex 2 subunit mu 1a [S... [more]
ap2m1a0.000e+075.45adaptor related protein complex 2 subunit mu 1a [S... [more]
ap2m1a0.000e+075.22adaptor related protein complex 2 subunit mu 1a [S... [more]
ap2m1a0.000e+075.22adaptor related protein complex 2 subunit mu 1a [S... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap2m10.000e+071.18adaptor related protein complex 2 subunit mu 1 [So... [more]
lipa4.369e-10338.95lipase A, lysosomal acid, cholesterol esterase [So... [more]
lipa2.077e-9838.97lipase A, lysosomal acid, cholesterol esterase [So... [more]
ap1m29.547e-9835.81adaptor related protein complex 1 subunit mu 2 [So... [more]
lipa9.422e-9738.69lipase A, lysosomal acid, cholesterol esterase [So... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ap2m10.000e+076.24adaptor-related protein complex 2, mu 1 subunit [S... [more]
Ap2m10.000e+075.90adaptor-related protein complex 2, mu 1 subunit [S... [more]
Ap1m23.969e-10437.36adaptor protein complex AP-1, mu 2 subunit [Source... [more]
Ap1m21.084e-10337.08adaptor protein complex AP-1, mu 2 subunit [Source... [more]
Ap1m15.767e-10238.27adaptor-related protein complex AP-1, mu subunit 1... [more]
back to top
BLAST of AP-2 complex subunit mu vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35603|AP2M_CAEEL0.000e+075.72AP-2 complex subunit mu OS=Caenorhabditis elegans ... [more]
sp|Q5ZMP6|AP2M1_CHICK0.000e+075.96AP-2 complex subunit mu OS=Gallus gallus OX=9031 G... [more]
sp|P84092|AP2M1_RAT0.000e+075.90AP-2 complex subunit mu OS=Rattus norvegicus OX=10... [more]
sp|P84091|AP2M1_MOUSE0.000e+075.90AP-2 complex subunit mu OS=Mus musculus OX=10090 G... [more]
sp|Q4R706|AP2M1_MACFA0.000e+075.90AP-2 complex subunit mu OS=Macaca fascicularis OX=... [more]
back to top
BLAST of AP-2 complex subunit mu vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A5HUF20.000e+099.32Adaptor-related protein complex 2 mu 2 subunit OS=... [more]
A0A504Y5I90.000e+080.32AP-2 complex subunit mu-A OS=Fasciola gigantica OX... [more]
A0A4S2M2B60.000e+080.32MHD domain-containing protein OS=Opisthorchis feli... [more]
A0A0B7A0270.000e+079.64MHD domain-containing protein OS=Arion vulgaris OX... [more]
A0A094ZXX70.000e+077.70AP-2 complex subunit mu OS=Schistosoma haematobium... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap2m1b0.000e+075.78adaptor related protein complex 2 subunit mu 1b [S... [more]
ap2m1b0.000e+075.56adaptor related protein complex 2 subunit mu 1b [S... [more]
ap2m1a0.000e+074.86adaptor related protein complex 2 subunit mu 1a [S... [more]
ap1m22.051e-10436.88adaptor related protein complex 1 subunit mu 2 [So... [more]
ap1m15.213e-10438.95adaptor related protein complex 1 subunit mu 1 [So... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000083.15.544e-10740.36pep scaffold:Pmarinus_7.0:GL480685:11363:20932:-1 ... [more]
ap1m11.587e-7742.66adaptor related protein complex 1 subunit mu 1 [So... [more]
ENSPMAT00000005159.15.133e-7140.89pep scaffold:Pmarinus_7.0:GL484914:6202:12019:-1 g... [more]
ap4m17.437e-3527.98adaptor related protein complex 4 subunit mu 1 [So... [more]
STON21.422e-722.73stonin 2 [Source:HGNC Symbol;Acc:HGNC:30652][more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
APM13.448e-9235.24Mu1-like medium subunit of the AP-1 complex; binds... [more]
APM46.027e-8231.54Cargo-binding mu subunit of AP-2; AP-2 is a hetero... [more]
APM23.261e-2325.33Protein of unknown function; homologous to the med... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418350.000e+073.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451561.747e-10337.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330691.276e-6430.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357942.403e-5127.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447695.028e-1724.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ap2m1a0.000e+075.68adaptor related protein complex 2 subunit mu 1 [So... [more]
ap2m1a0.000e+075.68adaptor related protein complex 2 subunit mu 1 [So... [more]
ap1m13.879e-10438.50adaptor related protein complex 1 subunit mu 1 [So... [more]
ap1m22.218e-10235.97adaptor related protein complex 1 subunit mu 2 [So... [more]
ap1m11.028e-10138.07adaptor related protein complex 1 subunit mu 1 [So... [more]
back to top
BLAST of AP-2 complex subunit mu vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032693.10.000e+0100.00SMESG000032693.1[more]
SMESG000032693.10.000e+098.64SMESG000032693.1[more]
SMESG000078973.15.109e-10337.64SMESG000078973.1[more]
SMESG000044931.18.906e-4728.84SMESG000044931.1[more]
SMESG000025662.11.693e-4026.58SMESG000025662.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017634 ID=SMED30017634|Name=AP-2 complex subunit mu|organism=Schmidtea mediterranea sexual|type=transcript|length=1935bp
GTAAAATTTTCCTCTTTATTTCAAGTAGTAATTTTCTTTAAATTTTTCAT
TAAGTAATGAAAATAGAATGATAGGAGGATTTTTTATTTATAATCATAAA
GGAGAAGTGTTAATTTCTCGAATTTTTCGAAATGACTTGAGTCGAAATGT
TGTCGATGCATTTAGAGTCAATGTTATTCATGCTAGACAACAAGTCAGAA
GTCCTGTAACAAATATAGCTAGAACTAGTTTTTTTCATGTTAAACGAGGA
AGTATTTGGCTTTGTGCAGTTGCCAGAACTAATGTCAATGCTGTCATGGT
GTTCCAATTTTTGCATCGCATGCTTGATGTAATGGGACAATATTTTGGAA
AAGTTAATGAAGAAAATATCAAAAATAATTTTGTTCTGATTTATGAATTA
TTAGATGAAATTCTCGATTACGGCTACCCGCAAAATACCGACACCGGCAT
CCTCAAGACTTACATCACTCAAGCCGGCATCAAGTCGACCACGAAAGAGG
AAACCACTCAAATTACTAATCAAGTTACCGGCCAGATTGGTTGGCGCCGA
GAAGGCATCAAATATCGACGTAACGAGCTGTTTTTGGACGTGATCGAATC
AGTGAACCTGCTGATGTCACCACAAGGTCAAATACTGTCGGCCCATGTCG
CAGGCAAGGTCATCATGAAATCGTTCCTGAGCGGCATGCCCGACTGCAAG
TTCGGATTCAACGACAAGCTGAGCCTCGAGAGCAAGAATCGCGATGACAA
AGGGGATTTCAGAACGAGCGGGGCCAGCAGCGGCAACAAGAGCAGCGGCT
CCAGCATTGCCATTGACGACTGCCAATTCCATCAGTGTGTCAAGCTAGGC
AGATTCGAGACCGAGCATACGATTTCCTTTATTCCCCCGGACGGAGAATT
CGAGTTGATGCGGTACCGCACGACCAAGGAGATCAATTTGCCGTTCCGAG
TGATTCCGCTCGTCCGAGAGATGGGCAAGTCGCGCATGGAGGTCAAGCTC
GTTGTCAAGGCAAACTTCAAGCCGAATTTCTTCGCCCAAAAAGTGGAAGT
GCGAATCCCGACGCCGACAAACACGAGTGGAGTCCAGGTGATCTGCATGA
AGGGCAAGGCCAAATACAAGGCCGCTGAGAACGCGATCGTTTGGAAGATC
AAGCGGATGGCAGGAATGAAAGATTGCCAGTTGTCAGCAGAGATTGATTT
ACTCACTGTCGGAGACCGGCAGAAGCGGTGGACTCGCCCCCCGATCTCGA
TGAATTTTGAGGTTCCATTCGCTCCGTCGGGATTCAAAGTGCGATATCTG
AAAGTATTCGAATCAAAGCTGAACTATTCTGACCACGAGGTCATCAAATG
GGTGCGCTACATCGGCAAGAGCGGATTATATGAAACGCGATGCTGATTCA
GTTCTCTGGTGGTGAAATATTTGGTTTTTCCAGTGATATAGATCTAGGAT
TGGAACTAATTTTGCAATTTTATTGATTATATATTATTATTATTGTATTG
ATTATTGTTGTTGTGGTGGTATCCAACGTGGCACTACATGGTTGCCATTA
GCAACATAGATTTGGGCCACCTTTGATTGGTCAATATTTGTATGTTTCTC
TTGCTGTCTCTCGATATATAACGATTTTGTTGATCGATCATTTCTGTTGT
CGTTTTGCAGATAAATGTTGCATTTCTTTTTTTATCGCTCTGTTCACTGA
TGGTGGCCAAATGGTCGATCGGATTGACGGAGGTGATTACCAAGTTGTCA
AGGGTCACCGACAGCATGGGACACCGGCAATTTGTTAAGCATGCGATTGA
ATGAATACCGATTTTGATTGATATTATATCGGTCACCTGCTGTAATTGCC
GTTGTCAAGGGAACCGATCCCTGTTACTAATAGTGAATAATTGCTGAAAT
AATTAGAATTTGTCAGTCGACAATTATTTAGCAGT
back to top

protein sequence of SMED30017634-orf-1

>SMED30017634-orf-1 ID=SMED30017634-orf-1|Name=SMED30017634-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=443bp
MIGGFFIYNHKGEVLISRIFRNDLSRNVVDAFRVNVIHARQQVRSPVTNI
ARTSFFHVKRGSIWLCAVARTNVNAVMVFQFLHRMLDVMGQYFGKVNEEN
IKNNFVLIYELLDEILDYGYPQNTDTGILKTYITQAGIKSTTKEETTQIT
NQVTGQIGWRREGIKYRRNELFLDVIESVNLLMSPQGQILSAHVAGKVIM
KSFLSGMPDCKFGFNDKLSLESKNRDDKGDFRTSGASSGNKSSGSSIAID
DCQFHQCVKLGRFETEHTISFIPPDGEFELMRYRTTKEINLPFRVIPLVR
EMGKSRMEVKLVVKANFKPNFFAQKVEVRIPTPTNTSGVQVICMKGKAKY
KAAENAIVWKIKRMAGMKDCQLSAEIDLLTVGDRQKRWTRPPISMNFEVP
FAPSGFKVRYLKVFESKLNYSDHEVIKWVRYIGKSGLYETRC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036168AP2_Mu_C_sf
IPR001392Clathrin_mu
IPR028565MHD
IPR022775AP_mu_sigma_su
IPR018240Clathrin_mu_CS
IPR011012Longin-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0016192vesicle-mediated transport
GO:0006810transport
GO:0006897endocytosis
GO:0006898receptor-mediated endocytosis
GO:0010171body morphogenesis
GO:0010940positive regulation of necrotic cell death
GO:0015031protein transport
GO:0061357positive regulation of Wnt protein secretion
GO:0072583clathrin-dependent endocytosis
GO:0097499protein localization to non-motile cilium
Vocabulary: cellular component
TermDefinition
GO:0030131clathrin adaptor complex
GO:0005886plasma membrane
GO:0005905clathrin-coated pit
GO:0008021synaptic vesicle
GO:0016020membrane
GO:0045202synapse
GO:1990075periciliary membrane compartment
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001392Clathrin adaptor, mu subunitPRINTSPR00314CLATHRINADPTcoord: 159..187
score: 76.18
coord: 249..276
score: 71.1
coord: 318..333
score: 51.14
coord: 98..125
score: 75.32
coord: 12..32
score: 53.25
coord: 358..369
score: 56.06
IPR001392Clathrin adaptor, mu subunitPIRSFPIRSF005992AP_complex_mucoord: 1..442
e-value: 3.0E-143
score: 475.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.1170coord: 159..437
e-value: 1.2E-100
score: 338.3
NoneNo IPR availableGENE3DG3DSA:3.30.450.60coord: 1..141
e-value: 1.7E-58
score: 198.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.1170coord: 291..439
e-value: 1.2E-100
score: 338.3
NoneNo IPR availablePANTHERPTHR10529:SF236AP-2 COMPLEX SUBUNIT MUcoord: 1..442
NoneNo IPR availablePANTHERPTHR10529LOW-DENSITY LIPOPROTEIN RECEPTOR-RELATEDcoord: 1..442
NoneNo IPR availableCDDcd09251AP-2_Mu2_Ctermcoord: 166..441
e-value: 2.56095E-168
score: 471.308
NoneNo IPR availableCDDcd14836AP2_Mu_Ncoord: 1..140
e-value: 4.18548E-87
score: 260.148
IPR022775AP complex, mu/sigma subunitPFAMPF01217Clat_adaptor_scoord: 4..126
e-value: 5.1E-8
score: 32.9
IPR028565Mu homology domainPFAMPF00928Adap_comp_subcoord: 158..442
e-value: 6.0E-81
score: 271.7
IPR028565Mu homology domainPROSITEPS51072MHDcoord: 168..441
score: 44.965
IPR018240Clathrin adaptor, mu subunit, conserved sitePROSITEPS00990CLAT_ADAPTOR_M_1coord: 157..177
IPR018240Clathrin adaptor, mu subunit, conserved sitePROSITEPS00991CLAT_ADAPTOR_M_2coord: 269..283
IPR036168AP-2 complex subunit mu, C-terminal superfamilySUPERFAMILYSSF49447Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptorcoord: 157..441
IPR011012Longin-like domain superfamilySUPERFAMILYSSF64356SNARE-likecoord: 1..139