Cysteine rich secretory protein LCCL domain containing 2

Overview
NameCysteine rich secretory protein LCCL domain containing 2
Smed IDSMED30017626
Length (bp)1514
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cysteine rich secretory protein LCCL domain containing 2 (SMED30017626) t-SNE clustered cells

Violin plots show distribution of expression levels for Cysteine rich secretory protein LCCL domain containing 2 (SMED30017626) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cysteine rich secretory protein LCCL domain containing 2 (SMED30017626) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cysteine rich secretory protein LCCL domain containing 2 (SMED30017626) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017626

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017626SMESG000031543.1 Contig2917newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017626SMESG000031543.1 Contig2917uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017626SMESG000079527.1 Contig2917newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017626SMESG000079527.1 Contig2917uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017626SMESG000031543.1 dd_Smed_v4_11957_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017626SMESG000031543.1 dd_Smed_v4_11957_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 88.1965 bits (217), Expect = 5.414e-18
Identity = 57/188 (30.32%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLCVP 678
            ALT +E++  +++HN  R  V PTASDM  + +DE +      Y  +CV+ H +     GEN    +D   ++  ++  W  ER ++N+       CS         P   CGHY  +V +  + IGCG  FC      +   +N+ L  C Y+     +  +PY+ G  CS C + Y  C + LC P
Sbjct:   27 ALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNL---SAATCS---------PGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEE--TNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYH-CKNSLCEP 199          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 88.1965 bits (217), Expect = 5.414e-18
Identity = 57/188 (30.32%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLCVP 678
            ALT +E++  +++HN  R  V PTASDM  + +DE +      Y  +CV+ H +     GEN    +D   ++  ++  W  ER ++N+       CS         P   CGHY  +V +  + IGCG  FC      +   +N+ L  C Y+     +  +PY+ G  CS C + Y  C + LC P
Sbjct:   27 ALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNL---SAATCS---------PGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEE--TNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYH-CKNSLCEP 199          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 88.1965 bits (217), Expect = 5.414e-18
Identity = 57/188 (30.32%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLCVP 678
            ALT +E++  +++HN  R  V PTASDM  + +DE +      Y  +CV+ H +     GEN    +D   ++  ++  W  ER ++N+       CS         P   CGHY  +V +  + IGCG  FC      +   +N+ L  C Y+     +  +PY+ G  CS C + Y  C + LC P
Sbjct:   27 ALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNL---SAATCS---------PGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEE--TNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYH-CKNSLCEP 199          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Human
Match: R3HDML (R3H domain containing like [Source:HGNC Symbol;Acc:HGNC:16249])

HSP 1 Score: 74.7146 bits (182), Expect = 2.151e-14
Identity = 45/194 (23.20%), Postives = 91/194 (46.91%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH--RRLDNY-GENGRLSSDN--NITNSVVSWFQERIYFNIFETGD------KRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFY---DSGQKDQPYEIGNICSDCDNAYQ-FCHDDLC 672
            +++++    LD HN++R SV+P A++M+ +++D+ + +    +  +C++ H   +L  Y G+N  + S    ++ + + SW +E+ ++      D       RC              C HY  MV ++   +GC    C+S +     +       C Y    +   + PY++G  CS C  +YQ  C+ ++C
Sbjct:   58 ISVRDMNALLDYHNHIRASVYPPAANMEYMVWDKRLARAAEAWATQCIWAHGPSQLMRYVGQNLSIHSGQYRSVVDLMKSWSEEKWHYLFPAPRDCNPHCPWRCDGPT----------CSHYTQMVWASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNYAIKGNWIGESPYKMGKPCSSCPPSYQGSCNSNMC 241          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Human
Match: PI15 (peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGNC:8946])

HSP 1 Score: 72.4034 bits (176), Expect = 1.266e-13
Identity = 51/183 (27.87%), Postives = 79/183 (43.17%), Query Frame = 1
Query:  157 EFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRR---LDNYGEN--GRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK---DQPYEIGNICSDCDNAY-QFCHDDLCVP 678
              LD HN +R  VFP A++M+ +++DEN+ K    +   C+++H     L   G+N   R     +I   V  W+ E   +      D  C+ +  +  + P   C HY  MV +T   IGC    C +       +       C Y        + PY++G  CS C  +Y   C D+LC P
Sbjct:   69 AILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQD--CNPRCPMRCFGP--MCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFP 247          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 60.4622 bits (145), Expect = 2.954e-10
Identity = 55/200 (27.50%), Postives = 82/200 (41.00%), Query Frame = 1
Query:  109 FCLIAFCFALTLKERKE-----FLDIHNYLRRSVF-----------PTASDMQELIYDENIEKHVTEYLEKCVFEHR-RLDNYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCS-KKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK---DQPYEIGNICSDCDNA 645
             CL+ F F  TL E  E      L  HNYLR  +            P+AS+M +LI+D  +E    +Y   C   H     N GEN    +   +T +       R   N++E+  +R     N + + L +S  GH   M  +T   IGCG   C+S + G +     ++  C Y           Y+ G  CS+C + 
Sbjct:    8 ICLLIFSFCETLCEFSETGKNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGHSASRANIGENMYWWTSPVVTQTDAELLGNR-SANLWESEFQRFGWNGNLLTEELFNSGIGHATQMAWATTNKIGCGISKCSSDSFGTQ-----YVVVCLYSPAGNYIGMDIYKSGETCSNCPDG 201          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 53.9138 bits (128), Expect = 9.322e-8
Identity = 49/183 (26.78%), Postives = 73/183 (39.89%), Query Frame = 1
Query:  151 RKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLD-NYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATS-GDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYD 693
            +K     HN  RR V   ASDM  L + + +      + + C F H R   N GEN   +  +N ++++  WF E          + RC       ++     CGHY  +V +    +GCG   C        R + NVF+  C Y+   K         CS+C      C+  LC   K Y+
Sbjct:   81 KKWITHEHNRYRRMV--PASDMNMLYWSDELAASAQRHADTCDFRHSRGRINVGENIWAAPYSNYSDAISIWFNE--------VHNPRCG-----CNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFV--CHYNPQGK---------CSNCPANAPACYQGLCYMPKNYE 237          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Celegans
Match: lon-1 (pep chromosome:WBcel235:III:5474478:5477999:1 gene:WBGene00003055.1 transcript:F48E8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lon-1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.274e-7
Identity = 50/188 (26.60%), Postives = 76/188 (40.43%), Query Frame = 1
Query:  151 RKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLD-NYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATS-GDRNYSNVFLTFCFYDSGQKDQP---YEIGN--ICSDCDNAYQFCHDDLCVPKKRYD 693
            +K     HN  RR V   ASDM  L + + +      + + C F H R   N GEN   +  +N ++++  WF E          + RC       ++     CGHY  +V +    +GCG   C        R + NVF+  C Y+      P   +  G+   CS+C      C+  LC   K Y+
Sbjct:   81 KKWITHEHNRYRRMV--PASDMNMLYWSDELAASAQRHADTCDFRHSRGRINVGENIWAAPYSNYSDAISIWFNE--------VHNPRCG-----CNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGRGHRNVFV--CHYNPQGNTMPAFTWASGDNGKCSNCPANAPACYQGLCYMPKNYE 251          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Celegans
Match: scl-1 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20608])

HSP 1 Score: 51.6026 bits (122), Expect = 2.263e-7
Identity = 51/207 (24.64%), Postives = 77/207 (37.20%), Query Frame = 1
Query:  100 YGYFCLIAFCF--ALTLKERKEFLDIHNYLRRSVFPT-----------ASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNYGEN----------GRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK-DQP-YEIGNICSDCDNA 645
            Y   CL+A       T   +   +D HN LR ++  +           A+DM++++ D  +      Y   C   H +   YGEN          G L S   I  +  +W +E   F           K N +   L +S  GH   M  +    IGCG K C    S  RN + + +   +   G    +P Y+ G  CS C  +
Sbjct:    2 YFILCLLAIGVNAQFTSTGQSSIVDAHNKLRSAIAKSTYVAKGTKKEPATDMRKMVVDSTVAASAQNYANTCPTGHSKGTGYGENLYWSWTSADVGSLDSYGEI--AAAAWEKEFQDFGW---------KSNAMDTTLFNSGIGHATQMAWANTSSIGCGVKNCGRDAS-MRNMNKIAVVCQYSPPGNTMGRPIYKEGTTCSSCSGS 196          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Celegans
Match: scl-13 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q9N5N4])

HSP 1 Score: 51.6026 bits (122), Expect = 2.815e-7
Identity = 55/208 (26.44%), Postives = 88/208 (42.31%), Query Frame = 1
Query:   76 MKFLLKTCYGYFCLIAFCFALTLK----ERKEFLDIHNYLRRSVF-----------PTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLP-DSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVF--LTFCFYDSG---QKDQPYEIGNICSDC 636
            MKF L       CL+A     T +     + + +D HN LR ++            P+AS+M+++++DE +     EY E C  +H    +YGEN   S  ++  +S+  +       N +E+  ++    +T +D     +  GH   M  +    IGCG K C      D N  N++     C YDS         Y+ G  CS C
Sbjct:    1 MKFAL-------CLLAIFGCATAQFSSTAQGQIVDAHNKLRSAIAQGSYVAAGTQEPSASNMRKIVWDETVAAAAQEYAEGCPDDHSGT-SYGENLYWSWSSSAPSSLDKF--GVAASNSWESEFQKYGWTSTFLDEAGFATGIGHATQMAWAETSKIGCGIKNCGK----DANKKNMYKVAVVCQYDSAGNMMDSDIYQQGETCSAC 194          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 48.9062 bits (115), Expect = 6.908e-6
Identity = 41/176 (23.30%), Postives = 69/176 (39.20%), Query Frame = 1
Query:   67 LSSMKFLLKTCYGYFCLIAFC-------FALTLKERKEFLDIHNYLRRSVF-------PTASDMQELIYDENIEKHVTEYLEKCVFEH---RRLDNY--GENGRL--------SSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGH 513
            +     LL T     C +AF          +T +ER   L  HN LR+ V        P A +M+E+++D+ +     ++ + C F H   R ++ +  G+N  +        + D +  + + SWF E      +  GD    K             GHY  +V      +GCG+
Sbjct:    2 MQPSAVLLTTIMIISCEVAFACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNE---VQKYSFGDAWSPK------------TGHYSQLVWGETSLVGCGY 162          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 78.9518 bits (193), Expect = 4.269e-16
Identity = 58/195 (29.74%), Postives = 90/195 (46.15%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFE---HRRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFY---DSGQKDQPYEIGNICSDCDNAY-QFCHDDLC--VPKKR 687
            ++ K+    LD HN +R  VFP A++M+ +++DE + K    +  +C++E   H  L + G+N  + S    +I + V SW+ ER  F+       RCS           S C HY  MV +    IGC  K C+        +    L  C Y    +   + PY+IG  CS C ++Y   C+ + C   PK R
Sbjct:   61 ISGKDMTALLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSY----PSRCS----------GSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQCDSRPKSR 241          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Zebrafish
Match: r3hdml (R3H domain containing-like [Source:ZFIN;Acc:ZDB-GENE-090313-275])

HSP 1 Score: 78.9518 bits (193), Expect = 4.269e-16
Identity = 58/195 (29.74%), Postives = 90/195 (46.15%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFE---HRRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFY---DSGQKDQPYEIGNICSDCDNAY-QFCHDDLC--VPKKR 687
            ++ K+    LD HN +R  VFP A++M+ +++DE + K    +  +C++E   H  L + G+N  + S    +I + V SW+ ER  F+       RCS           S C HY  MV +    IGC  K C+        +    L  C Y    +   + PY+IG  CS C ++Y   C+ + C   PK R
Sbjct:   61 ISGKDMTALLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHHFLQHIGQNLSIISGRYKSIIDLVKSWYDERHSFSY----PSRCS----------GSVCTHYTQMVWAASNKIGCAIKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSSYGGSCNKNQCDSRPKSR 241          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 80.4925 bits (197), Expect = 1.067e-15
Identity = 56/198 (28.28%), Postives = 86/198 (43.43%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLD---NYGEN-----GRLSSDNNITNSVVSWFQERIYFNIFETGD------KRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK---DQPYEIGNICSDCDNAY-QFCHDDLC 672
            A+   +R+E L +HN LR  V+PTAS+M+ +I+D+ +E+  T + E+C +EH   D   + G+N     GR  S       V +W+ E   +      +      +RCS             C HY  +V +T   +GC    C         + N     C Y        + PY+ G  CS C  +Y   C D+LC
Sbjct:   59 AIEWSDREEILKLHNKLRGEVYPTASNMEYMIWDDELERSATSWAEQCQWEHGPQDLLMSIGQNLAVHWGRYRSP---AYHVQAWYDEVKDYTYPYPHECNPWCPERCS----------GPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLC 243          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Zebrafish
Match: crispld1a (cysteine-rich secretory protein LCCL domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-090612-1])

HSP 1 Score: 71.2478 bits (173), Expect = 8.984e-13
Identity = 52/194 (26.80%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRR---LDNYGEN-----GRLSSDNNITNSVVSWFQE--RIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDS---GQKDQPYEIGNICSDCDNAY-QFCHDDLC 672
            A+T  + +  LD+HN LR  V+P AS+M+ +++D  +E+   E+ E C++EH     L   G+N     GR       T+ V +W+ E     F   +  +  C  + +         C HY  +V +T   IGC    C +     + ++      C Y          PY+ G  CS C  +Y   C ++LC
Sbjct:   61 AITASDMQAILDLHNKLRGQVYPPASNMEYMVWDNELERSAEEWAETCLWEHGPAGLLPQIGQNLGVHWGRYRPP---TSHVQAWYDEVKDYSFPYPQECNPHCPFRCS------GPVCTHYTQLVWATSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSCSACPPSYGGVCRENLC 245          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Zebrafish
Match: crispld1a (cysteine-rich secretory protein LCCL domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-090612-1])

HSP 1 Score: 71.2478 bits (173), Expect = 1.003e-12
Identity = 52/194 (26.80%), Postives = 86/194 (44.33%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRR---LDNYGEN-----GRLSSDNNITNSVVSWFQE--RIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYD---SGQKDQPYEIGNICSDCDNAY-QFCHDDLC 672
            A+T  + +  LD+HN LR  V+P AS+M+ +++D  +E+   E+ E C++EH     L   G+N     GR       T+ V +W+ E     F   +  +  C  + +         C HY  +V +T   IGC    C +     + ++      C Y    +     PY+ G  CS C  +Y   C ++LC
Sbjct:   61 AITASDMQAILDLHNKLRGQVYPPASNMEYMVWDNELERSAEEWAETCLWEHGPAGLLPQIGQNLGVHWGRYRPP---TSHVQAWYDEVKDYSFPYPQECNPHCPFRCS------GPVCTHYTQLVWATSSRIGCAINVCYNMNVWGQIWAKAVYLVCNYSPKGNWWGYAPYKHGTSCSACPPSYGGVCRENLC 245          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 1.777e-19
Identity = 60/189 (31.75%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  124 FCFALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNY-GENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLC 672
             C AL  +E++  LD HN+ R    P+ASDM +L +D  +E     Y EKC++EH +   + GEN  + S +  ++   +  W +ER Y+N F TG   C +            CGHY  MV +  + +GCG  FC      D    N++L  C Y+     + + PY+ G+ C++C + +  C   LC
Sbjct:   26 LCLALNYEEKRIILDKHNFYRSQTEPSASDMIKLTWDSALEAMAKSYAEKCIWEHNKDRGFIGENLFVMSGSSLDVALGLDDWHKERGYYN-FTTG--MCQEGQM---------CGHYTQMVWAGTERVGCGQNFCPKLEGVDDE--NMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDH-VCIGSLC 199          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 75.485 bits (184), Expect = 9.625e-15
Identity = 50/200 (25.00%), Postives = 93/200 (46.50%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH--RRLDNY-GENGRLSSD--NNITNSVVSWFQERIYFNIFETGD--KRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYD---SGQKDQPYEIGNICSDCDNAY-QFCHDDLCVPKKRYDKIS 702
            ++ ++    LD HN +R  VFP A++M+ +++DE + K    +  +C ++H   +L  Y G+N  + S    +I + V  W+ ER +++     +    C  K T       + C HY  MV ++   IGC    CT+       +       C Y    +   + PY++G  CS C  +Y   C +++C    + +K++
Sbjct:   58 ISPRDMSALLDYHNQVRSKVFPPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRYIGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCT------GAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMCFSGVKSNKLT 251          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 75.485 bits (184), Expect = 9.781e-15
Identity = 50/200 (25.00%), Postives = 93/200 (46.50%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH--RRLDNY-GENGRLSSD--NNITNSVVSWFQERIYFNIFETGD--KRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYD---SGQKDQPYEIGNICSDCDNAY-QFCHDDLCVPKKRYDKIS 702
            ++ ++    LD HN +R  VFP A++M+ +++DE + K    +  +C ++H   +L  Y G+N  + S    +I + V  W+ ER +++     +    C  K T       + C HY  MV ++   IGC    CT+       +       C Y    +   + PY++G  CS C  +Y   C +++C    + +K++
Sbjct:   53 ISPRDMSALLDYHNQVRSKVFPPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRYIGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCT------GAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMCFSGVKSNKLT 246          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Xenopus
Match: CRISPLD1 (cysteine-rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:100490431])

HSP 1 Score: 72.0182 bits (175), Expect = 5.812e-13
Identity = 57/194 (29.38%), Postives = 86/194 (44.33%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLD-------NYGEN-GRLSSDNNITNSVVSWFQE-RIY-FNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYD---SGQKDQPYEIGNICSDCDNAY-QFCHDDLC 672
            A+T  + K  LD+HN LR  V+P AS+M+ +I+D  +E+    + E C++EH   D       N G + GR       T  V +W+ E R Y F   +  D  C  + +         C HY  +V +T   IGC    C +     + +       C Y    +     PY+ G+ CS C  +Y   C D+LC
Sbjct:   56 AITESDMKLILDLHNKLRGEVYPPASNMEFMIWDVELERSAEAWAETCLWEHGPADLLPVIGQNLGAHWGRYRPP---TYHVQAWYDEVRDYTFPYPQECDPYCPFRCS------GPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYLVCNYSPKGNWWGHAPYKHGHPCSACPPSYGGGCKDNLC 240          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Xenopus
Match: CRISPLD1 (cysteine-rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:100490431])

HSP 1 Score: 71.2478 bits (173), Expect = 1.324e-12
Identity = 57/194 (29.38%), Postives = 86/194 (44.33%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLD-------NYGEN-GRLSSDNNITNSVVSWFQE-RIY-FNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYD---SGQKDQPYEIGNICSDCDNAY-QFCHDDLC 672
            A+T  + K  LD+HN LR  V+P AS+M+ +I+D  +E+    + E C++EH   D       N G + GR       T  V +W+ E R Y F   +  D  C  + +         C HY  +V +T   IGC    C +     + +       C Y    +     PY+ G+ CS C  +Y   C D+LC
Sbjct:   56 AITESDMKLILDLHNKLRGEVYPPASNMEFMIWDVELERSAEAWAETCLWEHGPADLLPVIGQNLGAHWGRYRPP---TYHVQAWYDEVRDYTFPYPQECDPYCPFRCS------GPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKAIYLVCNYSPKGNWWGHAPYKHGHPCSACPPSYGGGCKDNLC 240          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 92.4337 bits (228), Expect = 1.533e-20
Identity = 63/204 (30.88%), Postives = 97/204 (47.55%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCK 726
            ALT  E++  +D+HN  R  V P ASDM ++ +D+ +      Y +KCV+ H +     GEN    +D   ++  +V +W +E  Y+N F T    C          P+  CGHY  +V S  + IGCG  FC +    +   +N+ L  C Y+     +  +PY+ G  CS C   Y  C + LC P +  +K   S   V +
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYN-FSTAT--CD---------PNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEE--ANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS-CENSLCEPMRNPEKAQDSPPRVTE 217          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 92.4337 bits (228), Expect = 1.533e-20
Identity = 63/204 (30.88%), Postives = 97/204 (47.55%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCK 726
            ALT  E++  +D+HN  R  V P ASDM ++ +D+ +      Y +KCV+ H +     GEN    +D   ++  +V +W +E  Y+N F T    C          P+  CGHY  +V S  + IGCG  FC +    +   +N+ L  C Y+     +  +PY+ G  CS C   Y  C + LC P +  +K   S   V +
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYN-FSTAT--CD---------PNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEE--ANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS-CENSLCEPMRNPEKAQDSPPRVTE 217          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 92.8189 bits (229), Expect = 1.344e-19
Identity = 63/204 (30.88%), Postives = 97/204 (47.55%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCK 726
            ALT  E++  +D+HN  R  V P ASDM ++ +D+ +      Y +KCV+ H +     GEN    +D   ++  +V +W +E  Y+N F T    C          P+  CGHY  +V S  + IGCG  FC +    +   +N+ L  C Y+     +  +PY+ G  CS C   Y  C + LC P +  +K   S   V +
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYN-FSTAT--CD---------PNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEE--ANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS-CENSLCEPMRNPEKAQDSPPRVTE 217          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 87.4261 bits (215), Expect = 3.928e-19
Identity = 59/186 (31.72%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLC 672
            ALT  E++  +D+HN  R  V P ASDM ++ +D+ +      Y +KCV+ H +     GEN    +D   ++  +V +W +E  Y+N F T    C          P+  CGHY  +V S  + IGCG  FC +    +   +N+ L  C Y+     +  +PY+ G  CS C   Y  C + LC
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYN-FSTA--TCD---------PNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEE--ANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS-CENSLC 199          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Mouse
Match: R3hdml (R3H domain containing-like [Source:MGI Symbol;Acc:MGI:3650937])

HSP 1 Score: 76.2554 bits (186), Expect = 3.952e-15
Identity = 45/188 (23.94%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH---RRLDNYGENGRLSSD--NNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFY---DSGQKDQPYEIGNICSDCDNAYQF-CHDDLC 672
            ++ ++    LD HN++R SV P A++M+ +++DE + +    +  +C++ H   + +   G+N  + S    ++ + V SW +E+ +++      K C+     +   P   C HY  MV ++   +GC    C+S       +       C Y    +   + PY+ G  CS C  +YQ  C+ ++C
Sbjct:   58 ISARDMSALLDYHNHIRASVHPPAANMEYMVWDEQLARSAEAWATQCIWTHGPSQLMKYVGQNLSIHSGRFRSVVDLVRSWSEEKRHYSF--PAPKDCTPHCPWLCSGP--VCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKPCSACPPSYQGNCNSNMC 241          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. UniProt/SwissProt
Match: sp|Q9ET66|PI16_MOUSE (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 9.399e-19
Identity = 63/204 (30.88%), Postives = 97/204 (47.55%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCK 726
            ALT  E++  +D+HN  R  V P ASDM ++ +D+ +      Y +KCV+ H +     GEN    +D   ++  +V +W +E  Y+N F T    C          P+  CGHY  +V S  + IGCG  FC +    +   +N+ L  C Y+     +  +PY+ G  CS C   Y  C + LC P +  +K   S   V +
Sbjct:   29 ALTEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYN-FSTAT--CD---------PNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEE--ANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS-CENSLCEPMRNPEKAQDSPPRVTE 217          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. UniProt/SwissProt
Match: sp|Q6UXB8|PI16_HUMAN (Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.600e-17
Identity = 57/188 (30.32%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGENGRLSSDN--NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLCVP 678
            ALT +E++  +++HN  R  V PTASDM  + +DE +      Y  +CV+ H +     GEN    +D   ++  ++  W  ER ++N+       CS         P   CGHY  +V +  + IGCG  FC      +   +N+ L  C Y+     +  +PY+ G  CS C + Y  C + LC P
Sbjct:   27 ALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNL---SAATCS---------PGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEE--TNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYH-CKNSLCEP 199          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. UniProt/SwissProt
Match: sp|A2A5I3|CRSPL_MOUSE (Peptidase inhibitor R3HDML OS=Mus musculus OX=10090 GN=R3hdml PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.764e-14
Identity = 45/188 (23.94%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH---RRLDNYGENGRLSSD--NNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFY---DSGQKDQPYEIGNICSDCDNAYQF-CHDDLC 672
            ++ ++    LD HN++R SV P A++M+ +++DE + +    +  +C++ H   + +   G+N  + S    ++ + V SW +E+ +++      K C+     +   P   C HY  MV ++   +GC    C+S       +       C Y    +   + PY+ G  CS C  +YQ  C+ ++C
Sbjct:   58 ISARDMSALLDYHNHIRASVHPPAANMEYMVWDEQLARSAEAWATQCIWTHGPSQLMKYVGQNLSIHSGRFRSVVDLVRSWSEEKRHYSF--PAPKDCTPHCPWLCSGP--VCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKGNWIGEAPYKAGKPCSACPPSYQGNCNSNMC 241          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. UniProt/SwissProt
Match: sp|Q8BZQ2|CRLD2_MOUSE (Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus OX=10090 GN=Crispld2 PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.934e-14
Identity = 54/194 (27.84%), Postives = 88/194 (45.36%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRR---LDNYGEN-----GRLSSDNNITNSVVSWFQERIYFNIFETGD--KRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK---DQPYEIGNICSDCDNAY-QFCHDDLC 672
            A+ + +R+E L +HN LR  V+P AS+M+ + +DE +E+    +  +C++EH     L + G+N     GR  S       V SW+ E   +      +   RC ++ +         C HY  MV +T   IGC    C +       + N     C Y        + PY+ G  CS+C ++Y   C ++LC
Sbjct:   50 AIPMSDRQEILMLHNKLRGQVYPPASNMEHMTWDEELERSAAAWAHRCLWEHGPAGLLRSIGQNLAVHWGRYRSPG---FHVQSWYDEVKDYTYPYPHECTPRCRERCS------GPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYGGGCLNNLC 234          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. UniProt/SwissProt
Match: sp|P16563|CRIS2_MOUSE (Cysteine-rich secretory protein 2 OS=Mus musculus OX=10090 GN=Crisp2 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.027e-13
Identity = 61/237 (25.74%), Postives = 103/237 (43.46%), Query Frame = 1
Query:  103 GYFCLIAFCFALTLKE--------------------RKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNY------GENGRLSSDNNITNSVV-SWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNV-FLTFCFY-----DSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCK 714
             +F ++ F FAL L+                     ++E ++ HN LRRSV PT SD+ ++ +      +  ++  KC+ EH   D+       GEN  +S+D  + ++V+ SW+ E   F ++  G K            P+S  GHY  +V  +   IGCG  +C        N  N+ +   C Y     +  +K  PY+ G  C+ C N    C + LC     ++ +  +C+
Sbjct:    2 AWFQVMLFVFALLLRSPLTEGKDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCGENLYMSTDPTLWSTVIQSWYNENEDF-VYGVGAK------------PNSAVGHYTQLVWYSSFKIGCGIAYCP-------NQDNLKYFYVCHYCPMGNNVMKKSTPYQQGTPCASCPNN---CENGLCTNSCDFEDLLSNCE 215          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. TrEMBL
Match: A0A1I8HLS1 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.182e-28
Identity = 91/325 (28.00%), Postives = 146/325 (44.92%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNY---GENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLP-DSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACI-NGIE-NQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCK 1092
            +T  E +  +++HN LRRSV P A++M +LI    +     +  + C FEH    +Y   GEN  +   +N + +V+ WF ER  + +  +G   C  +     Y    S CGHY  +V+++++ +GCG K C+ ++          L  C Y+SG    PY  G  CS C +A   C D LCVP         +C + CK+C           CDC           + +   C+ C      C+ NG +      NCSC+C   F G +C+ N+ QF AS   +  G   R     PV    + + +   +  + + I ++C+
Sbjct:    1 MTDAEHQGIVELHNRLRRSVLPEAANMNQLIASATLRNLAQQAADTCRFEHNYGGDYSGLGENLYMG-GSNASLAVMLWFIERENYRLSASG-TLCGLEYGNGRYPQYASSCGHYYQVVQASVREVGCGKKACSGSS----------LIVCEYNSGSGSPPYTAGPSCSGCSSARPRCLDGLCVP---VGTSGSTCSLACKSCTKLVGNATGS-CDC-----------SGSYVPCTKCDSDATQCLNNGTDVGASLTNCSCVCPTDFYGDRCQYNRAQF-ASALQLRFGGELRSRSYFPVPKSFWPSLWRALEPPLLTAIADFCR 297          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. TrEMBL
Match: A0A1I8F324 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.484e-25
Identity = 80/276 (28.99%), Postives = 124/276 (44.93%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNY---GENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLP-DSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACINGIENQKD-----KNCSCICEESFEGKQCE 936
            +T  E +  +++HN LRRSV P A++M +LI    +     +  + C FEH    +Y   GEN  +   +N + +V+ WF ER  + +  +G   C  +     Y    S CGHY  +V+++++ +GCG K C+ ++          L  C Y+SG    PY  G  CS C +A   C D LCVP         +C + C++C           CDC           + +   C+ C      C+N   N  D      NCSC+C   F G +C+
Sbjct:   20 MTDAEHQGIVELHNRLRRSVLPEAANMNQLIASATLRNLAQQAADTCRFEHNYGGDYSGLGENLYMGG-SNASLAVMLWFIERENYRLSASG-ALCGLEYGNGRYPQYASSCGHYYQVVQASVREVGCGKKACSGSS----------LIVCEYNSGSGSPPYTAGPSCSGCSSARPRCLDGLCVP---VGTSGSTCSLACQSCTKLVGNATG-SCDC-----------SGSYVPCTKCDSDATQCLN---NGTDVGASLTNCSCVCPADFYGDRCQ 265          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. TrEMBL
Match: A0A1I8GC84 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.014e-24
Identity = 96/356 (26.97%), Postives = 152/356 (42.70%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNY---GENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPK--------KRYD---KISRS-CKVVCKNCAPYFDPMNS--CLCDCPLDT-DGNSCKGN--STIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGL----------PWRHGMNIPVNLLEFKNS-YSEFQRFIHSDILNYCKHKESN 1107
            AL+  ++ EF++IHN LR +V+P A+ M  L ++  +E       EKC FEH    +Y   GEN  +    N++   ++W  E+  +N          K  T         CGHYK ++   +  +GCGH  C+ +           L FC Y SG K      G+ CS C +    C + +CV          + Y+   K+S + CK+ C NC        S  C C C      G  C+     + + CS C      C+NG  + K  +C+C C  +F G +C++  RQF       ++G+           +   + +PV    FK S +S  +  +   I  +C   E+N
Sbjct:   33 ALSASQKTEFVNIHNRLREAVYPRATKMNFLTWNTRLESLAQAASEKCKFEHYYGGDYEGLGENIYMGYRTNVSEITLAWHIEKAIYNYTAASCNPAGKLTT---------CGHYKQLISDGVLEVGCGHYVCSGSN----------LVFCEYSSGSKVYT-SGGSACSKCPSYRGLCLNGMCVNSSIVSQSDVQAYNPGAKVSSTECKLNCSNCGVSQSIPGSLDCYCKCASGIGTGAYCENRVADSKSTCSVCSNLTTPCLNGGTDLKGASCACQCPATFVGPRCQV-YRQF------YLNGMRLSIIAEQFCAFDRCLQVPVTRTMFKTSIWSRLRPAVAQAINAFCTASEAN 361          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. TrEMBL
Match: A0A267DUN5 (SCP domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033476g2 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.730e-24
Identity = 96/356 (26.97%), Postives = 152/356 (42.70%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNY---GENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPK--------KRYD---KISRS-CKVVCKNCAPYFDPMNS--CLCDCPLDTD-GNSCKGN--STIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGL----------PWRHGMNIPVNLLEFKNS-YSEFQRFIHSDILNYCKHKESN 1107
            AL+  ++ EF++IHN LR +V+P A+ M  L ++  +E       EKC FEH    +Y   GEN  +    N++   ++W  E+  +N          K  T         CGHYK ++   +  +GCGH  C+ +           L FC Y SG K      G+ CS C +    C + +CV          + Y+   K+S + CK+ C NC        S  C C C      G  C+     + + CS C      C+NG  + K  +C+C C  +F G +C++  RQF       ++G+           +   + +PV    FK S +S  +  +   I  +C   E+N
Sbjct:   49 ALSASQKTEFVNIHNRLREAVYPRATKMNFLTWNTRLESLAQAASEKCKFEHYYGGDYEGLGENIYMGYRTNVSEITLAWHIEKAIYNYTAASCNPAGKLTT---------CGHYKQLISDGVLEVGCGHYVCSGSN----------LVFCEYSSGSKVYT-SGGSACSKCPSYRGLCLNGMCVNSSIVSQSDVQAYNPGAKVSSTECKLNCSNCGVSQSIPGSLDCYCKCASGIGTGAYCENRVADSKSTCSVCSNLTTPCLNGGTDLKGASCACQCPATFVGPRCQV-YRQF------YLNGMRLSIIAEQFCAFDRCLQVPVTRTMFKTSIWSRLRPAVAQAINAFCTASEAN 377          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. TrEMBL
Match: A0A1I8I2K1 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.952e-24
Identity = 90/335 (26.87%), Postives = 145/335 (43.28%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNY---GENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLP-DSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACI-NGIE-NQKDKNCSCICEESFEGKQCEI----------NKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCK 1092
            +T  E +  +++HN LRRSV P A++M +LI    +     +  + C FEH    +Y   GEN  +   +N + +V+ WF ER  + +  +G   C  +     Y    S CGHY  +V+++++ +GCG K C+ ++          L  C Y+SG    PY  G  CS C +A   C D LCVP         +C + C++C           CDC           + +   C+ C      C+ NG +      NCSC+C   F G +C            N+ QF AS   +  G   R     PV    + + +   +  + + I ++C+
Sbjct:   20 MTDAEHQGIVELHNRLRRSVLPEAANMNQLIASATLRNLAQQAADTCRFEHNYGGDYSGLGENLYMG-GSNASLAVMLWFIERENYRLSASG-ALCGLEYGNGRYPQYASSCGHYYQVVQASVREVGCGKKACSGSS----------LIVCEYNSGSGSPPYTAGPSCSGCSSARPRCLDGLCVP---VGTSGSTCSLACQSCTKLVGNATG-SCDC-----------SGSYVPCTKCDSDATQCLNNGTDVGASLTNCSCVCPADFYGDRCHGCVGRLFCSADNRAQF-ASALQLRFGGELRSRSYFPVPKSFWPSLWRALEPPLLTAIADFCR 326          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Cavefish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 79.7221 bits (195), Expect = 1.777e-15
Identity = 55/198 (27.78%), Postives = 86/198 (43.43%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLD---NYGEN-----GRLSSDNNITNSVVSWFQERIYFNIFETGD------KRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK---DQPYEIGNICSDCDNAY-QFCHDDLC 672
            A+   +R+E L +HN LR  V+PTAS+M+ +++D+ +E+  T + E+C +EH   D   + G+N     GR  S       V +W+ E   +      +      +RCS             C HY  +V +T   +GC    C+        + N     C Y        + PY  G  CS C  +Y   C D+LC
Sbjct:   55 AIQWSDREEILALHNKLREGVYPTASNMEYMVWDDELERSATHWAEQCQWEHGPQDLLMSIGQNLAVHWGRYRSP---AYHVQAWYDEVKDYTYPYPHECNPWCPERCS----------GPMCTHYTQLVWATTSRVGCAVHTCSRMNVWGEIWENAIYLVCNYSPKGNWIGEAPYAHGRPCSQCPPSYGGGCRDNLC 239          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 75.485 bits (184), Expect = 4.616e-15
Identity = 55/201 (27.36%), Postives = 93/201 (46.27%), Query Frame = 1
Query:   97 CYGYFCLIAFCFALTLKE-RKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHR--RLDNYGENGRLSSDN-NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDS-----GQKDQPYEIGNICSDCDNAYQFCHDDLC 672
            C G + L+A       KE ++  +++HN+ R +V P A+DM  + +   +     EY  KC++EH     +  GEN  +++   +I  ++  WF E  +++     +  C++         +  CGHY  MV +  K +GCG   C +  +    + N  L  C Y       GQK  PY++G  CS C +  + C D  C
Sbjct:   11 CAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNIMGENLFITTGPLDIEKALSDWFMEHKHYSY---DNNTCAE---------NEMCGHYTQMVWAKTKEVGCGSHLCETVEA--LGFKNATLLVCNYLPLGNYMGQK--PYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 76.2554 bits (186), Expect = 4.661e-15
Identity = 55/201 (27.36%), Postives = 93/201 (46.27%), Query Frame = 1
Query:   97 CYGYFCLIAFCFALTLKE-RKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHR--RLDNYGENGRLSSDN-NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDS-----GQKDQPYEIGNICSDCDNAYQFCHDDLC 672
            C G + L+A       KE ++  +++HN+ R +V P A+DM  + +   +     EY  KC++EH     +  GEN  +++   +I  ++  WF E  +++     +  C++         +  CGHY  MV +  K +GCG   C +  +    + N  L  C Y       GQK  PY++G  CS C +  + C D  C
Sbjct:   11 CAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNIMGENLFITTGPLDIEKALSDWFMEHKHYSY---DNNTCAE---------NEMCGHYTQMVWAKTKEVGCGSHLCETVEA--LGFKNATLLVCNYLPLGNYMGQK--PYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 75.485 bits (184), Expect = 7.557e-15
Identity = 53/191 (27.75%), Postives = 88/191 (46.07%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH--RRLDNY-GEN--GRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK---DQPYEIGNICSDCDNAYQ-FCHDDLCVP 678
            A++ ++    L  HN +R  VFP AS+M+ +++D+++ K   E+   C++EH  R L  + G+N   R     +I   V  W+ E   ++     D  C+ +  +  Y P   C HY  MV +T   IGC    C +       +       C Y        + PY++G  CS C  +Y   C +++CVP
Sbjct:   69 AISQEDMLAILQYHNKVRGKVFPPASNMEYMVWDDSLAKRAEEWASTCLWEHGPRNLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRD--CNPRCPLKCYGP--MCTHYTQMVWATSNKIGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYAGSCSNNMCVP 255          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 75.0998 bits (183), Expect = 8.712e-15
Identity = 55/201 (27.36%), Postives = 93/201 (46.27%), Query Frame = 1
Query:   97 CYGYFCLIAFCFALTLKE-RKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHR--RLDNYGENGRLSSDN-NITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDS-----GQKDQPYEIGNICSDCDNAYQFCHDDLC 672
            C G + L+A       KE ++  +++HN+ R +V P A+DM  + +   +     EY  KC++EH     +  GEN  +++   +I  ++  WF E  +++     +  C++         +  CGHY  MV +  K +GCG   C +  +    + N  L  C Y       GQK  PY++G  CS C +  + C D  C
Sbjct:   11 CAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKCIWEHNPDSQNIMGENLFITTGPLDIEKALSDWFMEHKHYSY---DNNTCAE---------NEMCGHYTQMVWAKTKEVGCGSHLCETVEA--LGFKNATLLVCNYLPLGNYMGQK--PYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 5.595e-13
Identity = 49/184 (26.63%), Postives = 77/184 (41.85%), Query Frame = 1
Query:  148 ERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHR---RLDNYGENGR--LSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQ---KDQPYEIGNICSDCDNAYQF-CHDDLC 672
            ER+   + HN LR SV P A+DM+ + +D  +      + ++C + H    +LD  G+N    + S+  +   V +WF E  ++   E  +K CS +       P   C HY  +V +  + +GC    C   +  D  +       C Y        + PY  G  CS C   Y   C   LC
Sbjct:    5 ERRALTEYHNRLRASVHPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQLDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPE--EKECSPECPHTCRGPI--CTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 48.1358 bits (113), Expect = 1.455e-6
Identity = 47/209 (22.49%), Postives = 85/209 (40.67%), Query Frame = 1
Query:  160 FLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-----RRLDNY--GENGRLSSDNNITN-SVVSWFQERIYFNI-FETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFY-----DSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVV-----CKN 729
             +D+HN LRR+V P+A +M ++++ +    +   +   C F H     R+   +  GEN  +SS     N ++  W+ E I     ++ G                   GHY  +V      +GC   +C       +     +L  C Y      + + ++PY++G  C+ C    + C ++LC    +Y     +C  +     CKN
Sbjct:   47 IVDLHNDLRRNVTPSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWTCGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTT------------TGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAK-----YLYVCHYCPMGNLNTRINRPYDLGTSCASCP---KNCVNNLCDNPCKYKNGYANCAAMVAQYTCKN 235          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 84.7297 bits (208), Expect = 1.785e-17
Identity = 61/195 (31.28%), Postives = 96/195 (49.23%), Query Frame = 1
Query:  136 LTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-RRLDNYGEN-----GRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFC-FYDSGQKD--QPYEIGNICSDCDNAYQFCHDDLCVPKKRYD 693
            LT ++ +  +++HN+ R  V P+A+ M  L +D N++     Y  KC++EH   L++ GEN     G+L    +++ +V  WF ER+ +          S +N   D   D  CGHY  MV +    +GC   FC +  + D N  NV    C ++ +G  D  +PY  G+ CS C      C + LCV K+  D
Sbjct:   57 LTDQQEEMLVELHNHYRGQVSPSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNTELEDTGENLFAGTGKL----DLSEAVEKWFLERLDY----------SYENNSCDE--DKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWN--NVSYLVCNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLCVKKEVGD 233          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 76.2554 bits (186), Expect = 1.843e-15
Identity = 51/186 (27.42%), Postives = 86/186 (46.24%), Query Frame = 1
Query:  151 RKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-----RRLDNY--GENGRLSSDNNITNSVV-SWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFC-FYDSG--QKDQPYEIGNICSDCDNAYQFCHDDLCV 675
            + E +D+HN  RR+V P A+DM  + Y E +      +++KCV +H     R L+ Y  GEN   S+   +  S++ +W++E  +F                         GHY  +V ++   +GCG   C+         +N++L  C +Y +G  ++  PY++G  C+ C N    C D LC 
Sbjct:   16 QAEIVDVHNAFRRAVEPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYELGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTN-------------GKPVGHYTQVVWNSSYKVGCGVTLCS---------NNIYLYGCHYYRAGNFKRWPPYKVGTPCASCPND---CVDKLCT 176          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 76.6406 bits (187), Expect = 1.882e-15
Identity = 51/185 (27.57%), Postives = 86/185 (46.49%), Query Frame = 1
Query:  151 RKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH-----RRLDNY--GENGRLSSDNNITNSVV-SWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFC-FYDSG--QKDQPYEIGNICSDCDNAYQFCHDDLC 672
            + E +D+HN  RR+V P A+DM  + Y E +      +++KCV +H     R L+ Y  GEN   S+   +  S++ +W++E  +F                         GHY  +V ++   +GCG   C+         +N++L  C +Y +G  ++  PY++G  C+ C N    C D LC
Sbjct:   31 QAEIVDVHNAFRRAVEPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYELGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTN-------------GKPVGHYTQVVWNSSYKVGCGVTLCS---------NNIYLYGCHYYRAGNFKRWPPYKVGTPCASCPND---CVDKLC 190          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 71.633 bits (174), Expect = 1.218e-13
Identity = 50/183 (27.32%), Postives = 80/183 (43.72%), Query Frame = 1
Query:  157 EFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEH---RRLDNYGEN--GRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK---DQPYEIGNICSDCDNAY-QFCHDDLCVP 678
              LD HN +R  VFP AS+M+ +++DE + K   ++   C++EH     L   G+N   R     +I   V  W+ E   ++     D  C+ +  +  Y P   C HY  MV +T   +GC    C +       +       C Y        + PY++G  CS C  +Y   C +++C P
Sbjct:   68 AILDYHNKVRGKVFPPASNMEYMVWDETLAKTAEDWAHACLWEHGPSHLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYSFPYPRD--CNPRCPLRCYGP--MCTHYTQMVWATSNKVGCAIHTCYNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSACPPSYGGSCSNNMCFP 246          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 73.9442 bits (180), Expect = 1.248e-13
Identity = 52/198 (26.26%), Postives = 88/198 (44.44%), Query Frame = 1
Query:  133 ALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLD---NYGEN-----GRLSSDNNITNSVVSWFQE-RIYFNIFETG-----DKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQK---DQPYEIGNICSDCDNAY-QFCHDDLC 672
            A+   +R+E L +HN LR SV+P+A++M+ +++D+ +E+  T++ E+C +EH   D   + G+N     GR  S       V +W+ E + Y   + +       +RCS             C HY  +V +T   +GC    C         +       C Y        + PY  G  CS C  ++   C ++LC
Sbjct:   70 AILWSDREEILLLHNKLRSSVYPSAANMEHMVWDDELERSATQWAEECRWEHGPQDLLMSIGQNLAVHWGRYRSP---AFHVQAWYDEVKDYTYPYPSECNPWCPERCS----------GPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLC 254          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Planmine SMEST
Match: SMESG000031543.1 (SMESG000031543.1)

HSP 1 Score: 929.472 bits (2401), Expect = 0.000e+0
Identity = 452/453 (99.78%), Postives = 453/453 (100.00%), Query Frame = 1
Query:   76 MKFLLKTCYGYFCLIAFCFALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCKHKESNEDCQKIKNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSALLGYVLNNPSKELEKLIDNSKRIYPIRNPPGGCTNKLTFKFDVLLALLIIFLWR 1434
            MKFLLKTCYGYFCLIAFCFALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCKHK+SNEDCQKIKNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSALLGYVLNNPSKELEKLIDNSKRIYPIRNPPGGCTNKLTFKFDVLLALLIIFLWR
Sbjct:    1 MKFLLKTCYGYFCLIAFCFALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCKHKQSNEDCQKIKNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSALLGYVLNNPSKELEKLIDNSKRIYPIRNPPGGCTNKLTFKFDVLLALLIIFLWR 453          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Planmine SMEST
Match: SMESG000031543.1 (SMESG000031543.1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 319/320 (99.69%), Postives = 320/320 (100.00%), Query Frame = 1
Query:  475 MVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCKHKESNEDCQKIKNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSALLGYVLNNPSKELEKLIDNSKRIYPIRNPPGGCTNKLTFKFDVLLALLIIFLWR 1434
            MVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCKHK+SNEDCQKIKNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSALLGYVLNNPSKELEKLIDNSKRIYPIRNPPGGCTNKLTFKFDVLLALLIIFLWR
Sbjct:    1 MVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCKHKQSNEDCQKIKNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSALLGYVLNNPSKELEKLIDNSKRIYPIRNPPGGCTNKLTFKFDVLLALLIIFLWR 320          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Planmine SMEST
Match: SMESG000066259.1 (SMESG000066259.1)

HSP 1 Score: 464.537 bits (1194), Expect = 1.105e-158
Identity = 228/418 (54.55%), Postives = 301/418 (72.01%), Query Frame = 1
Query:  112 CLIAFCFALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIA--NCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYC-KHKESNEDCQKIKNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSALLGYVLNNPSKELEKLIDNSKRIYPIRN 1356
            C +     LT +ERKEFLD+HN++RR V+P ASDMQEL Y+ENIEK V EYLE+C FEHR+LD YGENGRL+SD+N+TN+V+SWFQERIYFNI   G+ RCSK N+ I +L + QCGHYKMMVKS LK +GCG+KFC +      +Y++ +++FCFY+SGQKDQPYEIG  CS+C ++YQFC DDLCVPK RYDK SR+CK+ C+NCA YFDP NSCLCDCP  T+GNSC+G   +   NC  C  +GL+C +G E+ +  NC+C C   + G+ CEI K QF +S+Y+V+DG  WR+ M IPVN +EFK S+ +FQ  I   I  +C K+  S  +C+KI+   +  +NVL I GFP LLENGSLA+RIF   +       +E  VS++LL  +L N S +++ LI+N +++  I N
Sbjct:   12 CALYQILGLTPRERKEFLDLHNHVRRLVYPPASDMQELEYNENIEKSVNEYLEQCKFEHRKLDGYGENGRLASDSNVTNTVMSWFQERIYFNISAEGEGRCSKSNSKIPFLHEVQCGHYKMMVKSNLKSLGCGYKFCKNIQGNGISYTDSYISFCFYNSGQKDQPYEIGKPCSECSSSYQFCRDDLCVPKSRYDKNSRTCKLKCRNCAEYFDPKNSCLCDCPDGTEGNSCRGTPVVVDENCPSCLAQGLSCNSGTEDSRSGNCNCKCPPEYIGEYCEIRKDQFDSSFYYVVDGTDWRYNMMIPVNAIEFKKSFYKFQNAIARLINEFCVKNLNSYPECKKIEENQIIYDNVLLIPGFPHLLENGSLAIRIFIIFNDVTDNVKQERFVSTSLLREILTN-SDDIKNLIENVRKVVLIDN 428          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Planmine SMEST
Match: SMESG000066258.1 (SMESG000066258.1)

HSP 1 Score: 427.557 bits (1098), Expect = 2.337e-144
Identity = 197/414 (47.58%), Postives = 279/414 (67.39%), Query Frame = 1
Query:  115 LIAF---CFALTLKERKEFLDIHNYLRRSVFPTASDMQELIYDENIEKHVTEYLEKCVFEHRRLDNYGENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCVPKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIANCSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHVIDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCKHKESNEDCQKIKNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSALLGYVLNNPSKELEKLIDNSKRIYP 1347
            LI F      LT +ERK+FLDIHN+ RR+V P AS+MQEL+Y+E IE  V  YLE+C FEHR+LD +GENGRL++D NIT++V+SWFQER+YFN F+ G  RCS++N+  +YL   +CGHYKMMV+ TL  +GCG+K C S       Y   ++TFCFY++GQ D+PYEIG  C+ C+  Y FC+ +LCVP  +Y +   SC++ C NCA +F    SCLCDCP +T+   C+GN    +C+ C+KK L+C NG E   D NC+C C ++++G+ C +   +  ASY+HVIDG  WR+ M++P+N+ +FKNSY +FQ  I  DI N+C    S + C +I    +N N+VL +   P++LENGSL++ +F N S+  +   +E  V   +L  + N+PS  L+ L++N KRIYP
Sbjct:   12 LIVFPLKTLLLTPEERKQFLDIHNHFRRAVTPQASNMQELVYNETIENVVNGYLEQCRFEHRKLDGFGENGRLATDKNITDTVMSWFQERVYFNYFKNGSSRCSQENSKFEYLSKVECGHYKMMVRGTLASLGCGYKLCKSPYGDGITYPESYITFCFYNAGQMDRPYEIGKPCTGCEKGYLFCYRELCVPADKYFRNQTSCELKCLNCATFFSK-KSCLCDCPSNTEAEVCRGNINNPSCTTCQKKALSCNNGEEVSVDNNCTCKCTKAYQGEYCNVRIDKHEASYHHVIDGTKWRYNMSVPINIFQFKNSYEKFQTVIALDIFNFCLTSSSTKQCSEIVTYSINQNDVLLLPESPIILENGSLSIEMFVNYSIMNEIGKQEKFVPPFILSQIWNSPSPNLQSLVENIKRIYP 424          
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Planmine SMEST
Match: SMESG000055797.1 (SMESG000055797.1)

HSP 1 Score: 79.337 bits (194), Expect = 8.296e-17
Identity = 66/223 (29.60%), Postives = 97/223 (43.50%), Query Frame = 1
Query:   73 SMKFLLKTCYGYFCLIAFCFA---LTLKERKEFLDIHNYLRRSVF-------PTASDMQELIYDENIEKHVTEYLEKCVFEH-----RRLDNY---GENGRLSSDNNITNSVVSWFQERIYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCTSATSGDRNYSNVFLTF--CFYDSG---QKDQPYEIGNICSDCDNAYQFCHDDLC 672
            +M F++K     F L+A  F    L+ +ER + L+IHN  R+SV        P A++MQ++++ E          +KC F H     R+  NY   G+N  + +  NI   V  WF E    + +   D  CS          ++ CGHY  +V +  K +GCG   C         YS   + F  C Y  G     + PYE G  CS C +    C + LC
Sbjct:    5 TMNFIIKIT---FVLVALDFCSGDLSEEERNQILEIHNKFRKSVANGEVSNQPKAANMQQMVWSEEAASRAQATADKCSFNHDTINDRKYGNYEWVGQNIAMFTGGNIAKGVQLWFNE---VSGYTFSDNSCS----------ENTCGHYTQIVWAKSKELGCGLAKCK--------YSKYKMNFLVCNYGPGGNFNSELPYETGEPCSKCQSGSN-CSNGLC 202          
The following BLAST results are available for this feature:
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI165.414e-1830.32peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI165.414e-1830.32peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI165.414e-1830.32peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
R3HDML2.151e-1423.20R3H domain containing like [Source:HGNC Symbol;Acc... [more]
PI151.266e-1327.87peptidase inhibitor 15 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-102.954e-1027.50SCP-Like extracellular protein [Source:UniProtKB/... [more]
lon-19.322e-826.78pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
lon-11.274e-726.60pep chromosome:WBcel235:III:5474478:5477999:1 gene... [more]
scl-12.263e-724.64SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-132.815e-726.44SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG84836.908e-623.30gene:FBgn0038126 transcript:FBtr0082782[more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
r3hdml4.269e-1629.74R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
r3hdml4.269e-1629.74R3H domain containing-like [Source:ZFIN;Acc:ZDB-GE... [more]
crispld21.067e-1528.28cysteine-rich secretory protein LCCL domain contai... [more]
crispld1a8.984e-1326.80cysteine-rich secretory protein LCCL domain contai... [more]
crispld1a1.003e-1226.80cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.11.777e-1931.75pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
R3HDML9.625e-1525.00R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML9.781e-1525.00R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
CRISPLD15.812e-1329.38cysteine-rich secretory protein LCCL domain contai... [more]
CRISPLD11.324e-1229.38cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi161.533e-2030.88peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.533e-2030.88peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.344e-1930.88peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi163.928e-1931.72peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
R3hdml3.952e-1523.94R3H domain containing-like [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ET66|PI16_MOUSE9.399e-1930.88Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
sp|Q6UXB8|PI16_HUMAN2.600e-1730.32Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=... [more]
sp|A2A5I3|CRSPL_MOUSE2.764e-1423.94Peptidase inhibitor R3HDML OS=Mus musculus OX=1009... [more]
sp|Q8BZQ2|CRLD2_MOUSE3.934e-1427.84Cysteine-rich secretory protein LCCL domain-contai... [more]
sp|P16563|CRIS2_MOUSE1.027e-1325.74Cysteine-rich secretory protein 2 OS=Mus musculus ... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HLS12.182e-2828.00SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8F3247.484e-2528.99SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8GC841.014e-2426.97SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A267DUN51.730e-2426.97SCP domain-containing protein (Fragment) OS=Macros... [more]
A0A1I8I2K11.952e-2426.87SCP domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld21.777e-1527.78cysteine-rich secretory protein LCCL domain contai... [more]
ENSAMXT00000036030.14.616e-1527.36peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.14.661e-1527.36peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
pi15a7.557e-1527.75peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
ENSAMXT00000031557.18.712e-1527.36peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000374.15.595e-1326.63pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP31.455e-622.49cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000023160.21.785e-1731.28peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000020676.21.843e-1527.42cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000020674.21.882e-1527.57cysteine-rich venom protein pseudecin-like [Source... [more]
pi15a1.218e-1327.32peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
crispld21.248e-1326.26cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Cysteine rich secretory protein LCCL domain containing 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031543.10.000e+099.78SMESG000031543.1[more]
SMESG000031543.10.000e+099.69SMESG000031543.1[more]
SMESG000066259.11.105e-15854.55SMESG000066259.1[more]
SMESG000066258.12.337e-14447.58SMESG000066258.1[more]
SMESG000055797.18.296e-1729.60SMESG000055797.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017626 ID=SMED30017626|Name=Cysteine rich secretory protein LCCL domain containing 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1514bp
ATCTTACGCCTTAATACATAACCGATTTTCATTAAAAACATATTTTGAAT
GAATTGAGCTTAACAATTGTCTTCGATGAAGTTTCTGTTAAAAACTTGTT
ATGGATATTTTTGCTTGATTGCCTTCTGTTTTGCCTTAACTTTAAAAGAA
CGAAAAGAGTTTCTTGATATTCATAATTACCTACGTAGGTCGGTTTTCCC
AACAGCGTCGGACATGCAGGAATTAATTTATGATGAAAACATTGAGAAGC
ATGTTACGGAATATCTCGAAAAATGCGTATTTGAGCATCGGCGATTGGAC
AATTACGGAGAAAACGGGCGCCTTTCCTCGGATAATAATATAACAAATTC
GGTTGTCAGCTGGTTTCAAGAAAGAATTTATTTCAACATATTTGAAACGG
GAGATAAAAGATGTTCAAAGAAAAATACAATTATAGACTATTTGCCTGAT
TCTCAATGTGGACATTACAAAATGATGGTTAAAAGCACTTTAAAGGGTAT
TGGCTGTGGTCATAAGTTTTGCACTTCCGCAACATCAGGCGACAGGAATT
ATTCAAATGTTTTTCTAACGTTTTGTTTTTATGATTCTGGTCAAAAAGAC
CAGCCATATGAAATTGGAAATATTTGTTCAGACTGCGATAACGCCTATCA
GTTCTGTCACGATGATCTTTGTGTTCCAAAGAAAAGATATGACAAAATTT
CAAGATCTTGTAAAGTCGTTTGTAAGAATTGCGCTCCCTATTTTGATCCC
ATGAATTCCTGTCTTTGCGATTGTCCATTAGATACAGATGGGAATTCTTG
TAAAGGAAATTCAACTATTGCAAACTGTTCGTTTTGCAAAAAGAAAGGTT
TAGCCTGCATTAATGGAATCGAAAATCAAAAGGACAAAAATTGCAGTTGC
ATATGTGAAGAAAGTTTTGAAGGAAAACAGTGTGAAATAAATAAGCGTCA
ATTTTCGGCTTCTTATTATCATGTTATTGATGGATTGCCTTGGCGCCACG
GGATGAATATTCCAGTGAATTTATTAGAGTTCAAAAATTCATATTCGGAA
TTTCAAAGATTCATTCATAGCGATATTCTGAATTATTGCAAACATAAAGA
AAGCAATGAAGATTGTCAGAAAATAAAAAACATTCCGTTGAACTCGAATA
ATGTTCTGCCTATACAAGGTTTTCCATTACTGTTGGAAAATGGATCTTTG
GCGTTAAGAATATTTTTCAACTTGAGTGTTTCACTTCAAGCCAGTTATAA
AGAGAGTTTGGTATCATCAGCCCTTCTGGGATACGTTTTGAATAACCCTT
CAAAAGAATTAGAAAAACTTATCGATAATTCCAAAAGAATTTATCCAATT
AGAAACCCACCTGGTGGATGTACGAATAAATTGACATTCAAATTTGATGT
TTTATTAGCACTTTTAATCATTTTTCTCTGGCGTTAACATTTATTTCAAA
TGAAATACGTTTGCCATTTTTTCATTTTGTTATTTACTTATTATTATAAA
TAAAGTATTTACGG
back to top

protein sequence of SMED30017626-orf-1

>SMED30017626-orf-1 ID=SMED30017626-orf-1|Name=SMED30017626-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MKFLLKTCYGYFCLIAFCFALTLKERKEFLDIHNYLRRSVFPTASDMQEL
IYDENIEKHVTEYLEKCVFEHRRLDNYGENGRLSSDNNITNSVVSWFQER
IYFNIFETGDKRCSKKNTIIDYLPDSQCGHYKMMVKSTLKGIGCGHKFCT
SATSGDRNYSNVFLTFCFYDSGQKDQPYEIGNICSDCDNAYQFCHDDLCV
PKKRYDKISRSCKVVCKNCAPYFDPMNSCLCDCPLDTDGNSCKGNSTIAN
CSFCKKKGLACINGIENQKDKNCSCICEESFEGKQCEINKRQFSASYYHV
IDGLPWRHGMNIPVNLLEFKNSYSEFQRFIHSDILNYCKHKESNEDCQKI
KNIPLNSNNVLPIQGFPLLLENGSLALRIFFNLSVSLQASYKESLVSSAL
LGYVLNNPSKELEKLIDNSKRIYPIRNPPGGCTNKLTFKFDVLLALLIIF
LWR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR014044CAP_domain
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014044CAP domainSMARTSM00198SCP_3coord: 24..177
e-value: 4.4E-10
score: 48.8
IPR014044CAP domainPFAMPF00188CAPcoord: 30..168
e-value: 2.0E-10
score: 41.5
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 20..213
e-value: 7.7E-34
score: 118.9
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 8..180
NoneNo IPR availablePANTHERPTHR10334:SF414coord: 21..194
NoneNo IPR availableCDDcd05559CAP_PI16_HrTT-1coord: 26..169
e-value: 4.53353E-26
score: 100.57
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 21..194