TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30017619
Length (bp)1590
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30017619) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30017619) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30017619) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30017619) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017619

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017619SMESG000027280.1 SMESG000027263.1 SMESG000026967.1 SMESG000026956.1 SMESG000026954.1 SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025794.1 SMESG000025583.1 SMESG000025517.1 SMESG000025934.1 SMESG000025926.1 SMESG000025797.1 Contig3847GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30017619SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 122.094 bits (305), Expect = 2.750e-29
Identity = 110/508 (21.65%), Postives = 218/508 (42.91%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKC--NISQDKVTDHLQSEIFAHTKLLMDFV-VNFNNEM-----------EMLKANNNGLSAVNELLRNEIN---------------ELKLDG-ERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRT----AKCADYTNNKELIQSTDRNN-GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDID 1533
            M  ++Y+ + + +  +LC LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D  + +++  L ++C   E  C +   LR ++ H  TC +  + CP      ++C   +S+  +  HLQ +     +L  +F   +F+ E             +   N  G   +  LL                    E   D  +  + +   L   C +Q     +  ED+P       N +  L   +     ++    A+    ++ +              K  +  +  + ++Q+ +L E+  ++++LS   D               G  +WK+  +  ++ +AK   N   +S +F THK G+K+ +    +G G G+GTHLS++  ++ G FD +LEWPF   VTF+L++Q      +  HV+ T        ++        S D ++ GFG+ +F+S +++    + +R++ +FI+ +V++ 
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCP------NRCPMKLSRRDLPAHLQHDC-PKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESV--------------KPHLAMMCALVSRQRQELQELRRELEELSVGSD---------------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRAAVELP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 115.546 bits (288), Expect = 7.848e-27
Identity = 124/528 (23.48%), Postives = 225/528 (42.61%), Query Frame = 1
Query:  148 YNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCK--------------------------EMSCDYVD----ELRK-MEEH-SRTCKYRSVAC--------------------PYSNIGCD-KCNI--------SQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRE-------EIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            Y  + V  +++   C  C  +L + +   C  RFC +C++  L  +   P  T  C++ ++   + ++ D     +I  LQ+ C+                          E+ C   D     LRK + +H  + CKYR   C                    P   + C  KC++        +  ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ ER++E       +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  VT  L++Q +   H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSS--PKCTA-CQESIV--KDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 115.546 bits (288), Expect = 7.848e-27
Identity = 124/528 (23.48%), Postives = 225/528 (42.61%), Query Frame = 1
Query:  148 YNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCK--------------------------EMSCDYVD----ELRK-MEEH-SRTCKYRSVAC--------------------PYSNIGCD-KCNI--------SQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRE-------EIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            Y  + V  +++   C  C  +L + +   C  RFC +C++  L  +   P  T  C++ ++   + ++ D     +I  LQ+ C+                          E+ C   D     LRK + +H  + CKYR   C                    P   + C  KC++        +  ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ ER++E       +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  VT  L++Q +   H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:   39 YKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSS--PKCTA-CQESIV--KDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 536          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 113.235 bits (282), Expect = 6.065e-26
Identity = 95/371 (25.61%), Postives = 171/371 (46.09%), Query Frame = 1
Query:  436 KMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRE-------EIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            ++  H   C      C +   GC     +Q ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ ER++E       +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  VT  L++Q +   H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:  217 ELSAHLSECVNAPSTCSFKRYGCVFQGTNQ-QIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 113.235 bits (282), Expect = 6.065e-26
Identity = 95/371 (25.61%), Postives = 171/371 (46.09%), Query Frame = 1
Query:  436 KMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRE-------EIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            ++  H   C      C +   GC     +Q ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ ER++E       +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  VT  L++Q +   H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:  217 ELSAHLSECVNAPSTCSFKRYGCVFQGTNQ-QIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 561          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 87.4261 bits (215), Expect = 3.838e-18
Identity = 53/173 (30.64%), Postives = 89/173 (51.45%), Query Frame = 1
Query: 1042 KLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKM----CLRVDPDGFGDGK--GTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADY----TNNKELIQS-TDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            ++L  A    ++   + +WK+DK   +  +AK+G +  I+S  F++H+ G+KM    CL      FGDG   G  +S++  L+KGEFD  LEWPF  ++  +L++Q  R           D      N K L +   +RN  FG   F SL  L    + +++++I+++  VD
Sbjct:  249 RILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACL------FGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQ---NYVKDDKIYVQIDVD 412          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 82.4185 bits (202), Expect = 7.025e-17
Identity = 47/133 (35.34%), Postives = 72/133 (54.14%), Query Frame = 1
Query: 1132 AKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTD--RNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSV 1524
             KN  +  IYS+ F +H  G+KM     P G G     + SVF CLMKGE+D ILEWPFR  VTF++++   +   +++T    +    +E ++  +  RN  FGF  FL L +++   +   +  IFI+  V
Sbjct:  175 TKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKE-LLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVT---EFAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 91.6633 bits (226), Expect = 2.397e-19
Identity = 51/169 (30.18%), Postives = 92/169 (54.44%), Query Frame = 1
Query: 1042 KLLEMAANQNQLNY-GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNN------GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            ++L+ A ++  +NY G  +WK+  ++ KMA+A+      + S  F T + G+K+   +  +G G G+ TH+SV+  ++ GE+D +L+WPF HS+TF L  Q  +    S     A+        ++  R +      GFGF +F+S + L S P  ++ + +F++  VD
Sbjct:  307 QMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQ----SGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP-FIKGDTVFLRVKVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 90.8929 bits (224), Expect = 3.498e-19
Identity = 51/169 (30.18%), Postives = 92/169 (54.44%), Query Frame = 1
Query: 1042 KLLEMAANQNQLNY-GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNN------GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            ++L+ A ++  +NY G  +WK+  ++ KMA+A+      + S  F T + G+K+   +  +G G G+ TH+SV+  ++ GE+D +L+WPF HS+TF L  Q  +    S     A+        ++  R +      GFGF +F+S + L S P  ++ + +F++  VD
Sbjct:  316 QMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQ----SGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP-FIKGDTVFLRVKVD 479          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 51.9878 bits (123), Expect = 8.961e-7
Identity = 32/148 (21.62%), Postives = 71/148 (47.97%), Query Frame = 1
Query: 1084 GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSL-KELSSNPDLMRNNQIFIKCSV 1524
            G  +W++  ++ K+ ++K   + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP R      + +Q T +      A   DY   K +      ++    +Q+  +  ++ ++ + +RN+ +FI+  V
Sbjct:  255 GHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNV------ADAEDYV--KTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 51.9878 bits (123), Expect = 8.961e-7
Identity = 32/148 (21.62%), Postives = 71/148 (47.97%), Query Frame = 1
Query: 1084 GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSL-KELSSNPDLMRNNQIFIKCSV 1524
            G  +W++  ++ K+ ++K   + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP R      + +Q T +      A   DY   K +      ++    +Q+  +  ++ ++ + +RN+ +FI+  V
Sbjct:  255 GHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNV------ADAEDYV--KTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0334036)

HSP 1 Score: 51.9878 bits (123), Expect = 8.961e-7
Identity = 32/148 (21.62%), Postives = 71/148 (47.97%), Query Frame = 1
Query: 1084 GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSL-KELSSNPDLMRNNQIFIKCSV 1524
            G  +W++  ++ K+ ++K   + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP R      + +Q T +      A   DY   K +      ++    +Q+  +  ++ ++ + +RN+ +FI+  V
Sbjct:  255 GHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCTNV------ADAEDYV--KTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 134.035 bits (336), Expect = 3.903e-33
Identity = 118/446 (26.46%), Postives = 200/446 (44.84%), Query Frame = 1
Query:  292 CPGNTEDCK--QELLHLNENIYVDQPMNIKISKLQVKCKEMSCD---YVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSA--VNELLRNEINELKLDGERRREEIAELQRKCA----------------------DQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNY----GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            CP  T +CK  +E  H  +NI     +  K   +   C +       YVD       H + C      C +  +GCD   + ++K+ DH Q+  + H  LL+ F++     +E L+  +  L++  ++EL    + EL+L   +     A +Q  CA                        A E++L +E    +      +S R   L+L +   +  +  +  + ++         +Q  + Q    DKI  + NK +        ++++  G  D  ++EM A   +++     G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +G G G+GTHLS+FF +M+G  D +L+WPF   VT  L++Q  R  H+    +  D +++      +D N   G   F  L +L S    +R++ IFIK  VD+
Sbjct:  156 CPERTLNCKYCKEPFHF-KNIKAHDEICPKYPMICEGCAKKKIPREKYVD-------HIKLCTKFRTPCRFHVVGCDM-TVEKEKIHDHEQACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHKIHEL-HQSLRELELKMGQLCGAGASVQGACALPPPPPPAPTLGTSFTPLPTAVGAALELQLHSEKTKVV-----ELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHRLDQ----DKIEILNNKVR--------QLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFR-PDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 572          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 127.872 bits (320), Expect = 1.773e-31
Identity = 118/501 (23.55%), Postives = 223/501 (44.51%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNI--SQDKVTDHLQSEIFAHTKLLMDFVVN-FNNEMEMLKANNNGLSAVNELL-RNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIE------GNQ-----VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIG---QMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNY---GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRTAKC-ADYTNNKELIQSTDRNN------GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDID 1533
            M  ++Y+ + + +    C LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D  +  +I  L ++C   E  C +  ++++++ H  TC +  + CP      ++C++  ++  + +HLQ +     K+  +F  + F  E      N+ G+     +   N+               A + R+   Q    E      P        V D +   Q           NQ     +A   + N  ++        C   E   K    K+     +E   K  LT M +    L G   +++LE+     +L+    G  +WKL  ++ K+ +AK   N   +S  F TH+ G+K+ +    +G G G+G+HLS++  ++ GE+D +LEWPF + VTF++++Q     ++  H++ T     ++ N ++   S  RN+      GFG+ +F+S +E+    + +R+N IF+K S++I 
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCP------NRCSVKLTRRDLPEHLQHDC-PKRKVKCEFCGSEFTGEA---YENHQGICPQESVYCENKCG-------------ARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCS----LVGRQRQEILELRREMEELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSS--RNSLDESTLGFGYPKFISHEEIKKR-NYIRDNSIFLKASIEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 127.872 bits (320), Expect = 1.773e-31
Identity = 118/501 (23.55%), Postives = 223/501 (44.51%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNI--SQDKVTDHLQSEIFAHTKLLMDFVVN-FNNEMEMLKANNNGLSAVNELL-RNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIE------GNQ-----VAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIG---QMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNY---GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRTAKC-ADYTNNKELIQSTDRNN------GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDID 1533
            M  ++Y+ + + +    C LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D  +  +I  L ++C   E  C +  ++++++ H  TC +  + CP      ++C++  ++  + +HLQ +     K+  +F  + F  E      N+ G+     +   N+               A + R+   Q    E      P        V D +   Q           NQ     +A   + N  ++        C   E   K    K+     +E   K  LT M +    L G   +++LE+     +L+    G  +WKL  ++ K+ +AK   N   +S  F TH+ G+K+ +    +G G G+G+HLS++  ++ GE+D +LEWPF + VTF++++Q     ++  H++ T     ++ N ++   S  RN+      GFG+ +F+S +E+    + +R+N IF+K S++I 
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCP------NRCSVKLTRRDLPEHLQHDC-PKRKVKCEFCGSEFTGEA---YENHQGICPQESVYCENKCG-------------ARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTMMCS----LVGRQRQEILELRREMEELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSS--RNSLDESTLGFGYPKFISHEEIKKR-NYIRDNSIFLKASIEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 117.857 bits (294), Expect = 1.979e-29
Identity = 78/242 (32.23%), Postives = 125/242 (51.65%), Query Frame = 1
Query:  883 FQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQLNY----GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
             Q Q+ + +  CQ+ E+K            +E+      ME  N+Q      K+++  ++NK+ +L   V   D  ++EM A   +++     G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +G G G+GTHLS+FF +M+G  D +L+WPF   VT  L++Q  R  H+    +  D +++      +D N   G   F  L +L S    +R++ IFIK  VD+
Sbjct:   35 LQPQMVELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEI--LNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFR-PDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 272          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 117.857 bits (294), Expect = 1.979e-29
Identity = 78/242 (32.23%), Postives = 125/242 (51.65%), Query Frame = 1
Query:  883 FQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQLNY----GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
             Q Q+ + +  CQ+ E+K            +E+      ME  N+Q      K+++  ++NK+ +L   V   D  ++EM A   +++     G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +G G G+GTHLS+FF +M+G  D +L+WPF   VT  L++Q  R  H+    +  D +++      +D N   G   F  L +L S    +R++ IFIK  VD+
Sbjct:   35 LQPQMVELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEI--LNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFR-PDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 272          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 124.79 bits (312), Expect = 5.580e-30
Identity = 132/523 (25.24%), Postives = 234/523 (44.74%), Query Frame = 1
Query:  148 YNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNE----ICPGN-TED-------CKQELLHL-----NENIYVDQPMNIK--ISKLQVKCK--EMSCDYVD----ELRK-MEEH-SRTCKYRS--------------------VACPYSNIGCDK-CNI--------SQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREE-------IAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            Y    +  ++    C  C+ +L N R   C  RFC TC++  L         C  N T+D       C++E+L L     NE     + + +   +  L+  C+  E+SC   D     +RK + +H  +TCKYR                     V CP   I C   C++        +  ++  H  S    H  L+ ++      ++ ML+  ++  +   ++L N++   +++ ER +E+       I +LQR    QA++++ L+++I   RN+ R   D  DG++   E  Q  +  +E      +A+ A +     ++ +  I++  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  V+  L++Q     H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:   34 YKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEI---RNL-RQTGDEADGMKSNYESLQNRLSQLE-----VMAKNAASWNPGVLETQ--INRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 529          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 118.242 bits (295), Expect = 4.720e-28
Identity = 106/509 (20.83%), Postives = 220/509 (43.22%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVA---------------------CPYSNIGCDKC--NISQDKVTDH----LQSEIFAHTKL---LMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRTAKCADYTNNKELIQSTDRNN-------GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            M  Y+Y+ + +++   LC LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D+ +  ++  L ++C   E  C +  +L++++ H   C +  +                      CP   + C+ C  + + +   DH     Q  ++   K    +M  V++ ++ +E  K          E + + I   +    R           C +Q     +  ED+        ++ D           + + +   ++   +      T  +  E   +  +  +  + ++Q+ ++ E+  ++++LS + +               G  +WK+  ++ K+ +AK   N   +S  F THK G+K+ +    +G G G+G++LSV+  ++ GE+D +LEWPF + VTF+L++Q     ++  H++ T       N K   + T   N       GFG+ +F+S +++    + +R+N IF++ SV+I
Sbjct:    1 MPGYDYKFLEKLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADFTGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHSLVECPKRTQPCPYCNKEFVFDTIQSHQYQCPR-------YPTPCPNQCGIASIAREDL------SNHLKDSCS--------SALVLCPFKDSGCKHRGPKITISRHLEENMRAHLSMMSSLVSRQRQEILELRKQVEELSVSSE---------------GVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFN--PDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRKR-NYVRDNAIFLRASVEI 464          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 113.235 bits (282), Expect = 9.488e-27
Identity = 65/166 (39.16%), Postives = 94/166 (56.63%), Query Frame = 1
Query: 1048 LEM-AANQNQLNY-GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPD-LMRNNQIFIKCSVDIDS 1536
            LEM +A   Q +Y G F+WK+   T+K  DA  G    +YS +F T K G+K+CLR+  +G G GKGTH+S+FF +MKGE+D +L WPF+H VTF L++   R       A   D T+        D N   G   F  + +L+S     +R N ++I+C +D +S
Sbjct:  216 LEMRSACLEQTSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNR--DSVFDAFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIRENTLYIRCIIDTNS 379          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 114.775 bits (286), Expect = 1.521e-26
Identity = 132/548 (24.09%), Postives = 234/548 (42.70%), Query Frame = 1
Query:  148 YNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNE----ICPGN-TED-------CKQELLHL-----NENIYVDQPMNIK--ISKLQVKCK--EMSCDYVD----ELRK-MEEH-SRTCKYRS--------------------VACPYSNIGCDK-CNI---------------------------------SQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREE-------IAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            Y    +  ++    C  C+ +L N R   C  RFC TC++  L         C  N T+D       C++E+L L     NE     + + +   +  L+  C+  E+SC   D     +RK + +H  +TCKYR                     V CP   I C   C++                                 +  ++  H  S    H  L+ ++      ++ ML+  ++  +   ++L N++   +++ ER +E+       I +LQR    QA++++ L+++I   RN+ R   D  DG++   E  Q  +  +E      +A+ A +     ++ +  I++  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  V+  L++Q     H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:   34 YKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEI---RNL-RQTGDEADGMKSNYESLQNRLSQLE-----VMAKNAASWNPGVLETQ--INRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 554          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 104.76 bits (260), Expect = 2.541e-23
Identity = 123/535 (22.99%), Postives = 233/535 (43.55%), Query Frame = 1
Query:  154 YESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEI--CPGNTED-----------CKQELL-----------------------HLNENIY----------VDQPMNIKI-SKLQVKCK-----------EMSCDYVDELRK------MEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEI--------ELLNEDIPALRNVDRNVSDRLDGLQLII-EGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPD---LMRNNQIFIKCSVDI 1530
            Y  V ++Q+   C  C  +L N     C  RFC  CIS+ ++ +E   CP + E+           CK+E+L                       HL + +Y           DQ +  ++   L+ +CK            MS ++ +  +K      +++H   C    + C +SN GC+   + + KV +H  + +  H    M +V+N N ++E        LS +  L      +LK   E + +++++  + C  +  +           L+        +D+++      +QL+  E +++ +R + +  +    + +T         +   D+I  ++ + K     +SN   +++ N +R  L    + N    G+ +WK+  +  K  +A  G    I+S+ F T   G+++C R   +G G GKG+ LS++F +MKGEFD IL WPF+  VT  L++Q  +  H++   + AD  ++      ++ N   G  +F S  +L  NP     ++++ +FIK  VD+
Sbjct:   32 YLFVEQLQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCPIDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMSFNHENNYKKIFFSFQLDKHLCECPEAELQCTFSNYGCN-VMVKRGKVKEHEDTFLRDH----MLYVLNRNMKLE-----EQVLSVLQNL------DLK---EHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLST--------LEAYKDRIDNLDGQFKKHDVLLSNHKMQMTSNEERFRLVEGTSYN----GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFR-ADPNSSSFKRPDSEMNIASGCPRFASHAQL-ENPKNGCYIKDDTLFIKIVVDL 533          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 125.561 bits (314), Expect = 1.108e-30
Identity = 113/501 (22.55%), Postives = 220/501 (43.91%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKC--NISQDKVTDHLQSEIFAHTKLLMDFV-VNFNNEM-----------EMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCAD---QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC------QQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRT----AKCADYTNNKELIQSTDRNN-GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDID 1533
            M  ++Y+ + + +  +LC LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D  + +++  L ++C   E  C +   LR ++ H  TC +  V CP      ++C   +S+  +  HLQ +     +L  +F   +F+ E             +   N  G   +  LL         +  +R +  A   ++      Q+ + +     +P           R D    + +    A   V   F++  + C   C      +  E   K  +  +  + ++Q+ +L E+  ++++LS   D               G  +WK+  +  ++ +AK   N   +S +F THK G+K+ +    +G G G+GTHLS++  ++ G FD +LEWPF   VTF+L++Q      +  HV+ T        ++        S D ++ GFG+ +F+S +++    + +R++ +FI+ SV++ 
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCP------NRCPAKLSRRDLPAHLQHDC-PKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATS---ECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAF--VLCPFKE--SGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELEELSIGSD---------------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRASVELP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 123.25 bits (308), Expect = 1.150e-29
Identity = 124/501 (24.75%), Postives = 201/501 (40.12%), Query Frame = 1
Query:  166 TEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHL-------NENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEE-HSRTCKYRSVACPY--------------------SNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLR------NEINELK----LDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC-QQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNY-------GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            T ++   LC  CK +L     A C  R+C  C++  L      P N   C  E L+        + + + D     ++  L   C    C +   L++ E  H   C +    CP                      ++ C  C      V   +  E+     L  D         E  + +    S    L R      +E+ E +     + +R RE +A L     +       LN+  P L    + +  ++   + I+         V N   +++A  A  C +Q  + Q    DKI             +SNK+ +L  ++  K L MA  + +++        G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +G G G+GTHLS+FF +MKG  D +L+WPF   VT  L++   R  HV    +  D T++      +D N   G   F  + ++ +    +R++ IFIK  VD+
Sbjct:   26 TRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSG---PQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIV--------CVLNREVERVAVTAEACSRQHRLDQ----DKI-----------EALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDAFR-PDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 121.324 bits (303), Expect = 5.502e-29
Identity = 125/505 (24.75%), Postives = 202/505 (40.00%), Query Frame = 1
Query:  166 TEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEIC----PGNTEDCKQELLHL-------NENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEE-HSRTCKYRSVACPY--------------------SNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLR------NEINELK----LDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC-QQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNY-------GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            T ++   LC  CK +L     A C  R+C  C++  L    I     P N   C  E L+        + + + D     ++  L   C    C +   L++ E  H   C +    CP                      ++ C  C      V   +  E+     L  D         E  + +    S    L R      +E+ E +     + +R RE +A L     +       LN+  P L    + +  ++   + I+         V N   +++A  A  C +Q  + Q    DKI             +SNK+ +L  ++  K L MA  + +++        G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +G G G+GTHLS+FF +MKG  D +L+WPF   VT  L++   R  HV    +  D T++      +D N   G   F  + ++ +    +R++ IFIK  VD+
Sbjct:   26 TRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIV--------CVLNREVERVAVTAEACSRQHRLDQ----DKI-----------EALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDAFR-PDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 505          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 120.168 bits (300), Expect = 1.661e-28
Identity = 128/523 (24.47%), Postives = 228/523 (43.59%), Query Frame = 1
Query:  148 YNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEI-CPGNTED-----------CKQELLHL-----NENIYVDQPMNIK--ISKLQVKCK--EMSCDYVD----ELRK-MEEH-SRTCKYRSVAC--------------------PYSNIGCD-KCNI--------SQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRE-------EIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            Y  + V  +++   C  C+ +L N +   C  RFC +C++  L  +   C    E            CK+E+L L     NE     + + +   +  L+ +C+  E+ C   D     LRK + +H  + CKYR   C                    P   + C  KC++        +  ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ ER++E       +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  VT  L++Q +   H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 120.168 bits (300), Expect = 1.661e-28
Identity = 128/523 (24.47%), Postives = 228/523 (43.59%), Query Frame = 1
Query:  148 YNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEI-CPGNTED-----------CKQELLHL-----NENIYVDQPMNIK--ISKLQVKCK--EMSCDYVD----ELRK-MEEH-SRTCKYRSVAC--------------------PYSNIGCD-KCNI--------SQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRE-------EIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            Y  + V  +++   C  C+ +L N +   C  RFC +C++  L  +   C    E            CK+E+L L     NE     + + +   +  L+ +C+  E+ C   D     LRK + +H  + CKYR   C                    P   + C  KC++        +  ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ ER++E       +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  VT  L++Q +   H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 535          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 7.748e-30
Identity = 113/501 (22.55%), Postives = 220/501 (43.91%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKC--NISQDKVTDHLQSEIFAHTKLLMDFV-VNFNNEM-----------EMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCAD---QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC------QQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRT----AKCADYTNNKELIQSTDRNN-GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDID 1533
            M  ++Y+ + + +  +LC LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D  + +++  L ++C   E  C +   LR ++ H  TC +  V CP      ++C   +S+  +  HLQ +     +L  +F   +F+ E             +   N  G   +  LL         +  +R +  A   ++      Q+ + +     +P           R D    + +    A   V   F++  + C   C      +  E   K  +  +  + ++Q+ +L E+  ++++LS   D               G  +WK+  +  ++ +AK   N   +S +F THK G+K+ +    +G G G+GTHLS++  ++ G FD +LEWPF   VTF+L++Q      +  HV+ T        ++        S D ++ GFG+ +F+S +++    + +R++ +FI+ SV++ 
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCP------NRCPAKLSRRDLPAHLQHDC-PKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATS---ECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAF--VLCPFKE--SGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELEELSIGSD---------------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRASVELP 465          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 8.041e-29
Identity = 124/501 (24.75%), Postives = 201/501 (40.12%), Query Frame = 1
Query:  166 TEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHL-------NENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEE-HSRTCKYRSVACPY--------------------SNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLR------NEINELK----LDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC-QQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNY-------GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            T ++   LC  CK +L     A C  R+C  C++  L      P N   C  E L+        + + + D     ++  L   C    C +   L++ E  H   C +    CP                      ++ C  C      V   +  E+     L  D         E  + +    S    L R      +E+ E +     + +R RE +A L     +       LN+  P L    + +  ++   + I+         V N   +++A  A  C +Q  + Q    DKI             +SNK+ +L  ++  K L MA  + +++        G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +G G G+GTHLS+FF +MKG  D +L+WPF   VT  L++   R  HV    +  D T++      +D N   G   F  + ++ +    +R++ IFIK  VD+
Sbjct:   26 TRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSG---PQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIV--------CVLNREVERVAVTAEACSRQHRLDQ----DKI-----------EALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNR-EHVIDAFR-PDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q9BUZ4|TRAF4_HUMAN (TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.321e-28
Identity = 110/508 (21.65%), Postives = 218/508 (42.91%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKC--NISQDKVTDHLQSEIFAHTKLLMDFV-VNFNNEM-----------EMLKANNNGLSAVNELLRNEIN---------------ELKLDG-ERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRT----AKCADYTNNKELIQSTDRNN-GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDID 1533
            M  ++Y+ + + +  +LC LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D  + +++  L ++C   E  C +   LR ++ H  TC +  + CP      ++C   +S+  +  HLQ +     +L  +F   +F+ E             +   N  G   +  LL                    E   D  +  + +   L   C +Q     +  ED+P       N +  L   +     ++    A+    ++ +              K  +  +  + ++Q+ +L E+  ++++LS   D               G  +WK+  +  ++ +AK   N   +S +F THK G+K+ +    +G G G+GTHLS++  ++ G FD +LEWPF   VTF+L++Q      +  HV+ T        ++        S D ++ GFG+ +F+S +++    + +R++ +FI+ +V++ 
Sbjct:    1 MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVIPCP------NRCPMKLSRRDLPAHLQHDC-PKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQCPRLPVACPNQCGVGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESV--------------KPHLAMMCALVSRQRQELQELRRELEELSVGSD---------------GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRAAVELP 465          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.732e-26
Identity = 127/538 (23.61%), Postives = 228/538 (42.38%), Query Frame = 1
Query:  145 DYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNE--ICPGNTED-----------CKQELLHLNENIYV-DQP---MNIKISKLQ----------VKCKEMSCDYVDELRKMEEH-SRTCKYRSV--------------------ACPYSNIGC-DKC--NISQDKVTDHL-------QSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAV--NELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSN-KIDKLSGNVDRKLLEMAANQNQLN--------------YGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKEL-SSNPDLMRNNQIFIKCSVDI 1530
            D  Y+ V +++    C  C  +L N     C  RFC  CI    + N   ICP + E            CK+E+L+L+  +Y  + P     I + + Q          V C   SC      + ++EH S  C++R                      +CP   + C ++C   I + +V +HL       Q   F H    +        E E     ++ L  +  N  L   I++L    E++  +I +L       AE ++   +++     +       L  +Q +      +   +E   +Q +     N Q + +  + L+D +  +  KQ++   E S+ ++  L G   +    +  ++ QLN               G+ +WK+  +  K  +A  G    ++S+ F T + G+++C R   +G G GKGTHLS++F +M+GEFD +L+WPFR  VT  L++Q  +  H+  T K AD  ++       + N   G  +F+S   L +S    ++++ +F+K +VD+
Sbjct:   30 DTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLH--VYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQL-------AETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSA-WLEAQVRQLLQ--IVNQQPSRLDLRSLVDAVDSV--KQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFK-ADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 552          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 2.768e-25
Identity = 95/371 (25.61%), Postives = 171/371 (46.09%), Query Frame = 1
Query:  436 KMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRE-------EIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            ++  H   C      C +   GC     +Q ++  H  S    H  LL ++  +   ++ +L+  +   +   + L N+I   +++ ER++E       +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    E +    + +  QM +   + L +M  +          ++LE A+       G  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  VT  L++Q +   H+    K  D  ++     + + N   G   F++   L  N   ++++ IFIK  VD
Sbjct:  216 ELSAHLSECVNAPSTCSFKRYGCVFQGTNQ-QIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQ----LSRHDQMLSVHDIRLADMDLRF---------QVLETASYN-----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFK-PDPNSSSFKKPTGEMNIASGCPVFVAQTVL-ENGTYIKDDTIFIKVIVD 560          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 1.170e-100
Identity = 153/166 (92.17%), Postives = 159/166 (95.78%), Query Frame = 1
Query:  334 LNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGL 831
            LNENI VD PMN+KI+KLQVKCKE SCDYVDELRKME+HSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIF HTKLLMDFVVNFNNEMEMLKANNNGLS VNELLRNEINELKLDG+RRR EI +LQRKCA+QAEEIELLNEDIPALRNVDRNVSDRLDGL
Sbjct:   12 LNENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGL 177          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.084e-48
Identity = 135/489 (27.61%), Postives = 245/489 (50.10%), Query Frame = 1
Query:  103 MSGSKLENVGQIMRDYNYESVTE-IQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNE-ICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQ-AEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNY---------GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELI-QSTDRNNGF--GFDQFLSLKELSSNPDLMRNNQIFIKCSV 1524
            M  SKL+NV +++  YN + V E + ND+LC+LC KL+ +A  + C C +C+TCI  YL +N   CPG+  +CK++ L+L  +++ +  ++ +IS++ VKC  + C+Y  EL +++EH   C   SV CP   IGC++  + +D++  HL  ++  HT+L+M F     +E+     N+N     NE  + +I+ LK        E+  +Q+   D+   ++E L   I  LRN D  +      +Q +       + + E++ ++  +      Q+ E  + +L + +G  + K +V   ++  +I  +  N+D    E     N L            +F+W++++++ K     +     +YS+SF +H   +K CL +    +GD  G    ++  +MKGE D  LEWP R +VT ++I Q +   H +   +   Y  NK+   +  D  N +  G D  +    +   P ++ N+ I + C V
Sbjct:    1 MIPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEI-----NHN-----NETTKEDISHLK--------EVLRVQKALNDEKTAQMEFL---IEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDL-EVVGSTDIKNQV--KDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKLCPNVDMDFMWRIEEYSKKRRTVTD-----VYSDSFQSH--NYKFCLNLYI--YGDNLG----LWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVV 452          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A5A9NXF1 (TNF receptor-associated factor OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti007446 PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 6.881e-36
Identity = 136/504 (26.98%), Postives = 221/504 (43.85%), Query Frame = 1
Query:  184 MLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNE--ICPGNTEDCKQE----LLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSV---------------------ACPYSNIGCDKCNI---------SQDKVTDHLQSEIFAHTKLLMDFVVNFNNEM--------EMLKANNNGLSAVNELLRNEINELKLDGERR--REEIAELQRKCADQA--EEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDF--QQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALI--NQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLM-RNNQIFIKCSVDIDS 1536
             LC  C  +L  AR   C  R+C  C++  L  N+  +C    ED   E    +L L++  + D  +N +I  L+V C    C +   L+  E+H   C+Y  +                      CP +   C  C+          + DKV +H       H +LL++ +    + +        E+L     G +  + L+ +E +EL+ DG      ++ + L    A+ A  ++++ L + +  + N+       +  L   +E  Q+ + A+E D    QQI Q      Q E K +E  + +     ++ + +T +   I  L              QN    G F+W+L   T  + +A  G     YS +F T + GFK+C+R+  +G G GKGTH+S+FF +MKGE+DGIL+WPFRH VTF LI  NQR  +    R   C+   +       ++ N   G   F  L +L S      +++ I+IKC VD  S
Sbjct:   38 FLCSNCNNVLNKARQTVCGHRYCLACVNWLLRNNKDLVCTKCKEDQSIESDTSVLTLDQ-FFNDAAINKEILDLKVHCANQGCPWRSTLKNFEDHQSQCEYALIPCNIGCGIMVQRKALATHLERGCPNNKTTCASCSGVLTPRELQGNADKVKEHESCSHVGHLQLLLEVIRGLQSNLSSQERGIPEILDFLQPGTTG-SSLVSHEESELETDGGESGVNDKASSLHDDQAELAVGQQLDTLQQRVQVMENI-------ISALNREVEKTQIGVVALERDNLNNQQIIQ------QLETKVEEQQEWL----TRKDIHITSLQQCISGL--------------QNVSYDGTFLWRLCDVTQSLREAATGHKISQYSPAFYTARYGFKVCMRLYLNGDGVGKGTHISLFFVIMKGEYDGILQWPFRHKVTFFLIDQNQREHVIDAFRPDLCSASFHQP----VSEMNVASGCPLFFPLGKLRSPKHAYCKDDTIYIKCVVDTSS 504          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A226P8K3 (TNF receptor-associated factor OS=Colinus virginianus OX=9014 GN=H355_006777 PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 8.402e-34
Identity = 139/508 (27.36%), Postives = 228/508 (44.88%), Query Frame = 1
Query:  187 LCLLCKKLLVNARCAPCSCRFCFTCISDYL--DKNEICPGNTEDCKQE--------LLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIG----------------------CDKC---------NISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKAN-------NNGLSAVNELLRN----EINELKLDGE---RRREEIAELQRKCADQAEEI--ELLNED-IPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKEL-SSNPDLMRNNQIFIKCSVDID 1533
            LC  C  +L  A    C  R+C  C+S  +  +KN +C    + CK+E         L   E  + D  +N +IS+L+V+C  + C +   ++  EEH   C+Y  + C ++  G                      C KC         + S++K+ +H ++ +  H  LL+ +       M+ LKAN        NG    +EL  N     I+EL + G        E+  L R      E +  +L+ E  I  L N      + +  L   +E + + + A    FQ+Q     +   +  I+  EL  KI ++ +     LT+    + +L  N+   L    A+ +    G F+WK+   + K+ D+  G    +YS +F T K G+K+CLR+  +G G GKGTH+S+FF +MKG++D +L WPFRH VTF L++Q  R  H+    +  D  +        D N   G   FL L +L S     ++ + +F+KC +D +
Sbjct:   40 LCTNCNNVLKKALQTLCGHRYCSACLSWVVRNNKNPVC----QKCKEEDPSTLSEGSLLAEERAFGDAAINKEISELRVRCVTLGCSWCGTMKNFEEHQTLCEYALIPC-HTGCGHVVMRKKLADHLENGCVNNVTVCHKCKQSLSSSEYHGSKEKIKEHEKAAVGTHMLLLLQY-------MKQLKANLCSPSKAANGFIPQSELNVNGAEKSISELHIQGSLGINGNLEVDCLTRTSVPGDESVLQQLVREKLISELENKLHVFENIVAVLNKEVEASNLEITA----FQRQ-----SELDKNIIRGLEL--KIAELHHC----LTQKDAGLSRLHKNL---LFSEQASYD----GVFLWKITDVSRKLQDSVTGRAVSLYSPAFYTAKYGYKVCLRIYLNGDGTGKGTHVSLFFVVMKGDYDALLPWPFRHKVTFMLLDQNNR-EHIIDAFR-PDLASASFQRPVNDMNVASGCPTFLPLTKLQSPKHAYVKEDTLFLKCIIDTN 511          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3P8ZGJ2 (TNF receptor-associated factor OS=Esox lucius OX=8010 PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 2.763e-33
Identity = 124/442 (28.05%), Postives = 201/442 (45.48%), Query Frame = 1
Query:  292 CPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSA--VNELLRNEINELKLD-GERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQLNY----GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            CP  T +CK          Y  +P + K  K           YVD       H + C      C +  +GCD  ++ ++K+ DH ++  + H  LL+ F++     +E L+  N  L+   ++EL R  + EL+L  G+      A +Q  CA       L    +PAL      +   +            A+    +  + ++A+ +  CQ+ E+K            +EL      ME  N+Q      KV++  ++NK+ +L   V   D  ++EM     +++     G FVWK+  FT K  DA  G    ++S +F T K G+KMCLR+  +G G G+GTHLS+FF +M+G  D +L+WPF   VT  L++Q  R  H+    +  D +++      +D N   G   F  L +L S    +R++ IFIK  VD+
Sbjct:  156 CPERTLNCK----------YCKEPFHFKNIK-----------YVD-------HIKFCSKFRAPCRFHVVGCDT-SVEKEKIHDHERACSYEHLNLLLHFIMGIKVSLESLQPQNLELAGHKIHELHR-ALRELELKLGQLTLGVGAPVQGACAPA-----LPTPALPALTTSFTPLPSAMGA----------ALELQLHSEKTKVAELSRRCQELELKVSTFENIVCVLNRELERSCTTMEAYNRQHRLDQDKVEI--LNNKVRQLERTVGLRDLSIVEMEGKMKEMSAATFDGIFVWKISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGAGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFR-PDISSSSFQRPVSDMNIASGCPLFCPLPKLDSKNSYIRDDTIFIKAIVDL 548          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 132.109 bits (331), Expect = 1.415e-32
Identity = 132/498 (26.51%), Postives = 220/498 (44.18%), Query Frame = 1
Query:  154 YESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEI-------CPGNTEDCK--QELLHLNENIYVDQPMNIKISKLQVKCKEMSCD---YVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVN-ELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQLNY----GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            YE+  E Q D + + C            SC+       + L  NE+       CP  T +CK  +E  H  +NI     +  K   +   C +       YVD ++   +    C++  V       GCD  ++ ++K+ DH ++  + H  LL+ F++     +E L+  +  L++   + L   + EL+L   +     A +Q  CA        L      L      V   L+ LQL  E             + ++A+ +  CQ+ E+K            +E+      ME  N+Q      K+++  ++NK+ +L   V   D  ++EM     +++     G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +G G G+GTHLS+FF +M+G  D +L+WPF   VT  L++Q  R  H+    +  D +++      +D N   G   F  L +L S    +R++ IFIK  VD+
Sbjct:  121 YEATHEGQCDFMIIPCP-----------SCK-------ELLRANELERHNERECPERTLNCKYCKEPFHF-KNIKAHDEICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVV-------GCDM-SVEKEKIHDHERACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHKIQELHQSLRELELKMGQLSAG-APVQGACAPPPPPPPTLATSFTPLPT---TVGAALE-LQLHSE-------------KTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEI--LNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFR-PDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 569          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 117.087 bits (292), Expect = 6.686e-28
Identity = 109/380 (28.68%), Postives = 176/380 (46.32%), Query Frame = 1
Query:  400 KEMSCDYVDE---LRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            + ++C Y  E    + ++ H   C    + C     GC K  I ++K  DH++      T      V     +M + K   N +    +LL      + L     + ++AEL R+C    +E+EL    +    N+       +  L   +E +   M A     Q ++ Q      + EI    L +K+ Q+E  + V L ++S  I ++ G    K+ EM+A       G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +G G G+GTHLS+FF +M+G  D +L+WPF   VT  L++Q  R  H+    +  D +++      +D N   G   F  L +L S    +R++ IFIK  VD+
Sbjct:  127 RTLNCKYCKEPFHFKNIKAHDEICPKYPMICE----GCAKKKIPREKYVDHIKLCTKFRTPCRFHVV---GCDMSVSKPQWNLILTPRDLLYTSFT-VPLS----QTKVAELSRRC----QELEL---KVGTFENI-------VCVLNREMERSATTMEAYNR--QHRLDQ-----DKIEI----LNNKVRQLE--RTVGLRDLS--IVEMEG----KMREMSAATYD---GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFR-PDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 456          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 113.235 bits (282), Expect = 2.420e-26
Identity = 62/202 (30.69%), Postives = 111/202 (54.95%), Query Frame = 1
Query:  955 KIGQMENKQKVD---LTEMSNKIDKLSGNVDRKLLEMAANQNQLNY-------GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            ++  +  +Q++D   +  +SNK+ +L   +  + L++A ++  L         G FVWK+  F+ +  DA  G    ++S +F + K G+KMCLR+  +G G G+G+HLS+FF +M+G++D +L+WPF   VT  L++Q  R  H+    +  D ++       ++ N   G   F  L +L+     +R++ IFIK  VD+
Sbjct:  329 RLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNR-EHIIDAFR-PDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 528          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 112.079 bits (279), Expect = 5.840e-26
Identity = 101/377 (26.79%), Postives = 173/377 (45.89%), Query Frame = 1
Query:  427 ELRKMEEHSRTCKYRSVACPYSNIGCD-KCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNE----INELKLDG---ERRREEIAELQRKCADQAEEIEL-LNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKEL-SSNPDLMRNNQIFIKCSVD 1527
            E RK +    + K R   C +S IGC  K N   DKV +H  S   AH  LL++ V N    +           A++  L+N+    + ++ L+G   E    +     +  +   ++ EL + + + AL+   + + + +  L   +E  Q+ +  +E D    +                LI  +  +  +Q+  L     +I  L  ++       +A Q+    G F+W++   + K+ +A  G  +  YS +F T + GFK+C+R+   G G GKGTH+S+FF +MKG++D +L WPF+  VTF LI+Q  R  HV    +  D  +       ++ N   G   F  L +L S     ++++ +FIKC VD
Sbjct:  189 EKRKKDSKQESPK-RKETCVFSEIGCTFKGN--PDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPALDLHLQNQDMTPLPDITLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNM---------------NLIQHLEAVVAEQQQRLIRKDLQISSLQQSI-------SAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQR-EHVVDAFR-PDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVD 538          

HSP 2 Score: 49.6766 bits (117), Expect = 7.002e-6
Identity = 33/115 (28.70%), Postives = 52/115 (45.22%), Query Frame = 1
Query:  184 MLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNE--IC------PGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGC 504
             LC  C  +L  A    C  R+C  C+   L  N+  IC      PG+  D    ++   ++ + D  +N +I +L+V C    C +   L+  E+H   C+Y  + C   NIGC
Sbjct:   27 FLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESD--SSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGC 136          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 110.923 bits (276), Expect = 1.260e-25
Identity = 98/355 (27.61%), Postives = 159/355 (44.79%), Query Frame = 1
Query:  469 RSVACPYSNIGCD-KCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKEL-SSNPDLMRNNQIFIKCSVD 1527
            R   C +S IGC  K N   DKV +H  S   AH  LL++ V N    +           A++  L     EL+ D          L     D   E+E+  + + AL+   + + + +  L   +E  Q+ +  +E D    +                LI  +  +  +Q+  L     +I  L  ++       +A Q+    G F+W++   + K+ +A  G  +  YS +F T + GFK+C+R+   G G GKGTH+S+FF +MKG++D +L WPF+  VTF LI+Q  R  HV    +  D  +       ++ N   G   F  L +L S     ++++ +FIKC VD
Sbjct:  192 RKETCVFSEIGCTFKGN--PDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPERTVQYPALDLTLNG--GELETDSGDTGANDKALSLH--DDQAELEV-GQQLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNM---------------NLIQHLEAVVAEQQQRLIRKDLQISSLQQSI-------SAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQR-EHVVDAFR-PDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVVD 515          

HSP 2 Score: 49.2914 bits (116), Expect = 7.595e-6
Identity = 33/115 (28.70%), Postives = 52/115 (45.22%), Query Frame = 1
Query:  184 MLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNE--IC------PGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGC 504
             LC  C  +L  A    C  R+C  C+   L  N+  IC      PG+  D    ++   ++ + D  +N +I +L+V C    C +   L+  E+H   C+Y  + C   NIGC
Sbjct:   27 FLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESD--SSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGC 136          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 2.146e-26
Identity = 93/372 (25.00%), Postives = 162/372 (43.55%), Query Frame = 1
Query:  436 KMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEM----LKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLD--GLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKL--LEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            ++ +H   C   +  C +  +GC     + + V +H +S + +H  L    V++ N+E+E+    L+ +    + ++E+L   + +L+ D             +     E +   NE + +L    R      D   L+  +   +  +RA+E         C   C   E                Q++ +       D L    +R+L  LE A        G+ VWK+  +  +  +A +G    +YS+ F T   G+KMC R   +G G G+GTHLS+FF +M+GE+D +LEWPFR  VT +L++Q     H+S T    D  +        D N   G   F+S   L  +  L+ ++ +F++  VD
Sbjct:   76 ELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTL----VISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNP-GPCEERCHMHE----------------QRLTMH------DGLLDTAERRLQVLETAGYS-----GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFT-PDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLV-DDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 1.854e-24
Identity = 55/148 (37.16%), Postives = 83/148 (56.08%), Query Frame = 1
Query: 1084 GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            G+ VWK+  +  +  DA +G    +YS+ F T   G++MC R   +G G G+GTHLS+FF +M+GE+D +L WPFR  VT  L++Q      +S T K  D  ++     ++D N   G   F+S   L S    ++++ IFIK  VD
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFK-PDPASSSFRRPTSDMNIASGCPLFVSHVALESA-SYLQDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 85.1149 bits (209), Expect = 8.463e-18
Identity = 115/532 (21.62%), Postives = 219/532 (41.17%), Query Frame = 1
Query:  148 YNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYL---DKNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCN--ISQDKVTDHLQSEIFA------HTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEIN-ELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRL--DGLQL----IIEGNQVAMRAVEN---------------DFQQQIA--------QCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSG------NVDRKL-LEMAANQNQLNYGEFVWKLDKFTDKMAD------AKNGIN----AIIYSESFLTHKNGFKMCLRVD-------PDGFGD------GKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTR-LPHVSRTAKCADYTNNKELIQSTDRN-NGFGFDQFLSLKELSSNPDLMRNNQIFIKCSV 1524
            Y  +    +++   C +C   L      PC  RFC  CI   +   D    CP +       +LH  + ++ D     +I  L V+C    C +  ELR ++EH   C+Y       + + C +C   + +  +  H + E         H    M +  + N+E        N      EL+R ++   L++D ++     A++    +    E +++   + A  +    V  RL  +GL++    + +G Q +  A  +               D Q   A        + A +C Q   + +E+   + +    Q   + E+S K D   G       + R L   +A ++++L  G F W++++F+  +        A +G++    A+++S  F T   G+++CLR+        P G         G+  HL++F  L++G++D  L WPF+  +  ++++Q  R   HV+     AD   +     S  RN  GFG+  F+ +  L      +R++ + ++C V
Sbjct:   51 YEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVDNA-----VLHEGQ-LFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEY-------AQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSKNHEQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQ-----AQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMD-ADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHR-SYLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 3.583e-7
Identity = 30/133 (22.56%), Postives = 60/133 (45.11%), Query Frame = 1
Query:  928 EIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLL----EMAANQNQLNYGEFVWKLDKFTDKMADAKNGIN--AIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPF 1308
            +++  E   + G ++  +   L     +++      +R +L     +A  +N    G F+WK+    +++ +A NG      I S +F T + G+++ LR+         G H+S +  L  G +D  L WP+
Sbjct:  269 DVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLC------RSGEHVSAYAMLGPGPYDATLAWPY 395          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: rnf41l (ring finger protein 41, like [Source:ZFIN;Acc:ZDB-GENE-030131-9441])

HSP 1 Score: 46.2098 bits (108), Expect = 1.368e-6
Identity = 31/113 (27.43%), Postives = 55/113 (48.67%), Query Frame = 1
Query:  163 VTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVACPYSN 495
            V  +++ +LC +C+ +L +   APC   FC  CI  +L  N  CP   ED  ++ L  +E   + + M   ++ L++ C  +   C+ V  L  +  H + C Y    CP++ 
Sbjct:    9 VGRVKDGLLCCVCRDVLEDPLQAPCEHAFCSACIHGWLVHNHTCP---ED--RQPLDASELRPLFRYMRNDLNALRLHCTHRARGCEGVCALETIAIHEQQCPYTPTPCPHTG 116          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 132.494 bits (332), Expect = 3.303e-33
Identity = 135/537 (25.14%), Postives = 229/537 (42.64%), Query Frame = 1
Query:  139 MRDYNYES---VTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTED-----------CKQELLHL-----NENIYVDQPMNIKISKLQ--------VKCKEMSCDYVDELRKMEEHSRTCKYRSVACPY-------------------SNIGCDKC---NISQDKVTDHLQSEIFAHTKLLMDFV---VNFNNEMEMLKAN--NNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNV------DRKLLEMAANQNQL-------------NY-GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            M+D  +++   V  +     C +C   L +    PC  RFC  C+   L     CP + E+           C++E+L L     N  +  +   +++  +          V+C    C      R +E H   C+++   C Y                     + C  C    I +D++  H Q+ I    +L   F     +F    E L+ +  +     VN LL    NE K     R E  A+L +   ++A++ E + E   AL   ++N+      L  +IE +    R    + +++I       Q+ E   +E   ++G +EN+        S     + G +      DR   ++A +  QL             +Y G ++WK+D++T +  +  +G    IYS  F   + G+K C RV P+G G GKG+HLS+FF LM+GEFD +L WPFR  VTF L++Q  R+  +  T +  D T++     +++ N   G   F+S   L +    +R++ +FIK +VD
Sbjct:    1 MQDEGFQTELFVEPLDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSKCPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHH-QTNICEQAELPCSFAKHGCHFKGTREALETHFRDQASVHVNLLLTATQNEEKA----RSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLN-VIERSVAEQRRELAELKERI-----QLQEVEAAIREQDRRLGMIENEASRGAAPSSGP-GSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQ-DRVHDIGDTFR-PDPTSSSFKRPTSNMNIASGCPLFISHTNLQTR-AYVRDDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 123.25 bits (308), Expect = 3.763e-30
Identity = 98/369 (26.56%), Postives = 169/369 (45.80%), Query Frame = 1
Query:  427 ELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLR--NEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            E +K+  H+R C      C +S +GC    + +  + +H    +  H  LL              +   N L   N+L R   E    K + ER + E A+++ +  DQ   + ++ + +   +     +  R D   L+    +V MR       +   +    C  + +K+ E+ D      NK    L+++ + I      + ++ L +   Q     G F+WK+DKFT++ A+AK+G    IYS  F TH+ G+K+C R+ P+G G  +  +LS+F  LM+GE+D IL WPF+ ++T  LI+Q   + ++S T    D  +      + + N   G  +F S   L +    M  N +F+K  VD
Sbjct:  173 ERKKLSAHTRECPNALTDCRFSPLGCTY-KVKKIALREHQNKHVIKHMILL---------GRTTGEPQPNLLELENQLERFDGENTSFKTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLV---GEVRMRDKLKK-FKVKTKANKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGM-NISETFD-PDPCSISFQRPTRNINVASGCPRFCSQTVLRTR-GYMNENCVFVKVVVD 524          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 117.087 bits (292), Expect = 3.476e-28
Identity = 114/481 (23.70%), Postives = 208/481 (43.24%), Query Frame = 1
Query:  166 TEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEI--------FAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEI---KQKELIDKIGQMENKQKVDLTEMSNKIDKL----------SGNVDRKLLEMAANQNQLNYGEF----VWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            T I    LC  C+ ++ +A    C  R+C  CIS  L +    P   + C   +       + D+  + +I +L V C  +   C +  ELR  + H   C++  ++C +   G     +S  K+ +HLQ+E         +    +++  +   ++E        N      EL+R E++      E R E+     R C +  E +E     I  L      +   ++GLQ +     +   A+  D  +++A         E+   +    +D++ +   +  V L E  + I +L          +G  +  + ++    N L    F    +WK+    +K ++A +G     YS  F T  +G+KMC R+  +G G G+  H+S+FF +M+GEFD +L WPFR  VT  L++Q   + HV    +  D +++       + N   G   F S ++L+ +   +R++ +F+K  VD
Sbjct:   16 TAIAAKHLCAKCRLIVKDAVQTACGHRYCSPCISPLLSRG---PIQCDVCGSTIT--KPETFRDKFADREILELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECGK---KLSVAKLPEHLQNECQYREETCSYCEQPVVVARMKE-HHEKTCPSYPVNCPKCSKELIRVEVHSTPFTREPRLEK----GRGCENTLEVLEDHESRIKKLEQRGGGIG--VNGLQSMRISENIDNEAI-GDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQ-DNVEHVIDAFR-PDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQH-AYIRDDTMFLKIIVD 477          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 116.701 bits (291), Expect = 4.785e-28
Identity = 114/466 (24.46%), Postives = 198/466 (42.49%), Query Frame = 1
Query:  190 CLLCKKLLVNARCAPCSCRFCFTCISDYL-DKNEICP-GNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCN-ISQDKVTDHLQSEIFAHTKLLMDFV---VNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNY-----------GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSV 1524
            C +C   L +    PC  RFCF CI   + D    CP  NT   ++EL   N   +  + M   I   ++K KE  C +   L+++EEH + C      CP      ++C  + Q K  D   +E   +  +  D     V  +   E LK    G   ++    NE               A +QRK  D+       N  +P             D  ++     Q +    E+   +   +     Q A ++++  +D +G   ++ +  L  +  K++ +  + DR++ E+     +L             G F+WKLD F      +  G+ A I+S  F T   G+KMCLR++ +G   G G H+S+F  +M+G++DGILEWPF   +T ++++Q     +R P +S T          +   S   + G+G+ +F  + +L+     ++NN I ++  +
Sbjct:   58 CPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCPVDNTPLSERELYRDN---FAKREMMSFIVWCRLK-KERGCTWKGALKELEEHLKGCPCMDTNCP------NECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKVTISKIEEHLK----GCPCMDTNCPNECG-------------AVMQRKEVDKHCAEACPNRSVPC------------DHCKMKSSKEQASHGPQEHTPHEAELRREALFQSANMQRE--VDMLGSRGDEYRQFLAYLERKVEDVKTSSDRRIAELTHKLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRP-ISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTEG-QYIKNNSILVRIQI 480          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 112.079 bits (279), Expect = 1.322e-26
Identity = 115/472 (24.36%), Postives = 196/472 (41.53%), Query Frame = 1
Query:  118 LENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEI--CPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAH----------TKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVEN----DFQQQIAQCATNCQQAEIK-QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQ--STDRNNGFGFDQFLSLKELSS 1476
            + +   +   Y+ E V  +  +  C +C   L       C  RFC  C+ +   +     CP +     +E L L +++++D+     I    VKC    C +  ELR +E H+R C Y  V C  SN  C    + +  V +HL  E              +   +      N + +++  +N   SA  +L R +++E  L     R  + E    C D++            L+    N  D+   L     G Q+    + +    + Q  +  CA      E++ Q  L+D+      +  +++T     + + SG    +L +     N+L    FVW++  F D +  AK G+   + SE F T KNG+K+   + P+G   GK TH+S F  + +GE+DGIL WPF   +   L++Q+  +       K      + E      T  NNG G   F+S ++L +
Sbjct:    1 MADPSPVPSGYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMD-----REPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTC--SNPMCSA-QLPRMDVDEHLLVECDWRLIVCEYCGDESPYCLQKAHARNCDYKLVTCSNPMCSA--QLPRMDVDEHLLVECDWRLIVCEY---CGDESPY---------CLQKDHSNQCDKFPVLCPNDCGTQITREKLRDHQSEECQFAVVPCAFRDFGCEVEIQNRLMDQHLDTNIQSHLNMTCNQLLLSRDSGAQFHELQQGLGRVNELLKMRFVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFVSINRGEYDGILAWPFTRVIKITLLDQKENVLQRRNVEKTIIPNPSLENFHRPKTVSNNGRGSATFVSHEKLWT 450          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 131.724 bits (330), Expect = 2.267e-32
Identity = 112/405 (27.65%), Postives = 185/405 (45.68%), Query Frame = 1
Query:  418 YVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERR-----REEIAELQRKCADQ-AEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIK-----------QKELIDKIGQME--NKQ------KVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQLNY----GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDIDS 1536
            YVD ++   +    C++  V       GCD  ++ ++K+ DH +   + H  LL+ F++     +E L+     L   ++ L +E+++   D E R     R   A LQ  CA   A     L+  + A              L+L ++  +            ++A+ +  CQ+ E+K            +EL      ME  N+Q      K+++  +SNK+ +L   V   D  ++EM      ++     G F+WK+  FT K  DA  G    ++S +F T K G+KMCLR+  +G G G+GTHLS+FF +M+G  D +L+WPF   VT  L++Q  R  H+    +  D +++      +D N   G   F  L +L S    +R+  IFIK  VD+  
Sbjct:  203 YVDHIKFCSKFKAPCRFHVV-------GCDT-SVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQR--LEVASQKL-HELHQSLRDLELRMSQLGRSGTAPLQGVCAATLATSFTPLHSAMGA-------------ALELQLQSEKT-----------KVAELSRRCQELELKVSTFENIVCILNRELERSCATMEAYNRQHRLDQDKIEI--LSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR-EHIIDAFR-PDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVDLSG 568          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 123.635 bits (309), Expect = 4.075e-30
Identity = 110/450 (24.44%), Postives = 192/450 (42.67%), Query Frame = 1
Query:  190 CLLCKKLLVNARCAPCSCRFCFTCISDYLD-KNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMS--CDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLD-GERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVD 1527
            C  C+ +L   R   C  RFC++CI+D L   N +CP + E          + I+ D   + +I  L+V C+  +  C     L+++ +H   C +  V CP   +G  K  + + ++ +HL  +   + +   +F  N     E+ K       A      N      L   E+      E   +   +   +  L +++ +LR     V  RL  L+   +G + ++                         +  +++   M +  ++ L +M  +          ++LE A+       G  +WK+  +  +  DA  G    +YS+ F T   G+KMC RV  +G G GKGTHLS+FF +M+GE+D +L WPF+  VT  L++Q     H+    K  D +++       + N   G   F+S   L S    ++++ IFIK +VD
Sbjct:   48 CEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPL------FKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCP---LGKCKERMMRKEIPEHLAWKC-KYRESTCEFCKNKMPLTELQKHKETVCPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALE---QGGRASL-------------------------ETQLNRHDDMLSVHEIRLADMDLRF---------QVLETASYN-----GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFK-PDPSSSSFRRPVAEMNIASGCPLFVSQSVLESG-TYIKDDTIFIKVTVD 443          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 122.094 bits (305), Expect = 1.460e-29
Identity = 114/511 (22.31%), Postives = 221/511 (43.25%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVA---------------------CPYSNIGCDKCN--ISQDKVTDH----LQSEIFAHTKL---LMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRTAKCADYTNNKELIQSTDRNN------GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            M  ++Y+ + + +    C LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D  +  +I  L ++C   E  C +  ++++++ H  TC +  +                      CP   + C+ C    + +   +H     Q  ++   K    +M  +++ +   E  K          E + + I   +    R          +C +Q     +  ED+        +V D          G+ + +   ++      A C   C +  I +         +E+  K  LT M N + +    +    R++ E++ + +    G  +WKL+ ++ K+ +AK   N   +S  F TH+ G+K+ +    +G G G+G+HLSV+  ++ GE+D +LEWPF + VTF++++Q     ++  H++ T        N +   ST RN+      GFG+ +F+S +E+    + +R+N IFIK S++I
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPR-------FPVQCPNQCGTPNIAREDL------ANHVKDNC--------GSALVLCPFKD------AGCKHRCPKLAIGR--------HLEDTTKSHLTMMCNLVSRQRQEILELRREMEELSVSHD----GVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCST-RNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASIEI 464          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 122.094 bits (305), Expect = 2.182e-29
Identity = 117/528 (22.16%), Postives = 227/528 (42.99%), Query Frame = 1
Query:  139 MRDYNYESVTEIQNDMLCLLCKKLLVNA-RCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLN-ENIYVDQPMNIKISKLQVKC--KEMSCDYVDELRKMEEHSRTCKYRSVA---------------------CPYSNIGCDKCN--ISQDKVTDH----LQSEIFAHTKL---LMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNV---DRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQR----TRLPHVSRTAKCADYTNNKELIQSTDRNN------GFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDIDS*LNYIFIVINKFAHL 1581
            M  ++Y+ + + +    C LC K +    + + C  RFC TC+ ++L +          C ++ L L+   IY D  +  +I  L ++C   E  C +  ++++++ H  TC +  +                      CP   + C+ C    + +   +H     Q  ++   K    +M  +++ +   E  K          E + + I   +    R          +C +Q     +  ED+        +V D          G+ + +   ++      A C   C +  I +         +E+  K  LT M N + +    +    R++ E++ + +    G  +WKL+ ++ K+ +AK   N   +S  F TH+ G+K+ +    +G G G+G+HLSV+  ++ GE+D +LEWPF + VTF++++Q     ++  H++ T        N +   ST RN+      GFG+ +F+S +E+    + +R+N IFIK S++I      I +++  F  L
Sbjct:    1 MPGFDYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVF------KCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPR-------FPVQCPNQCGTPNIAREDL------ANHVKDNC--------GSALVLCPFKD------AGCKHRCPKLAIGR--------HLEDTTKSHLTMMCNLVSRQRQEILELRREMEELSVSHD----GVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCST-RNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASIEIP---QKIMVILKCFIKL 478          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 120.168 bits (300), Expect = 2.057e-28
Identity = 114/455 (25.05%), Postives = 192/455 (42.20%), Query Frame = 1
Query:  292 CPGNTEDCK--QELLHLNENIYVDQPMNIKISKLQVKCKEMSCD---YVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDR-------------NVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIK-------------QKELIDKIGQMENKQ-KVD---LTEMSNKIDKLSGNVDRKLLEMAANQNQLNY-------GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDI 1530
            CP  T +CK  +E  H  +NI     +  K   +   C +       YVD       H + C      C +  +GCD  ++ ++K+ DH ++  + H  LL+ +++     ME L+    GL      L  E+ +   D E R  +++        Q       +                        +VS     L   +     A+    +  + ++A+    C + E+K             + E      +  N+Q K+D   +  +SNK+ +L   V  K L +A  + +L         G F+W++  F  K  DA  G    ++S +F T K G+KMCLR+  +G G G+GTHLS+FF +M+G  D +L+WPF   VT  L++Q  R  H+    +  D T++      ++ N   G   F  L +L +    +R++ IFIK  VD+
Sbjct:  156 CPERTLNCKYCKEPFHF-KNIKAHDEICPKYPMICEGCAKKKIPREKYVD-------HIKFCSKFRTPCRFHVVGCDM-SVEKEKIHDHERAFAYEHLNLLLHYIMGMKVSMEGLQPQ--GLETAGHKL-VELQKSLRDLEARVSQLSTTSSGPPVQGAAASSSSSSSGPPGPPASVPLPPPPTLPPTLSVSTSFTPLPSSV---GAALELQLHSEKTKVAELGRRCTELEVKSGTFENVVCVLNREVERFTTTMEASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTVAEMEGRLREMAATTFDGVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNR-EHIIDAFR-PDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIVDL 593          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025980.1 (SMESG000025980.1)

HSP 1 Score: 858.596 bits (2217), Expect = 0.000e+0
Identity = 432/479 (90.19%), Postives = 450/479 (93.95%), Query Frame = 1
Query:  103 MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLD-KNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDIDS 1536
            MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISD+LD K + CPGNTE+CKQE+LHLNENI VD PMN+KI+KLQVKCKEMSCDYVDELRKME+HSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIF HTKLLMDFVVNFNNEME+LKANNNGLS VNELLRNEINELKLDG+RRR EI +LQRKCA+QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQ   GEF+WKLDKFTDKMADAK GINA IYSESFLTHKNGFKMCL V PDG G GKG HLSVFF LMKGEFDGILEWPFRHSVTFALINQRTRLPHVS+  +CA+Y NNKE IQ TDRN G GF +F+S +ELSSNPDLMRNNQIFIKCSVDIDS
Sbjct:    1 MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDFLDHKKKNCPGNTEECKQEMLHLNENICVDYPMNMKIAKLQVKCKEMSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKKGINAFIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKITECANYPNNKEFIQPTDRNAGRGFARFVSHEELSSNPDLMRNNQIFIKCSVDIDS 479          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 412/479 (86.01%), Postives = 426/479 (88.94%), Query Frame = 1
Query:  103 MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLD-KNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDIDS 1536
            MSGSKLENV QIMRDYNYESVTEIQNDMLC LCKKLLVNARCAPC CRFCFTCISD+LD K +ICPG+TE+CKQE+LHLNENI VD PMNIKISKLQVKCKEMSC YVDELRKME+HSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRR EIA+LQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN                            QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQ   GEF+WKLDKFTDKMADAKNGIN  IYSESFLTHKNGFKMCLRVDPDG G GKGTHLSVFF LMKGEFDGILEWPFRHSVTFALINQRTRLPHVS+T KCA+Y N+K LIQ TDRN G GF +F+S +ELSSNPDLMRNNQIFIKCSVDIDS
Sbjct:    1 MSGSKLENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRVEIADLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN----------------------------QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPNDKALIQPTDRNAGLGFPKFVSHEELSSNPDLMRNNQIFIKCSVDIDS 451          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025934.1 (SMESG000025934.1)

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 389/404 (96.29%), Postives = 393/404 (97.28%), Query Frame = 1
Query:  103 MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRH 1314
            MSGSKLENV QIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQE+L+LNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSR CKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNF+NEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQ KCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDK SGNVDRKLLEMAANQNQ   GEF+WKLDKFTDKMADAK GINAIIYSESFLTHKNGFKMCLRVDPDG G GKGTHLSVFFCLMKGEFDGILEWPF H
Sbjct:    1 MSGSKLENVWQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQEVLYLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRACKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFHNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQMKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKSSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 404          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025901.1 (SMESG000025901.1)

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 417/513 (81.29%), Postives = 425/513 (82.85%), Query Frame = 1
Query:  103 MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAE-----------------------------------LQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDIDS 1536
            MS SKLENV QIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQE+LHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRS AC YSNIGCDKCNISQDKV DHLQSEIF HTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAE                                   LQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN                            QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQ   GEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCL V PDG G GKGTHLSV+F LMKGEFDGILEWPFRHSVT ALINQRTRLPHVS T K A+ +N+K LIQ TDRN G GF +F+S +ELSSNPDLMRNNQIFIKCSVDIDS
Sbjct:    1 MSCSKLENVWQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLDKNEICPGNTEDCKQEVLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSEACLYSNIGCDKCNISQDKVEDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELRVNIICLNGENAAMRENMDKLISAGERNQVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN----------------------------QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLSVYPDGVGVGKGTHLSVYFHLMKGEFDGILEWPFRHSVTLALINQRTRLPHVSETTKYANDSNSKTLIQPTDRNAGLGFPKFVSHEELSSNPDLMRNNQIFIKCSVDIDS 485          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025998.1 (SMESG000025998.1)

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 406/479 (84.76%), Postives = 425/479 (88.73%), Query Frame = 1
Query:  103 MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDYLD-KNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCKEMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINAIIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQFLSLKELSSNPDLMRNNQIFIKCSVDIDS 1536
            MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISD+LD K + CPGNTE+CKQE+LHLNENI VD PMN+KI+KLQVKCKE SCDYVDELRKME+HS+TCKYRSVACPYSNIGC+KCNISQDKV DHL SEI AHTKLLMDFVVNF+NEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQ+KCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN                            QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQ   GEFVWKLDKFTDKMADAKNG NAIIYSESFLTHKNG+KMCL VDPDG G GKGTHLSVFFCLMKGEFDGILEWPF HSVTFALINQRTRLPHVS TAK +DY NNK  IQ TDRN G+G+ +F+S +ELSSNPDLMRNN+IFIKCSVDIDS
Sbjct:    1 MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFCFTCISDFLDHKKKNCPGNTEECKQEMLHLNENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSQTCKYRSVACPYSNIGCNKCNISQDKVADHLLSEILAHTKLLMDFVVNFHNEMEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQKKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN----------------------------QKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFVWKLDKFTDKMADAKNGTNAIIYSESFLTHKNGYKMCLLVDPDGNGGGKGTHLSVFFCLMKGEFDGILEWPFGHSVTFALINQRTRLPHVSGTAKRSDYINNKAFIQPTDRNAGWGYAKFVSHEELSSNPDLMRNNEIFIKCSVDIDS 451          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF42.750e-2921.65TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF37.848e-2723.48TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF37.848e-2723.48TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF36.065e-2625.61TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF36.065e-2625.61TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-13.838e-1830.64TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-27.025e-1735.34TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf42.397e-1930.18gene:FBgn0026319 transcript:FBtr0334401[more]
Traf43.498e-1930.18gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like8.961e-721.62gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like8.961e-721.62gene:FBgn0030748 transcript:FBtr0074274[more]
Traf-like8.961e-721.62gene:FBgn0030748 transcript:FBtr0334036[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a3.903e-3326.46Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf4a1.773e-3123.55tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a1.773e-3123.55tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
BX901915.11.979e-2932.23pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.11.979e-2932.23pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh25.580e-3025.24slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
sytl24.720e-2820.83synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
hspb69.488e-2739.16heat shock protein family B (small) member 6 [Sour... [more]
ssh21.521e-2624.09slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a12.541e-2322.99solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf41.108e-3022.55TNF receptor associated factor 4 [Source:MGI Symbo... [more]
Traf21.150e-2924.75TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf25.502e-2924.75TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf31.661e-2824.47TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.661e-2824.47TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61382|TRAF4_MOUSE7.748e-3022.55TNF receptor-associated factor 4 OS=Mus musculus O... [more]
sp|P39429|TRAF2_MOUSE8.041e-2924.75TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q9BUZ4|TRAF4_HUMAN1.321e-2821.65TNF receptor-associated factor 4 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE1.732e-2623.61TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q60803|TRAF3_MOUSE2.768e-2525.61TNF receptor-associated factor 3 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWW31.170e-10092.17TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
T1E1012.084e-4827.61TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A5A9NXF16.881e-3626.98TNF receptor-associated factor OS=Triplophysa tibe... [more]
A0A226P8K38.402e-3427.36TNF receptor-associated factor OS=Colinus virginia... [more]
A0A3P8ZGJ22.763e-3328.05TNF receptor-associated factor OS=Esox lucius OX=8... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a1.415e-3226.51TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a6.686e-2828.68TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2b2.420e-2630.69TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf15.840e-2626.79TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf11.260e-2527.61TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002130.12.146e-2625.00pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.11.854e-2437.16pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf68.463e-1821.62TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.13.583e-722.56pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
rnf41l1.368e-627.43ring finger protein 41, like [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494643.303e-3325.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352373.763e-3026.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388733.476e-2823.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487734.785e-2824.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412431.322e-2624.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.22.267e-3227.65TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf34.075e-3024.44TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a1.460e-2922.31TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a2.182e-2922.16TNF receptor associated factor 4 [Source:NCBI gene... [more]
unm_sa8082.057e-2825.05TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025980.10.000e+090.19SMESG000025980.1[more]
SMESG000025794.10.000e+086.01SMESG000025794.1[more]
SMESG000025934.10.000e+096.29SMESG000025934.1[more]
SMESG000025901.10.000e+081.29SMESG000025901.1[more]
SMESG000025998.10.000e+084.76SMESG000025998.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017619 ID=SMED30017619|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1590bp
ATTTTGACTTATTTAATATTAGCTCAGAACTAAATATTTATATTTTTGTT
AAATAAGGATCTTATATATTAATACTTTTTATTTATTAAATTTATATGAT
AAATGTCTGGTTCAAAATTAGAAAATGTTGGGCAGATTATGAGAGATTAT
AATTATGAAAGTGTAACAGAAATCCAGAATGACATGTTATGCTTGTTATG
TAAAAAGTTATTGGTAAATGCTCGCTGTGCTCCTTGTAGCTGCAGGTTTT
GTTTCACTTGTATTTCAGATTATCTTGATAAGAATGAAATTTGTCCCGGT
AACACAGAAGACTGCAAACAGGAACTGCTTCATTTGAACGAAAATATTTA
TGTGGATCAGCCAATGAATATCAAAATCTCAAAGTTACAAGTGAAATGCA
AGGAAATGTCTTGTGATTATGTTGATGAGTTAAGAAAAATGGAAGAACAT
TCACGGACATGCAAATATCGGTCAGTAGCATGTCCATATTCCAATATCGG
ATGTGACAAATGCAATATATCCCAGGATAAAGTTACGGATCATTTGCAAT
CTGAAATATTTGCGCACACAAAATTATTGATGGATTTCGTGGTCAATTTC
AATAATGAAATGGAGATGTTGAAGGCCAATAATAACGGATTGAGCGCAGT
GAATGAATTATTGCGAAATGAAATCAACGAATTGAAATTGGATGGCGAGA
GGAGACGAGAGGAAATTGCTGAATTGCAGAGGAAATGTGCCGATCAAGCT
GAGGAAATCGAATTACTGAATGAAGACATTCCGGCATTGAGGAATGTAGA
TAGAAATGTGAGCGATAGATTGGATGGATTGCAATTGATTATCGAGGGCA
ACCAGGTGGCCATGCGAGCAGTTGAGAACGATTTCCAGCAACAAATTGCC
CAATGCGCCACCAATTGCCAGCAAGCAGAAATTAAACAAAAAGAATTAAT
TGATAAAATCGGTCAAATGGAAAATAAACAAAAAGTAGATCTGACGGAAA
TGTCGAATAAAATTGATAAATTAAGTGGAAATGTCGACAGGAAATTATTG
GAAATGGCAGCCAATCAAAATCAGCTGAATTATGGAGAATTTGTGTGGAA
GCTCGACAAATTCACTGACAAAATGGCAGACGCAAAAAATGGAATCAACG
CAATCATTTATAGCGAATCATTTCTCACGCATAAAAATGGTTTCAAAATG
TGTTTGCGTGTGGATCCTGATGGATTTGGTGATGGCAAGGGCACTCATTT
GTCTGTGTTCTTTTGTTTGATGAAGGGCGAGTTTGATGGCATTTTGGAAT
GGCCATTCAGGCATTCAGTCACATTTGCATTGATCAATCAGCGCACCCGA
CTGCCTCATGTCAGTAGGACTGCGAAATGTGCAGATTATACAAATAATAA
AGAATTAATCCAGTCAACAGATAGAAATAATGGATTTGGATTTGACCAAT
TTTTAAGCCTGAAAGAATTATCGAGCAATCCAGATCTGATGCGTAACAAT
CAGATATTTATTAAATGCTCCGTTGACATTGACTCGTGATTGAATTATAT
TTTTATTGTTATCAATAAATTTGCTCATTTAAAAAAAGAT
back to top

protein sequence of SMED30017619-orf-1

>SMED30017619-orf-1 ID=SMED30017619-orf-1|Name=SMED30017619-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=479bp
MSGSKLENVGQIMRDYNYESVTEIQNDMLCLLCKKLLVNARCAPCSCRFC
FTCISDYLDKNEICPGNTEDCKQELLHLNENIYVDQPMNIKISKLQVKCK
EMSCDYVDELRKMEEHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQS
EIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGER
RREEIAELQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGN
QVAMRAVENDFQQQIAQCATNCQQAEIKQKELIDKIGQMENKQKVDLTEM
SNKIDKLSGNVDRKLLEMAANQNQLNYGEFVWKLDKFTDKMADAKNGINA
IIYSESFLTHKNGFKMCLRVDPDGFGDGKGTHLSVFFCLMKGEFDGILEW
PFRHSVTFALINQRTRLPHVSRTAKCADYTNNKELIQSTDRNNGFGFDQF
LSLKELSSNPDLMRNNQIFIKCSVDIDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR012227TNF_rcpt-assoc_TRAF_met
IPR043211TNF_rcpt-assoc_TRAF
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
IPR013323SIAH-type
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 206..226
NoneNo IPR availableCOILSCoilCoilcoord: 171..198
NoneNo IPR availableCOILSCoilCoilcoord: 273..293
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 22..477
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 1.18966E-5
score: 40.1433
NoneNo IPR availableCDDcd00270MATH_TRAF_Ccoord: 329..476
e-value: 9.78406E-51
score: 167.399
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 23..80
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 333..457
e-value: 4.0E-11
score: 53.0
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 328..475
score: 20.289
IPR012227TNF receptor-associated factor TRAF, metazoaPIRSFPIRSF015614TRAFcoord: 3..130
e-value: 1.6E-11
score: 41.2
coord: 109..479
e-value: 1.1E-61
score: 206.7
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 260..478
e-value: 7.4E-52
score: 177.7
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 95..151
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 328..477
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 4..95
e-value: 3.3E-6
score: 28.6
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 96..149
e-value: 5.2E-6
score: 28.6
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 22..477
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 30..69
score: 9.022