Rho GTPase activating protein 24

Overview
NameRho GTPase activating protein 24
Smed IDSMED30017618
Length (bp)1629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho GTPase activating protein 24 (SMED30017618) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho GTPase activating protein 24 (SMED30017618) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho GTPase activating protein 24 (SMED30017618) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho GTPase activating protein 24 (SMED30017618) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017618

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017618h1SMcG0013986 PL08008A2B03smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
cephalic gangliaSMED30017618h1SMcG0013986 dd_Smed_v4_6320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017618h1SMcG0013986 dd_Smed_v4_6320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017618h1SMcG0013986 dd_Smed_v4_6320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30017618h1SMcG0013986 dd_Smed_v4_6320_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho GTPase activating protein 24 vs. Ensembl Human
Match: ARHGAP24 (Rho GTPase activating protein 24 [Source:HGNC Symbol;Acc:HGNC:25361])

HSP 1 Score: 205.297 bits (521), Expect = 3.245e-57
Identity = 118/329 (35.87%), Postives = 190/329 (57.75%), Query Frame = 3
Query:   93 PQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKAN-SEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            PQ     ++ I C WL+KQGG  KT   R+FVL  + LYYF ++ ++   G I L   ++SE   ++ N  +F F ++P   ++ +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IP++ Y+   +    +   E   +  + ++++ LPV N+ LLKY+C FL EV S+S  N+M + +LA +F PNILR +  DP        V+   ++  I  HD LF  + E  SK
Sbjct:   11 PQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSK 338          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Human
Match: ARHGAP22 (Rho GTPase activating protein 22 [Source:HGNC Symbol;Acc:HGNC:30320])

HSP 1 Score: 169.859 bits (429), Expect = 8.810e-45
Identity = 107/316 (33.86%), Postives = 169/316 (53.48%), Query Frame = 3
Query:  120 IIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXX---XXXDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRI----IHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANEN---LDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            ++   WLKKQ    K  ++R+FVL  + L+Y+ ++ +   +G ISL+  +++E     ED     F  S      +E +  N     L  + + + + W+  +++ ++   GGG+FG  L   + H   E  Y PR+    + +C  +IRE GL EEG+FR  GQ +LV  +++  D           DVHTV SLLKLYLRELPEP++PF+ Y+   +    +  +E    L+L K+ +  LP  N+ LL+Y+C FL EV ++S  N+M + +LA +F PNILR Q  DP       S++   +   I+ H  LF
Sbjct:   38 VLKAGWLKKQRSIMKNWQQRWFVLRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANPEALLLMASSQRDMEDWVQAIRRVIWAPLGGGIFGQRLEETVHH---ERKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQ-VSNLPQANYNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRKHSQLF 349          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Human
Match: ARHGAP22 (Rho GTPase activating protein 22 [Source:HGNC Symbol;Acc:HGNC:30320])

HSP 1 Score: 169.474 bits (428), Expect = 1.013e-44
Identity = 107/316 (33.86%), Postives = 169/316 (53.48%), Query Frame = 3
Query:  120 IIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXX---XXXDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRI----IHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANEN---LDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            ++   WLKKQ    K  ++R+FVL  + L+Y+ ++ +   +G ISL+  +++E     ED     F  S      +E +  N     L  + + + + W+  +++ ++   GGG+FG  L   + H   E  Y PR+    + +C  +IRE GL EEG+FR  GQ +LV  +++  D           DVHTV SLLKLYLRELPEP++PF+ Y+   +    +  +E    L+L K+ +  LP  N+ LL+Y+C FL EV ++S  N+M + +LA +F PNILR Q  DP       S++   +   I+ H  LF
Sbjct:   44 VLKAGWLKKQRSIMKNWQQRWFVLRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANPEALLLMASSQRDMEDWVQAIRRVIWAPLGGGIFGQRLEETVHH---ERKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQ-VSNLPQANYNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRKHSQLF 355          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Human
Match: ARHGAP24 (Rho GTPase activating protein 24 [Source:HGNC Symbol;Acc:HGNC:25361])

HSP 1 Score: 163.696 bits (413), Expect = 5.604e-43
Identity = 89/247 (36.03%), Postives = 145/247 (58.70%), Query Frame = 3
Query:  336 KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            ++ +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IP++ Y+   +    +   E   +  + ++++ LPV N+ LLKY+C FL EV S+S  N+M + +LA +F PNILR +  DP        V+   ++  I  HD LF  + E  SK
Sbjct:    8 RDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSK 253          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Human
Match: ARHGAP24 (Rho GTPase activating protein 24 [Source:HGNC Symbol;Acc:HGNC:25361])

HSP 1 Score: 163.31 bits (412), Expect = 9.478e-43
Identity = 89/244 (36.48%), Postives = 143/244 (58.61%), Query Frame = 3
Query:  345 INENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IP++ Y+   +    +   E   +  + ++++ LPV N+ LLKY+C FL EV S+S  N+M + +LA +F PNILR +  DP        V+   ++  I  HD LF  + E  SK
Sbjct:    1 MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSK 243          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 91.2781 bits (225), Expect = 6.144e-20
Identity = 57/167 (34.13%), Postives = 86/167 (51.50%), Query Frame = 3
Query:  453 LFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASH-SENRMEISSLAKIFSPNILRDQD 944
            +FG+ L  +  H   E + VP+ I    + I   GL+ +GI+R +G LS V ++R   D+ NY+      D+H +   LKL+ REL +PL P S +    +     +A       +E L  LP  N + LK L   L  VASH S+NRM+  +LA +F P +  + D
Sbjct:   91 VFGSTLSAICQH---ENSLVPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRFKKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLFHNGD 254          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 91.6633 bits (226), Expect = 4.199e-19
Identity = 57/167 (34.13%), Postives = 86/167 (51.50%), Query Frame = 3
Query:  453 LFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASH-SENRMEISSLAKIFSPNILRDQD 944
            +FG+ L  +  H   E + VP+ I    + I   GL+ +GI+R +G LS V ++R   D+ NY+      D+H +   LKL+ REL +PL P S +    +     +A       +E L  LP  N + LK L   L  VASH S+NRM+  +LA +F P +  + D
Sbjct:  610 VFGSTLSAICQH---ENSLVPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRFKKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLFHNGD 773          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 91.2781 bits (225), Expect = 4.658e-19
Identity = 57/167 (34.13%), Postives = 86/167 (51.50%), Query Frame = 3
Query:  453 LFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASH-SENRMEISSLAKIFSPNILRDQD 944
            +FG+ L  +  H   E + VP+ I    + I   GL+ +GI+R +G LS V ++R   D+ NY+      D+H +   LKL+ REL +PL P S +    +     +A       +E L  LP  N + LK L   L  VASH S+NRM+  +LA +F P +  + D
Sbjct:  608 VFGSTLSAICQH---ENSLVPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRFKKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLFHNGD 771          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Celegans
Match: pac-1 (GTPase-activating protein pac-1 [Source:UniProtKB/Swiss-Prot;Acc:P34288])

HSP 1 Score: 87.4261 bits (215), Expect = 7.008e-18
Identity = 58/165 (35.15%), Postives = 89/165 (53.94%), Query Frame = 3
Query:  504 NYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMREL--------VDRANYEWDNP---DVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANE------NLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQD 944
            ++VP I+  C   I  YG+   GI+R  G  + V  ++E         VD +  E  +P   DV+ V SLLK++LR+LPEPL+      + K   + IDAN        L  ++  LR LP P++  L++L   L+E+  HS+ N+ME  +LA +F P+I+R  D
Sbjct:  121 DHVPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWRDVNVVSSLLKMFLRKLPEPLL------TDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTLRFLIVHLSEITKHSDVNKMECRNLALMFGPSIVRPSD 279          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Celegans
Match: rga-8 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:A0A2K5AU32])

HSP 1 Score: 87.4261 bits (215), Expect = 7.218e-18
Identity = 54/167 (32.34%), Postives = 86/167 (51.50%), Query Frame = 3
Query:  453 LFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWD----NPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKA---VGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEV-ASHSENRMEISSLAKIFSPNI 929
            +FG PL     HL  +   +  ++ +CC ++R+ G+ E GIFR +G  S + ++R  +D   ++ D    N D H V S LK YLRELP+PL      DSL++       ++  E    +   L+ +   + Q L YL  FL ++ A   E  M  S+LA +F+P +
Sbjct:  289 VFGVPLD---EHLSIQKERISGVLTKCCDFLRQNGMNERGIFRVSGNASKIKRIRAALDAGQFDADEKHYNNDPHAVASTLKAYLRELPDPL----TMDSLQSDWVEAINLEGEERFSAIDRCLKKMTRGHRQNLIYLMKFLCDLEAKREETSMNASNLAIVFAPTM 448          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0300967)

HSP 1 Score: 93.2041 bits (230), Expect = 2.116e-19
Identity = 57/158 (36.08%), Postives = 91/158 (57.59%), Query Frame = 3
Query:  486 HLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY-EWDNP----DVHTVCSLLKLYLRELPEPLIPFSNYDS-LKAVGYRID-ANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVAS-HSENRMEISSLAKIFSPNILR 935
            HL      +P ++  C ++I  YG+ + GI+R +G  S + ++R   D     +  NP    D+H V SLLK+Y RELP PL  +  YD+ ++A+  + D A+E L L+KE +  LP P+++ LKYL   L +V+  H    M   +LA +++PN+LR
Sbjct:  429 HLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLR 585          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0300966)

HSP 1 Score: 93.2041 bits (230), Expect = 2.116e-19
Identity = 57/158 (36.08%), Postives = 91/158 (57.59%), Query Frame = 3
Query:  486 HLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY-EWDNP----DVHTVCSLLKLYLRELPEPLIPFSNYDS-LKAVGYRID-ANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVAS-HSENRMEISSLAKIFSPNILR 935
            HL      +P ++  C ++I  YG+ + GI+R +G  S + ++R   D     +  NP    D+H V SLLK+Y RELP PL  +  YD+ ++A+  + D A+E L L+KE +  LP P+++ LKYL   L +V+  H    M   +LA +++PN+LR
Sbjct:  429 HLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLR 585          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0332179)

HSP 1 Score: 93.2041 bits (230), Expect = 2.154e-19
Identity = 57/158 (36.08%), Postives = 91/158 (57.59%), Query Frame = 3
Query:  486 HLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY-EWDNP----DVHTVCSLLKLYLRELPEPLIPFSNYDS-LKAVGYRID-ANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVAS-HSENRMEISSLAKIFSPNILR 935
            HL      +P ++  C ++I  YG+ + GI+R +G  S + ++R   D     +  NP    D+H V SLLK+Y RELP PL  +  YD+ ++A+  + D A+E L L+KE +  LP P+++ LKYL   L +V+  H    M   +LA +++PN+LR
Sbjct:  429 HLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLR 585          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0081318)

HSP 1 Score: 93.2041 bits (230), Expect = 2.154e-19
Identity = 57/158 (36.08%), Postives = 91/158 (57.59%), Query Frame = 3
Query:  486 HLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY-EWDNP----DVHTVCSLLKLYLRELPEPLIPFSNYDS-LKAVGYRID-ANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVAS-HSENRMEISSLAKIFSPNILR 935
            HL      +P ++  C ++I  YG+ + GI+R +G  S + ++R   D     +  NP    D+H V SLLK+Y RELP PL  +  YD+ ++A+  + D A+E L L+KE +  LP P+++ LKYL   L +V+  H    M   +LA +++PN+LR
Sbjct:  429 HLLNSGQDIPMVLRSCAEFIENYGVID-GIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLR 585          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Fly
Match: RhoGAP5A (gene:FBgn0029778 transcript:FBtr0070785)

HSP 1 Score: 91.2781 bits (225), Expect = 2.841e-19
Identity = 56/172 (32.56%), Postives = 90/172 (52.33%), Query Frame = 3
Query:  435 LDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNPD-----VHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASH-SENRMEISSLAKIFSPNIL 932
            L R  G+FGT L  ++    E ++ +P ++  C + +   G+ +EGI+R +G    +  ++  +DR   + D  +     V+ +   LKLYLR LP PLI F  Y S  A G      E   L+ E +R LP  +H  L+Y+   L  VASH + N+M   +LA +F+P ++
Sbjct:  295 LKRIRGVFGTDLTTMV--QLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLI 464          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Zebrafish
Match: arhgap24 (Rho GTPase activating protein 24 [Source:ZFIN;Acc:ZDB-GENE-091118-20])

HSP 1 Score: 206.453 bits (524), Expect = 9.928e-58
Identity = 113/317 (35.65%), Postives = 183/317 (57.73%), Query Frame = 3
Query:  117 DIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXD-KANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRI--DANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYE 1043
            +++ C WL+KQGG  KT   R+FVL  + LYY+ ++ ++   G I L    ++E   + +   +F F ++P   +E +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + +   N   P ++ +C  +IR +GL+EEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IPFS Y+   A    +  D    +  ++ ++  LPV N+ LLKY+C FL EV S+S  N+M + +LA +F PNILR +  DP        ++   +A  I  HD LF  E E
Sbjct:   22 EVLRCGWLRKQGGFVKTWHTRWFVLRGDQLYYYKDEDETKALGTIFLPGNRVTEHPSNGEEGGKFLFEVIPGGDRERMTSNHETYLLMASTQNDMEDWVKSIRRVIWAPFGGGIFGQKLEETVRYERRYGNKMAPMLVEQCVDFIRNWGLREEGLFRLPGQANLVKELQDAFDCGEKPSFDC-NTDVHTVASLLKLYLRELPEPVIPFSKYEEFLACTKLLSKDQEAGMKELRRQVEALPVVNYNLLKYICKFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPVTIMEGTVLVQQLMAVLIGQHDVLFPAEEE 337          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Zebrafish
Match: ARHGAP22 (si:dkey-191m6.4 [Source:ZFIN;Acc:ZDB-GENE-121214-182])

HSP 1 Score: 183.726 bits (465), Expect = 5.573e-50
Identity = 111/315 (35.24%), Postives = 175/315 (55.56%), Query Frame = 3
Query:  114 EDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANSEFN-FSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRI----IHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY-EWD-NPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRI--DANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHS-ENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            E ++   WLKKQ    K  + R+FVL  + L+++ ++ ++  +G ISLK  +++EL  +      + F ILP   K+    +H  + L  N + +   W+  +++ ++   GGG+FG  L   + +   E  + PR+    + +C  +IRE GL EEG+FR  GQ +LV +++E  D  +  ++D N DVHTV SLLKLYLRELPEP++PF  Y+        +  D  E +  + + +  LP  N  LLKY+C FL EV SHS EN+M + +LA +F PN+LR +  DP       S++   +   I  HD L+
Sbjct:   39 EGVLKAGWLKKQRSIMKNWQLRWFVLRADHLFFYKDEEETKPQGCISLKGSQVNELTANPEEPGRHLFEILPAGEKDKAAMSHESFLLMANTQSDMDDWVKAIRRVIWAPFGGGIFGQRLEDTVQY---ERKFGPRLAPLLVEQCVDFIREQGLDEEGLFRMPGQANLVKELQEAFDCGDKPQFDSNTDVHTVASLLKLYLRELPEPVVPFCKYEDFLTCAQLLTKDEEEGIQELGKLVMTLPAANFNLLKYICKFLDEVQSHSHENKMGVQNLATVFGPNMLRPKMEDPVAIMEGTSLVQHLMTVLISEHDRLY 350          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Zebrafish
Match: arhgap22 (Rho GTPase activating protein 22 [Source:ZFIN;Acc:ZDB-GENE-090313-87])

HSP 1 Score: 172.555 bits (436), Expect = 8.358e-49
Identity = 105/296 (35.47%), Postives = 167/296 (56.42%), Query Frame = 3
Query:  114 EDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANSEFN-FSILPEIGKELINE--NHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNY--------VPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHS-ENRMEISSLAKIFSPNILRDQDTDP 953
            E ++   WLKKQ    K  + R+FVL  + LY++ ++ ++  +G I L+  +++EL  +      + F I+P    E      +H  + L  N +++ + W+  +++ ++   GGG+FG        HL++   Y         P ++ +C  +IRE GLKEEG+FR  GQ +LV ++++  D  +      N DVHTV SLLKLYLRELPEP+IPF+ Y+        +  +E + L  + +++  LP  N+ LLKY+C FL EV SHS EN+M + +LA +F PNILR +  DP
Sbjct:   24 EQVVKAGWLKKQRSIMKNWQLRWFVLRTDHLYFYKDEEETKPQGCIPLQGSQVNELTANPDEPGRHLFEIVPGCTGEKDRSALSHEAFLLMANSQNDMEDWVKAIRRVIWAPFGGGIFGQ-------HLEDTVQYERKFGPRLAPLLVEQCVDFIREQGLKEEGLFRMPGQANLVKELQDAFDCGDKPLFDSNTDVHTVASLLKLYLRELPEPVIPFNKYEDFLTCAQLLLKDEEMGLGELVKQVSTLPQANYNLLKYICKFLDEVQSHSNENKMSVQNLATVFGPNILRPKIEDP 312          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Zebrafish
Match: arhgap24 (Rho GTPase activating protein 24 [Source:ZFIN;Acc:ZDB-GENE-091118-20])

HSP 1 Score: 169.088 bits (427), Expect = 5.995e-45
Identity = 92/249 (36.95%), Postives = 146/249 (58.63%), Query Frame = 3
Query:  321 LPEIG-KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRI--DANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYE 1043
            +P+ G +E +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + +   N   P ++ +C  +IR +GL+EEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IPFS Y+   A    +  D    +  ++ ++  LPV N+ LLKY+C FL EV S+S  N+M + +LA +F PNILR +  DP        ++   +A  I  HD LF  E E
Sbjct:    1 MPKGGDRERMTSNHETYLLMASTQNDMEDWVKSIRRVIWAPFGGGIFGQKLEETVRYERRYGNKMAPMLVEQCVDFIRNWGLREEGLFRLPGQANLVKELQDAFDCGEKPSFDC-NTDVHTVASLLKLYLRELPEPVIPFSKYEEFLACTKLLSKDQEAGMKELRRQVEALPVVNYNLLKYICKFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPVTIMEGTVLVQQLMAVLIGQHDVLFPAEEE 248          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Zebrafish
Match: arhgap24 (Rho GTPase activating protein 24 [Source:ZFIN;Acc:ZDB-GENE-091118-20])

HSP 1 Score: 168.318 bits (425), Expect = 1.472e-44
Identity = 90/243 (37.04%), Postives = 142/243 (58.44%), Query Frame = 3
Query:  336 KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRI--DANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYE 1043
            +E +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + +   N   P ++ +C  +IR +GL+EEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IPFS Y+   A    +  D    +  ++ ++  LPV N+ LLKY+C FL EV S+S  N+M + +LA +F PNILR +  DP        ++   +A  I  HD LF  E E
Sbjct:   26 RERMTSNHETYLLMASTQNDMEDWVKSIRRVIWAPFGGGIFGQKLEETVRYERRYGNKMAPMLVEQCVDFIRNWGLREEGLFRLPGQANLVKELQDAFDCGEKPSFDC-NTDVHTVASLLKLYLRELPEPVIPFSKYEEFLACTKLLSKDQEAGMKELRRQVEALPVVNYNLLKYICKFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPVTIMEGTVLVQQLMAVLIGQHDVLFPAEEE 267          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Xenopus
Match: ARHGAP24 (Rho GTPase activating protein 24 [Source:NCBI gene;Acc:100488856])

HSP 1 Score: 205.682 bits (522), Expect = 2.046e-57
Identity = 121/343 (35.28%), Postives = 191/343 (55.69%), Query Frame = 3
Query:   75 NITGREPQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXX-XDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYV-PRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANEN---LDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSKYDGDSRY 1076
            N+    P      ++ I C WL+KQGG  KT   R+FVL  + LYYF ++ +    G I L    + E    +++  +F F ++P   +E +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K    ++ P ++ +C  +IR+ GL EEG+FR  GQ +LV ++++  D   + +++  N D+HTV SLLKLYLRELPEP+IPFS Y+   +    +   E     +LVK+ +R LP  N+ LLKY+C FL EV SHS  N+M + +LA +FSPNILR +  DP        V+   +A  I  H+ LF          DGD+++
Sbjct:    5 NVPVESPHISPGQQNTIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDEMKPLGTIFLPGNRVVEHPCNEESPGKFLFEVVPGGDRERMTANHETYLLMASTQNDMEDWVRSIRRVIWAPFGGGIFGQKLEDTVRYEKRYGTHLAPMLVEQCVDFIRQQGLTEEGLFRMPGQANLVKELQDAFDCGEKPSFD-SNTDIHTVASLLKLYLRELPEPVIPFSKYEDFISSAKHLSKEEESGMAELVKQ-VRSLPPVNYNLLKYICRFLDEVQSHSGVNKMSVQNLATVFSPNILRPKVQDPMTIMEGTVVVQQLMAVMISQHEVLF--------PKDGDNQF 337          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Xenopus
Match: palm2 (paralemmin 2 [Source:Xenbase;Acc:XB-GENE-6039054])

HSP 1 Score: 153.295 bits (386), Expect = 1.441e-39
Identity = 85/239 (35.56%), Postives = 131/239 (54.81%), Query Frame = 3
Query:  330 IGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRI--DANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFE 1031
            I  + +  NH  + L  N   E + W+  + + ++   GG +FG  L   +     E  + P ++ +C  +IRE GL+EEG+FR  GQ +LV ++++  D         + DVHTV SLLKLYLRELPEP+IPFS Y       + +  D  E    +   ++ LP  N+ LLKY+C+FL EV S+S+ N+M + +LA +F+PNILR +  DP       S+I   +   I  +  +F+
Sbjct:   39 IKGDKVTVNHETFLLMANSHHEMEDWVRAIHKVIWAPFGGAVFGQRLEDAV---SLETRHAPLVVEQCVDFIRENGLQEEGLFRLPGQATLVKELQDTFDSGGKPTFDKSTDVHTVASLLKLYLRELPEPVIPFSRYQDFLRCAHILSGDQGEGTQELSILIKSLPPVNYNLLKYICSFLDEVQSYSDTNKMNVQNLATVFAPNILRPKQQDPVALIEGASLIQHLLTILIHENHWIFQ 274          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Xenopus
Match: svopl (SVOP like [Source:Xenbase;Acc:XB-GENE-994336])

HSP 1 Score: 143.28 bits (360), Expect = 1.717e-36
Identity = 108/358 (30.17%), Postives = 175/358 (48.88%), Query Frame = 3
Query:  114 EDIIYCNWLKKQGGKF-KTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANS-EFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNY-VPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVG--YRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF----EFEYEPLSK---------------YDGDSRYTDEDSYSLK 1103
            E  +   WLKKQ   F K  ++RYFVL    L ++ +      +G + L    +SE+     ++ +F F I+P    E      + Y L  N + E ++W+  +K++      G +FG  L   + + K+   + VP ++ +C  +IRE G+ EEGIFR  GQ +LV Q++E  D   R ++  D  DVHTV SL KLYLRELPEP IP+  Y+   +      +D  +    +  ++ +LP  N+ LL ++C FL EV  +S  N+M + +L+ +   N+L+ Q  DP     +   I   +   I  H+  F    +   EP+++               +D DS+  +    SLK
Sbjct:   44 EKPVKSGWLKKQQKSFVKNWQQRYFVLKGQQLCFYKDLDDGKAQGCLFLPRSTVSEVSSSPDDAGKFIFQIIPASSMEHNKPIPDPYVLMANSQAEMEEWVKAIKRAAGFP-SGAVFGQCLVDTITYEKKYGRHTVPILMEKCADFIREKGMDEEGIFRLPGQDNLVKQLKEAFDAGERPSFSSDT-DVHTVASLFKLYLRELPEPAIPWRQYEDFLSCEKMMSVDEEKGHGELMNQISILPKENYNLLCFICRFLFEVQKNSSVNKMSVDNLSMVIGVNLLKPQTEDPEALMRSAPQIQRLLTVMISHHEKFFPKSKDLPEEPVTQKSDHKKVQVPRSSVGWDADSKQDNSQEMSLK 399          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Xenopus
Match: svopl (SVOP like [Source:Xenbase;Acc:XB-GENE-994336])

HSP 1 Score: 135.191 bits (339), Expect = 7.089e-34
Identity = 112/365 (30.68%), Postives = 176/365 (48.22%), Query Frame = 3
Query:  114 EDIIYCNWLKKQGGKF-KTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANS-EFNFSILPEIGKELINENHNK-----YFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNY-VPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVG--YRIDANENLDLVKEKLRLLPVPNHQLLKYLC--TFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF----EFEYEPLSK---------------YDGDSRYTDEDSYSLK 1103
            E  +   WLKKQ   F K  ++RYFVL    L ++ +      +G + L    +SE+     ++ +F F I+P    E     HNK     Y L  N + E ++W+  +K++      G +FG  L   + + K+   + VP ++ +C  +IRE G+ EEGIFR  GQ +LV Q++E  D   R ++  D  DVHTV SL KLYLRELPEP IP+  Y+   +      +D  +    +  ++ +LP  N+ LL Y C   FL EV  +S  N+M + +L+ +   N+L+ Q  DP     +   I   +   I  H+  F    +   EP+++               +D DS+  +    SLK
Sbjct:   19 EKPVKSGWLKKQQKSFVKNWQQRYFVLKGQQLCFYKDLDDGKAQGCLFLPRSTVSEVSSSPDDAGKFIFQIIPASSME-----HNKPIPDPYVLMANSQAEMEEWVKAIKRAAGFP-SGAVFGQCLVDTITYEKKYGRHTVPILMEKCADFIREKGMDEEGIFRLPGQDNLVKQLKEAFDAGERPSFSSDT-DVHTVASLFKLYLRELPEPAIPWRQYEDFLSCEKMMSVDEEKGHGELMNQISILPKENYNLL-YFCHDRFLFEVQKNSSVNKMSVDNLSMVIGVNLLKPQTEDPEALMRSAPQIQRLLTVMISHHEKFFPKSKDLPEEPVTQKSDHKKVQVPRSSVGWDADSKQDNSQEMSLK 375          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Xenopus
Match: palm2 (paralemmin 2 [Source:Xenbase;Acc:XB-GENE-6039054])

HSP 1 Score: 120.553 bits (301), Expect = 2.616e-30
Identity = 72/213 (33.80%), Postives = 119/213 (55.87%), Query Frame = 3
Query:  105 FKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXD-KANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNY 734
             + E  +   WLKK+    K  ++R+FVL    L Y+ ++ +S ++G ISL+  ++ ++    +  +++ F I+P    + +  NH  + L  N   E + W+  + + ++   GG +FG  L   +     E  + P ++ +C  +IRE GL+EEG+FR  GQ +LV ++++  D         + DVHTV SLLKLYLRELPEP+IPFS Y
Sbjct:   32 LQQEQSLKSGWLKKRRNIMKNWQQRWFVLRGQELRYYKDKEESKMQGCISLQGFQVLKVNPQPEEPNKYLFEIIP---GDKVTVNHETFLLMANSHHEMEDWVRAIHKVIWAPFGGAVFGQRLEDAV---SLETRHAPLVVEQCVDFIRENGLQEEGLFRLPGQATLVKELQDTFDSGGKPTFDKSTDVHTVASLLKLYLRELPEPVIPFSRY 238          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Mouse
Match: Arhgap24 (Rho GTPase activating protein 24 [Source:MGI Symbol;Acc:MGI:1922647])

HSP 1 Score: 202.986 bits (515), Expect = 1.777e-56
Identity = 114/317 (35.96%), Postives = 184/317 (58.04%), Query Frame = 3
Query:  129 CNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKAN-SEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            C WL+KQGG  KT   R+FVL  + LYYF ++ ++   G I L   ++ E   ++ N  +F F ++P   ++ +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP++P++ Y+   +    +   E   +  + ++++ LPV N+ LLKY+C FL EV S+S  N+M   +LA +F PNILR +  DP        V+   ++  I  HD LF  + EP SK
Sbjct:   21 CGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLHGNKVIEHPCNEENPGKFLFEVVPGGERDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAGVKELMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSK 336          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Mouse
Match: Arhgap22 (Rho GTPase activating protein 22 [Source:MGI Symbol;Acc:MGI:2443418])

HSP 1 Score: 171.785 bits (434), Expect = 1.120e-45
Identity = 106/315 (33.65%), Postives = 172/315 (54.60%), Query Frame = 3
Query:  120 IIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKAN-SEFNFSILPEIG--KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRI----IHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVK--EKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            ++   WL+KQ    K  ++R+FVL  + L+Y+ ++ +S  +G ISL+  +++EL  D  +  +  F I P     +E +  N     L  + + + + W+  +++ ++   G G+FG  L   + H   E  + PR+    + +C  +IRE GL EEG+FR  GQ +LV  +++  D           DVHTV SLLKLYLRELPEP+IPF+ Y+   +    +  +E    V+  +++  LP  N+ LL+Y+C FL EV +HS+ N+M + +LA +F PNILR Q  DP       S++   +   I+ H  LF
Sbjct:   44 VLKAGWLRKQRSIMKNWQQRWFVLRGDQLFYYKDKDESKPQGFISLQGTQVTELLPDPEDPGKHLFEITPGGATEREKVPANPEALLLMASSQRDMEDWVQAIRRVIWAPLGRGIFGQRLEDTVHH---ERKFGPRLAPLLVEQCVDFIRERGLSEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEGEGTVELAKQVSNLPQANYNLLRYICKFLDEVQAHSDVNKMSVQNLATVFGPNILRPQIEDPVTIMEGTSLVQHLMTVLIRKHGQLF 355          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Mouse
Match: Arhgap24 (Rho GTPase activating protein 24 [Source:MGI Symbol;Acc:MGI:1922647])

HSP 1 Score: 165.622 bits (418), Expect = 1.003e-43
Identity = 92/245 (37.55%), Postives = 143/245 (58.37%), Query Frame = 3
Query:  345 INENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKE---KLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP++P++ Y+   +    +   E    VKE   +++ LPV N+ LLKY+C FL EV S+S  N+M   +LA +F PNILR +  DP        V+   ++  I  HD LF  + EP SK
Sbjct:    1 MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAG-VKELMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSK 243          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Mouse
Match: Arhgap24 (Rho GTPase activating protein 24 [Source:MGI Symbol;Acc:MGI:1922647])

HSP 1 Score: 165.622 bits (418), Expect = 1.003e-43
Identity = 92/245 (37.55%), Postives = 143/245 (58.37%), Query Frame = 3
Query:  345 INENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKE---KLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP++P++ Y+   +    +   E    VKE   +++ LPV N+ LLKY+C FL EV S+S  N+M   +LA +F PNILR +  DP        V+   ++  I  HD LF  + EP SK
Sbjct:    1 MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAG-VKELMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSK 243          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Mouse
Match: Arhgap24 (Rho GTPase activating protein 24 [Source:MGI Symbol;Acc:MGI:1922647])

HSP 1 Score: 165.622 bits (418), Expect = 1.003e-43
Identity = 92/245 (37.55%), Postives = 143/245 (58.37%), Query Frame = 3
Query:  345 INENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKE---KLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP++P++ Y+   +    +   E    VKE   +++ LPV N+ LLKY+C FL EV S+S  N+M   +LA +F PNILR +  DP        V+   ++  I  HD LF  + EP SK
Sbjct:    1 MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAG-VKELMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSK 243          
BLAST of Rho GTPase activating protein 24 vs. UniProt/SwissProt
Match: sp|Q8N264|RHG24_HUMAN (Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 1.558e-56
Identity = 118/329 (35.87%), Postives = 190/329 (57.75%), Query Frame = 3
Query:   93 PQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKAN-SEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            PQ     ++ I C WL+KQGG  KT   R+FVL  + LYYF ++ ++   G I L   ++SE   ++ N  +F F ++P   ++ +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IP++ Y+   +    +   E   +  + ++++ LPV N+ LLKY+C FL EV S+S  N+M + +LA +F PNILR +  DP        V+   ++  I  HD LF  + E  SK
Sbjct:   11 PQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSK 338          
BLAST of Rho GTPase activating protein 24 vs. UniProt/SwissProt
Match: sp|Q8C4V1|RHG24_MOUSE (Rho GTPase-activating protein 24 OS=Mus musculus OX=10090 GN=Arhgap24 PE=1 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 1.194e-55
Identity = 114/317 (35.96%), Postives = 184/317 (58.04%), Query Frame = 3
Query:  129 CNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKAN-SEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            C WL+KQGG  KT   R+FVL  + LYYF ++ ++   G I L   ++ E   ++ N  +F F ++P   ++ +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP++P++ Y+   +    +   E   +  + ++++ LPV N+ LLKY+C FL EV S+S  N+M   +LA +F PNILR +  DP        V+   ++  I  HD LF  + EP SK
Sbjct:   21 CGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLHGNKVIEHPCNEENPGKFLFDVVPGGERDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAGVKELMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSK 336          
BLAST of Rho GTPase activating protein 24 vs. UniProt/SwissProt
Match: sp|Q5U2Z7|RHG24_RAT (Rho GTPase-activating protein 24 OS=Rattus norvegicus OX=10116 GN=Arhgap24 PE=1 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 8.361e-55
Identity = 112/322 (34.78%), Postives = 186/322 (57.76%), Query Frame = 3
Query:  114 EDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXX-XDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSK 1055
            ++   C WL+KQGG  KT   R+FVL  + L+YF ++ ++   G I L   ++ E    +++  +F F ++P   ++ +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + K   N   P ++ +C  +IR+ GLKEEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP++P++ Y+   +    +   E   +  + ++++ LPV N+ LLKY+C FL EV S+S  N+M   +LA +F PNILR +  DP        V+   ++  I  HD LF  + EP SK
Sbjct:   17 QNATKCGWLRKQGGFVKTWHTRWFVLKGDQLHYFKDEDETKPLGTIFLPGNKVIEHPCNEESPGKFLFEVVPGGERDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFD-SNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAGVKELTKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDRLFPKDTEPQSK 337          
BLAST of Rho GTPase activating protein 24 vs. UniProt/SwissProt
Match: sp|Q8BL80|RHG22_MOUSE (Rho GTPase-activating protein 22 OS=Mus musculus OX=10090 GN=Arhgap22 PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 7.838e-45
Identity = 106/315 (33.65%), Postives = 172/315 (54.60%), Query Frame = 3
Query:  120 IIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKAN-SEFNFSILPEIG--KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRI----IHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVK--EKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            ++   WL+KQ    K  ++R+FVL  + L+Y+ ++ +S  +G ISL+  +++EL  D  +  +  F I P     +E +  N     L  + + + + W+  +++ ++   G G+FG  L   + H   E  + PR+    + +C  +IRE GL EEG+FR  GQ +LV  +++  D           DVHTV SLLKLYLRELPEP+IPF+ Y+   +    +  +E    V+  +++  LP  N+ LL+Y+C FL EV +HS+ N+M + +LA +F PNILR Q  DP       S++   +   I+ H  LF
Sbjct:   44 VLKAGWLRKQRSIMKNWQQRWFVLRGDQLFYYKDKDESKPQGFISLQGTQVTELLPDPEDPGKHLFEITPGGATEREKVPANPEALLLMASSQRDMEDWVQAIRRVIWAPLGRGIFGQRLEDTVHH---ERKFGPRLAPLLVEQCVDFIRERGLSEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEGEGTVELAKQVSNLPQANYNLLRYICKFLDEVQAHSDVNKMSVQNLATVFGPNILRPQIEDPVTIMEGTSLVQHLMTVLIRKHGQLF 355          
BLAST of Rho GTPase activating protein 24 vs. UniProt/SwissProt
Match: sp|Q7Z5H3|RHG22_HUMAN (Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.231e-44
Identity = 107/316 (33.86%), Postives = 169/316 (53.48%), Query Frame = 3
Query:  120 IIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXX---XXXDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRI----IHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANEN---LDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            ++   WLKKQ    K  ++R+FVL  + L+Y+ ++ +   +G ISL+  +++E     ED     F  S      +E +  N     L  + + + + W+  +++ ++   GGG+FG  L   + H   E  Y PR+    + +C  +IRE GL EEG+FR  GQ +LV  +++  D           DVHTV SLLKLYLRELPEP++PF+ Y+   +    +  +E    L+L K+ +  LP  N+ LL+Y+C FL EV ++S  N+M + +LA +F PNILR Q  DP       S++   +   I+ H  LF
Sbjct:   38 VLKAGWLKKQRSIMKNWQQRWFVLRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANPEALLLMASSQRDMEDWVQAIRRVIWAPLGGGIFGQRLEETVHH---ERKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQ-VSNLPQANYNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRKHSQLF 349          
BLAST of Rho GTPase activating protein 24 vs. TrEMBL
Match: A0A068Y5S5 (Rho GTPase activating protein 24 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000489900 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 6.964e-74
Identity = 132/330 (40.00%), Postives = 197/330 (59.70%), Query Frame = 3
Query:   72 RNITGREPQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXX---XXXXXXXXXDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRAN----YEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHS-ENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFE 1037
            R+ + R P +      I +C WL+KQGGKF+T +RR+FVL +  L Y+ +  +  L G + +     +E+   E D    +  F+ + +  K   +E      LS +  DE + WI  L++ +YL  GGGLFGT L  V  +   E  YVPR++++  ++IR+YGL  +GIFRK G   ++ ++ +  D A        +  D H    +LK YLRELPEP+IP+  YD LKA GY I+  ++L  + ++L  LP PN++LL++LC  L+EVA HS ENRM + +LA +F+PNILR  D DP VE S   VIT+T+A FI+ H++LF +E
Sbjct:    8 RSSSVRVPTSNGSAIQIQHCGWLRKQGGKFRTWKRRFFVLRQGSLEYYTDSEQIRLIGALEIGPPDIMEVVACETDVTADDKAFNFIVKKSKTWGSEQKQSLILSASSADERRDWIRALRKQLYLKLGGGLFGTHLSEVFAYTSPETKYVPRVVYKTAEFIRQYGLTTDGIFRKCGSRHVIEELCDAYDMARPDPILRANEHDAHAAAGVLKQYLRELPEPVIPYRQYDRLKATGYLIEDGQDLKPIIDQLECLPAPNYRLLQFLCQLLSEVAEHSEENRMTVENLASVFAPNILRQADYDPDVEMSVTPVITLTIAGFIRCHEELFRYE 337          
BLAST of Rho GTPase activating protein 24 vs. TrEMBL
Match: A0A068WII6 (Rho GTPase activating protein 24 OS=Echinococcus granulosus OX=6210 GN=EgrG_000489900 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 9.349e-74
Identity = 132/330 (40.00%), Postives = 197/330 (59.70%), Query Frame = 3
Query:   72 RNITGREPQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXX---XXXXXXXXXDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRAN----YEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHS-ENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFE 1037
            R+ + R P +      I +C WL+KQGGKF+T +RR+FVL +  L Y+ +  +  L G + +     +E+   E D    +  F+ + +  K   +E      LS +  DE + WI  L++ +YL  GGGLFGT L  V  +   E  YVPR++++  ++IR+YGL  +GIFRK G   ++ ++ +  D A        +  D H    +LK YLRELPEP+IP+  YD LKA GY I+  ++L  + ++L  LP PN++LL++LC  L+EVA HS ENRM + +LA +F+PNILR  D DP VE S   VIT+T+A FI+ H++LF +E
Sbjct:    8 RSSSVRVPTSNGSAIQIQHCGWLRKQGGKFRTWKRRFFVLRQGSLEYYTDSEQIRLIGALEIGPPDIMEVVACETDVTADDKAFNFIVKKSKTWGSEQKQSLVLSASSADERRDWIRALRKQLYLKLGGGLFGTHLSEVFAYTSPETKYVPRVVYKTAEFIRQYGLTTDGIFRKCGSRHVIEELCDAYDMARPDPILRANEHDAHAAAGVLKQYLRELPEPVIPYRQYDRLKATGYLIEDGQDLKPIIDQLECLPAPNYRLLQFLCQLLSEVAEHSEENRMTVENLASVFAPNILRQADYDPDVEMSVTPVITLTIAGFIRCHEELFRYE 337          
BLAST of Rho GTPase activating protein 24 vs. TrEMBL
Match: A0A5J4P3M8 (Rho GTPase-activating protein 22/24/25 OS=Paragonimus westermani OX=34504 GN=DEA37_0003368 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.331e-71
Identity = 148/424 (34.91%), Postives = 231/424 (54.48%), Query Frame = 3
Query:   66 MRRNITG--REPQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKA-----NSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRAN----YEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSKYDGDSRYTDEDSYSLKSALSYINC-ATLLSPNDDSSKSTDSISRMKNSPTRVQSMIIINDNLSNAFELTRSQDTVLNTVPRP 1298
            MR  + G     +N+  N  + Y  WLKK GGKFKT ++RYFVL    L Y+ N       GK SL++ ++       A     N  F F + P+   + ++ NH ++ LS    +E + WI   ++ +YL  GG LFG+ L  V P+ K E++Y+PR+++E  ++IR  G+  EG+FRK G  +++ ++ +  D A      + +  +VH    LLKLYLRELPEP++PF+ Y+ LKA G+ I   ++L ++   L +LP PN+ +L+++C FL EV+++++ N M I +LA +F+PN+LR  D D  VE + + +I +T+A FI+ H  LF  E  PL+  D +  +    S S +S +   +  A L SPND SS+S    +                 NLS    +        NTVPRP
Sbjct:    1 MRNALAGNLSTEKNIHPNSSVTYKGWLKKLGGKFKTWKKRYFVLEGTQLSYYTNPDDQRALGKFSLESTQIEIPNVTDAEFGGDNKGFVFIVKPDGTDDNLSGNHTQFVLSAQTAEERKYWIRAFRKVLYLKIGGALFGSHLNEVFPYTKPEHSYLPRVVYEAVEFIRANGIDCEGVFRKCGAQNMIQELADTYDVAATGPILQPNQHNVHVAAGLLKLYLRELPEPIVPFAFYERLKATGFHIADGQDLTVLIRTLEMLPAPNYHVLQFMCQFLFEVSNYAQSNLMTIENLASVFAPNVLRLADGDLDVEMAASPIINLTMAEFIRCHSRLFRLEMVPLNSMD-NIVFGSVKSESQRSTMPSKDWQANLFSPNDVSSRSQGFFT-----------------NLSKPLHIAEKYS---NTVPRP 403          
BLAST of Rho GTPase activating protein 24 vs. TrEMBL
Match: A0A4S2M4Z2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003926 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 4.371e-71
Identity = 126/324 (38.89%), Postives = 195/324 (60.19%), Query Frame = 3
Query:  126 YCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANSEFN-------FSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRAN----YEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSKYD 1061
            +  WLKK GGKFKT R+R+FV+    + Y+ N  +  L G+ S++N+++     D  ++EF        F + P +  E ++  H +  L+     E + WI  +++++YL +GG LFG+ L  V P+ + E++Y+PR+++E   +IREYG+  EGIFRK G  +L+  + E  D +        +   VH    LLKLYLRELPEP+IPF+ YD LK+VG+++   ++ ++V + + +LP PN+ LL++LC FL EVA H E N M + +LA IF+PNILR +D D  VE S   +I +T   FI+ H  LF     P S++D
Sbjct:   23 HTGWLKKLGGKFKTWRKRFFVIQGRCMSYYTNPEELRLLGEFSIENVQIDIP--DSTDNEFGGESKGYIFILKPAVTSETLSPGHQQMVLAAATPRERKTWIRAIRKALYLKQGGALFGSKLEEVFPYTRPEHDYLPRVVYESAAFIREYGMTTEGIFRKCGTQNLIQALAEAYDVSTPGPILHPEEHSVHIAAGLLKLYLRELPEPVIPFAFYDRLKSVGFKVQLGQDQEMVTDSIEMLPAPNYHLLQFLCQFLNEVAEHHEINLMTVENLASIFAPNILRQEDGDLDVEISAAPLINLTCTQFIRYHKQLFRLRIAPSSQFD 344          
BLAST of Rho GTPase activating protein 24 vs. TrEMBL
Match: A0A4S2M3Z2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003926 PE=4 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 7.144e-70
Identity = 126/324 (38.89%), Postives = 195/324 (60.19%), Query Frame = 3
Query:  126 YCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANSEFN-------FSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRAN----YEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSKYD 1061
            +  WLKK GGKFKT R+R+FV+    + Y+ N  +  L G+ S++N+++     D  ++EF        F + P +  E ++  H +  L+     E + WI  +++++YL +GG LFG+ L  V P+ + E++Y+PR+++E   +IREYG+  EGIFRK G  +L+  + E  D +        +   VH    LLKLYLRELPEP+IPF+ YD LK+VG+++   ++ ++V + + +LP PN+ LL++LC FL EVA H E N M + +LA IF+PNILR +D D  VE S   +I +T   FI+ H  LF     P S++D
Sbjct:   23 HTGWLKKLGGKFKTWRKRFFVIQGRCMSYYTNPEELRLLGEFSIENVQIDIP--DSTDNEFGGESKGYIFILKPAVTSETLSPGHQQMVLAAATPRERKTWIRAIRKALYLKQGGALFGSKLEEVFPYTRPEHDYLPRVVYESAAFIREYGMTTEGIFRKCGTQNLIQALAEAYDVSTPGPILHPEEHSVHIAAGLLKLYLRELPEPVIPFAFYDRLKSVGFKVQLGQDQEMVTDSIEMLPAPNYHLLQFLCQFLNEVAEHHEINLMTVENLASIFAPNILRQEDGDLDVEISAAPLINLTCTQFIRYHKQLFRLRIAPSSQFD 344          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Cavefish
Match: si:dkey-191m6.4 (rho GTPase-activating protein 22 [Source:NCBI gene;Acc:103041296])

HSP 1 Score: 187.193 bits (474), Expect = 3.121e-51
Identity = 111/314 (35.35%), Postives = 177/314 (56.37%), Query Frame = 3
Query:  114 EDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANSEFN-FSILPEIG--KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKE-EYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY-EWD-NPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRI--DANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHS-ENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            E ++   WLKKQ    K  + R+FVL  + LY++ ++ ++  +G I LK  +++EL  +   +  + F I+P     K+    +H  + L  N +++   W+  +++ ++   GGG+FG  L   +   K+      P ++ +C  +IRE GL EEG+FR  GQ +LV ++++  D  +  ++D N DVHTV SLLKLYLRELPEP+IPF  YD   +    +  D  E L  + ++++ LP  N  LLKY+C FL EV SHS +N+M + +LA +F PNILR +  DP       S++   +   I  HD L+
Sbjct:   39 EGVLKAGWLKKQRSIMKNWQLRWFVLRSDYLYFYKDEEETKPQGCIPLKGSQVNELTVNPEEAGRHLFEIVPGAAGEKDRTAVSHEAFLLMANSQNDMDDWVRAIRRVIWAPFGGGIFGQRLEDTVQFEKKFGPRLAPLLVEQCVDFIREQGLDEEGLFRMPGQANLVKELQDAFDCGDKPQFDSNTDVHTVASLLKLYLRELPEPVIPFCKYDDFLSCAQILAKDEEEALQQLWQQVKTLPAANFNLLKYICKFLDEVQSHSMQNKMSVQNLATVFGPNILRPKMEDPVAIMEGTSLVQHLMTVLISKHDQLY 352          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Cavefish
Match: ARHGAP22 (Rho GTPase activating protein 22 [Source:HGNC Symbol;Acc:HGNC:30320])

HSP 1 Score: 167.933 bits (424), Expect = 2.508e-47
Identity = 106/295 (35.93%), Postives = 169/295 (57.29%), Query Frame = 3
Query:  111 NEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANSEFN-FSILPEIG-KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNY--------VPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYE-WDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASH-SENRMEISSLAKIFSPNILRDQDTDP 953
             E  +   WLKKQ    K  + R+FVL  + LY++ ++ ++  +G I L   +++EL  +      + F I+P  G K+    +H  + L  N +++ + W+  +++ ++   GG +FG        HL++   Y         P ++ +C  +IRE GLKEEG+FR  GQ +LV ++++  D  +   +DN DVHTV SLLKLYLRELPEP+IPF+ Y+        +  +E + L  + ++++ LP  N+ LLKY+C FL EV SH SEN+M + +LA +F PNILR +  DP
Sbjct:   23 QERAVKAGWLKKQRSIMKNWQLRWFVLRTDQLYFYKDEEETKPQGCIPLHGCQVNELTANPDEPGRHLFEIVPGTGEKDRSALSHEAFLLMANSQNDMEDWVKAIRRVIWAPFGG-IFGQ-------HLEDTVQYERKFGPRLAPLLVEQCVDFIREQGLKEEGLFRMPGQANLVKELQDAFDCGDKPLFDNTDVHTVASLLKLYLRELPEPVIPFNKYEDFLTCAQLLLKDEEVGLSELAQQVKTLPQANYNLLKYIC-FLDEVQSHSSENKMSVQNLATVFGPNILRPKMEDP 308          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Cavefish
Match: arhgap24 (Rho GTPase activating protein 24 [Source:ZFIN;Acc:ZDB-GENE-091118-20])

HSP 1 Score: 159.073 bits (401), Expect = 1.486e-41
Identity = 84/234 (35.90%), Postives = 134/234 (57.26%), Query Frame = 3
Query:  345 INENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNP--DVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRI--DANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + +   N   P ++ +C  +IR++GL+EEG+FR  GQ +LV ++++  D       N   DVHTV SLLKLYLRELPEP+IPF  YD   A    +  D +  +  ++ ++  LP+ N+ LLKY+C FL EV S+S  N+M + +LA +F PNILR +  DP        ++   +A  I  H  +F
Sbjct:    1 MTANHETYLLMASTQNDMEDWVKTIRRVIWAPFGGGIFGQKLEETVRYERRYGNKLAPMLVEQCVDFIRQWGLQEEGLFRLPGQANLVKELQDAFDCGEKPSFNSSTDVHTVASLLKLYLRELPEPVIPFCKYDEFLACTKLLSKDQDSGMKELRRQVESLPLVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPVAIMEGAVLVQQLMAVLIGQHSVIF 234          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Cavefish
Match: arhgap25 (Rho GTPase activating protein 25 [Source:ZFIN;Acc:ZDB-GENE-060526-210])

HSP 1 Score: 151.369 bits (381), Expect = 5.989e-39
Identity = 101/306 (33.01%), Postives = 163/306 (53.27%), Query Frame = 3
Query:  132 NWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKE-EYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDAN--ENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
             WLKKQ    K  +  YFVL  NVL Y  +  +S ++G I L   +++EL  ++ + +F F I+P       +   +   L    + E ++W+  +++++       +FG  L  +L + K+     VP ++ +C ++I+E+GL EEGIFR  GQ + V   RE  D   R ++  D  DVHTV SLLKLYLRELPEP++P++ Y         +DA      + +++++ LLP  N+ LL Y+C FL EV  HS+ N+M + +LA +   N+ + Q  D         +I   +   I+ H+ LF
Sbjct:    8 GWLKKQRSIVKNWKLCYFVLRGNVLTYHKDDRESAVQGTIQLGATQVNELPSNQ-DDKFIFEIIPRSNG---DRERDGCVLMATSQSEMEEWVRLIRRAIGAP-NSAVFGKGLADILAYEKKLGPRSVPMLVEKCAEFIKEHGLDEEGIFRLPGQENQVKHFREAFDAGERPSFPSDT-DVHTVGSLLKLYLRELPEPVVPWTQYQDFLDSSLMLDATTAAGREKLEKQISLLPKVNYNLLSYICRFLFEVQQHSKVNKMSVENLATVMGVNLFKPQVEDAISMMKGTPMIQKVMTVMIRHHELLF 307          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Cavefish
Match: si:ch211-247j9.1 (si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-212])

HSP 1 Score: 144.436 bits (363), Expect = 1.786e-36
Identity = 80/180 (44.44%), Postives = 109/180 (60.56%), Query Frame = 3
Query:  504 NYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY-EWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDAN---ENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            +  P ++ +C  +IR  GL E G+FR+ GQ +LV +++E  D      +D+ DVHTV SLLKLYLRELPEPL+PFS Y      G +I A+   + L  +K  L  LPV N  LLKY+C FL EV ++S  N+M I +LA +F PNILR +  DP   ES   V+   ++  I+ H  LF
Sbjct:   50 HMAPLVVEQCADFIRARGLLEVGLFRQPGQATLVKELQEAFDAGEKPSFDSTDVHTVASLLKLYLRELPEPLVPFSRYQEFLMCGKKIPADREQQGLLELKSLLHELPVANFNLLKYICRFLNEVQAYSSTNKMSIQNLATVFGPNILRPKAEDP---ESIIGVVQHLMSELIREHCMLF 226          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001850.1 (pep scaffold:Pmarinus_7.0:GL478209:54363:80813:1 gene:ENSPMAG00000001682.1 transcript:ENSPMAT00000001850.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.954 bits (328), Expect = 1.318e-34
Identity = 89/289 (30.80%), Postives = 138/289 (47.75%), Query Frame = 3
Query:   69 RRNITGREPQNLFKN--EDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKI--XXXXXXXXXXXXDKANSEFNFSILP--EIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLR-------------LVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRL--LPVPNHQLLKYLCTFLTE 863
            RR   G  P +   +    ++   WLKKQGG  ++   R+FVL    L Y+ ++ ++ + G +      +       D  N ++   IL     G E    +     L  + + + ++W   L++ ++   GGG+FG  L               V P         PR++ +C  +IRE GL EEG+FR  GQ SLV  ++   D   R +++  + DVHTV SLLKLYLRELPEP++PFS Y    A    ++A      ++   RL  LP  N+ LL+Y+C  L +
Sbjct:    1 RRGEAGGHPGSASGSSRRGVLKSGWLKKQGGFVRSWHARWFVLRGEQLCYYKDEDENKILGSLFLPGSRVLERPPTPDDPN-KYLLEILSGEARGGERAGGSAESTVLMASSQSDMEEWARALRRVIWAPLGGGVFGQRLEETVRWERQHCGHATVPPGALAGLPPAPRVVQQCVSFIRERGLAEEGLFRMPGQASLVRDLQRAFDCGERPSFD-GSTDVHTVASLLKLYLRELPEPVVPFSAYADFLACAKLLNAKPEQGFLELSCRLQVLPPANYSLLRYICRCLPQ 287          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Sea Lamprey
Match: si:ch211-247j9.1 (si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-212])

HSP 1 Score: 134.42 bits (337), Expect = 3.866e-34
Identity = 87/224 (38.84%), Postives = 127/224 (56.70%), Query Frame = 3
Query:  519 IIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRL---LPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPY-VEESTNSVITVTVAAFIKSHDDLFEFEYEP-----LSKYDGDS--RYTDEDSYSLKSALSYINCATLLSP 1145
            ++ +C  +IR  GL EEG+FR  GQ +LV +++E  D   R  ++ D  DVHTV SL+KLYLRELPEP++PFS Y    +    +  N++ + VKE  +L   LP+ N  LLKY+C+FL EV SH+  N+M I +LA +F PNILR +  DP  + E+  + +   ++  I+ H  LF    E      LS+ +G    R     S+   SA +  +   L SP
Sbjct:    1 LVTQCVNFIRCQGLAEEGLFRLPGQTNLVRELQEAFDCGERPIFDGDT-DVHTVASLVKLYLRELPEPVVPFSLYSEFLSCASLLAKNQS-EGVKELTQLVNSLPLANFNLLKYICSFLYEVQSHASINKMSIQNLATVFGPNILRPKVEDPATIMEAGATTVQHLMSTLIEQHAVLFARGPEASTKSSLSRTNGTGFRRRESGVSWDESSAPAQTDGGALSSP 222          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004676.1 (pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-1 gene:ENSPMAG00000004196.1 transcript:ENSPMAT00000004676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 5.972e-22
Identity = 55/171 (32.16%), Postives = 92/171 (53.80%), Query Frame = 3
Query:  453 LFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRAN------YEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEV-ASHSENRMEISSLAKIFSPNILRDQD 944
            +FG PL ++    + E   VP+ +    + + + GL  +GI+R +G L+ + ++R LVD           W+  D+H +   LK++ RELPEPL PF+ +D   +     D+ E L  +KE+++ LP PN   ++ L   L +V A    NRM   S+A +F P +LR ++
Sbjct:  419 VFGCPLAMLC---ERENTTVPKFVQLSIETVDKRGLCIDGIYRVSGNLATIQKLRFLVDHEEKVSLDESHWE--DIHVITGALKMFFRELPEPLFPFNQFDPFISAIKLQDSREKLTKIKEQVQKLPKPNKDTMRALFEHLKKVIACGDANRMTTQSVAIVFGPTLLRPEN 584          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000404.1 (pep scaffold:Pmarinus_7.0:GL476366:629540:661972:1 gene:ENSPMAG00000000361.1 transcript:ENSPMAT00000000404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 2.580e-20
Identity = 67/188 (35.64%), Postives = 98/188 (52.13%), Query Frame = 3
Query:  510 VPRIIHECCQYIREY-----GLKEEGIFRKNGQLSLVMQMREL--VDRANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDS-LKAVGYRIDANENLDLVKEKLRLL----PVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEE-STNSVITVTVAAFIKSHDDLFE 1031
            VP ++    Q++ E+     GL+ EG+FR +G +  V ++R+    D  +      DV +V  LLKL+LRELP+ ++P S   S L+A  +R  A + + L  E LRLL    P  NH LL+YLC+FL  VA H E N M   +L  +F PN  R     P +E  +   V+    A FI     +F+
Sbjct:   20 VPLVVETMVQFLEEHVSVHTGLESEGLFRVSGSVRAVERLRQAWEADVTSDGRGQADVSSVAGLLKLFLRELPDGVVPASLLPSFLQA--HRDSAGDEMRLA-ESLRLLLAQLPGENHALLRYLCSFLVRVAQHQEVNLMSPQNLGTVFGPNFFR---VSPGMEGIAEQQVVNRVTARFITDFLSIFQ 201          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Sea Lamprey
Match: ARHGAP15 (Rho GTPase activating protein 15 [Source:HGNC Symbol;Acc:HGNC:21030])

HSP 1 Score: 93.2041 bits (230), Expect = 3.214e-20
Identity = 51/174 (29.31%), Postives = 96/174 (55.17%), Query Frame = 3
Query:  453 LFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY------EWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDP 953
            +FG PL  +    + E + VP  +  C   +    L+ +G++R +G  + + ++R +VD   +      +W+  D++ +   LKL+ RELPEPL+P+  ++   A     + +  +  +K+ + +LP+PNH  +K+L   L  V +H E NRM + ++A +F+P +LR +  DP
Sbjct:  605 VFGCPLACLC---ERENSMVPLFVRMCMIALEWQRLEIDGVYRVSGNQATIQKLRIMVDHDEHVDLDDSQWE--DINVITGALKLFFRELPEPLVPYIFFEQFIAAIKIFEYHNRVKCMKDLINILPLPNHNTMKFLIRHLKTVVAHGEKNRMSMQNMAIVFAPTLLRPE-VDP 772          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 70.8626 bits (172), Expect = 3.475e-13
Identity = 64/255 (25.10%), Postives = 117/255 (45.88%), Query Frame = 3
Query:  339 ELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLD------RG---GGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNP---------DVHTVCSLLKLYLRELPEPLIPFSNYDSLK--AVGYRIDANENLD---LVKEKLRLLPVPNHQLLKYLCTFLTEVASH-SENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFE 1031
            +++ +N ++Y + T    +  +WI  +K S          +G     +FG PL  V    + E   +P I+ +  + I   GL E G++R  G +  +  ++   D      DN          +V+ +    K+YLRELP+ L   +  +     A+ Y+  A  N +   ++ E L+ LP   +Q LK +   L +V  H   N+M+ S+LA +FS + +  +D    +     +V T+ +  FIK+ +D F+
Sbjct: 1917 KIVMQNGHEYLIQTASSSDLTEWIKMIKASKRFSFHSKKYKGKTHNKIFGVPLEDVC---ERENTLIPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGAT-DNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQEDLANSMGSRLGAVQTI-LQDFIKNPNDYFK 2166          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 70.4774 bits (171), Expect = 3.791e-13
Identity = 58/201 (28.86%), Postives = 95/201 (47.26%), Query Frame = 3
Query:  432 YLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIR--EYGLKEEGIFRKNGQLSLVMQMRELVD----RANYEWDN----PDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRL---------------------LPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRD 938
            YLD G  L+G+ L   +     E N +P I+  C  +I   E  ++ EGI+RK+G   ++ ++ +       + N E  N     D++ V  +LK YLR+LP P+  F  Y+ L  +       ENL  V  KL L                     LP  ++++L+ L   + +V  +S  NRM + +LA +F+P ++RD
Sbjct:  782 YLD-GSNLYGSSL---VARCNYENNEIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLIRD 978          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 68.5514 bits (166), Expect = 1.238e-12
Identity = 48/168 (28.57%), Postives = 84/168 (50.00%), Query Frame = 3
Query:  456 FGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDR--ANYEWDNP-------DVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASH-SENRMEISSLAKIFSPNI 929
            FG PL  ++   + E + VP I+ +C   I ++GL +EGI+RK+  +  V +++E +D+  AN     P       D++ V SLLK +   LP+ ++P +    +K      D     + +   +  LP   +  L+ L   L  V +H ++NRM + +L  I+ P I
Sbjct:  470 FGVPLESLI---EFEQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTI 634          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Yeast
Match: BAG7 (Rho GTPase activating protein (RhoGAP); stimulates the intrinsic GTPase activity of Rho1p, which plays a bud growth by regulating actin cytoskeleton organization and cell wall biosynthesis, resulting in the downregulation of Rho1p; structurally and functionally related to Sac7p; BAG7 has a paralog, SAC7, that arose from the whole genome duplication [Source:SGD;Acc:S000005660])

HSP 1 Score: 65.855 bits (159), Expect = 5.215e-12
Identity = 55/186 (29.57%), Postives = 86/186 (46.24%), Query Frame = 3
Query:  447 GGLFGTPLRLVLPHLKEEY---------NYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRA-----NYE-WDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKL--------RLLPVPNHQLLKYLCTFLTEVA-SHSENRMEISSLAKIFSPNIL 932
            G +FG  L   L   +EE            +P +I +  +Y++E  L   GIFR  G    V +++ +  +       +E W + +VH + +LLK YL  L EPL+P + YD  +     I  N  ++  KE++         LLP  N  L+ YL   L   A +  +N M  S+LA I  P++L
Sbjct:   45 GKVFGVSLEESLKVAQEEVIIQKSTNEIGSIPVVIAKSGKYLKENALDTTGIFRIAGSNKRVRELQAVFSKPPDYGRKFEGWCDFNVHDIATLLKRYLNSLSEPLVPLALYDIFRNP---ILENPKINEHKEQIIKDYEDIYMLLPQQNRHLILYLAALLNLFARNEKKNLMSASNLAAIVQPSLL 227          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 66.6254 bits (161), Expect = 5.625e-12
Identity = 61/206 (29.61%), Postives = 98/206 (47.57%), Query Frame = 3
Query:  432 YLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIR--EYGLKEEGIFRKNGQLSLVMQMR-ELVDRANYEWD----------NPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEK---------------------LRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQD 944
            Y   G  L+G+ L+    +   E + VP II  C   I   + GL  EG++RK+G  +LV ++  E     +   D          N D+H V S+LK YLR+LP+P++ FS YD+L  +       E L L  +K                      ++LPV + ++LK L   + +V   SE N M + +L+ +F+P+++ D D
Sbjct:  778 YTPDGSHLYGSSLQARCAY---EKSTVPIIIRCCIDRIEKDDIGLNMEGLYRKSGSQTLVEEIENEFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLIHDFD 980          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Nematostella
Match: EDO49792 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFW5])

HSP 1 Score: 116.701 bits (291), Expect = 5.340e-30
Identity = 68/208 (32.69%), Postives = 113/208 (54.33%), Query Frame = 3
Query:  132 NWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKAN-SEFNFSILPEIGKEL--INENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPL-RLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYE--WDNPDVHTVCSLLKLYLRELPEPLIPFSNYD 737
             WL+K+GG FKTLR R+F +  + LYY+ +++     G + L   E+     D  +   + F I+    +E   +  +H  + +  +  +E  +WI  + + +Y   GGG+FG  L   V    ++   +VP ++  C +YI++YGL+EEG+FR  G    +  ++   +R       D  D+HTV SLLKLYLREL EP+IP+  ++
Sbjct:    2 GWLRKEGGSFKTLRSRWFEIKGDQLYYYKDKSDPRPAGVVPLAGNEVIRHSPDPMDPGNYKFEIVSGKNREGRPVVGSHETFVMIASTMEEMDRWIGAINRIIYKPYGGGMFGGDLCETVKFEARKGGGFVPIVVDVCIEYIKKYGLEEEGLFRLPGNAKHISTLKAQFNRGESPELSDEKDIHTVASLLKLYLRELSEPVIPYDFFE 209          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Nematostella
Match: EDO47842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY9])

HSP 1 Score: 110.153 bits (274), Expect = 1.981e-25
Identity = 76/215 (35.35%), Postives = 120/215 (55.81%), Query Frame = 3
Query:  435 LDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDR-ANYEWDNPDVHTVCSLLKLYLRELPEPLIP---FSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDT-DPYVEES-TNSVITVTVAAFIKSHDDLFEFEYEPLSKY 1058
            ++ G   FG PL  V      + + +P ++ +   Y+ + GLK EGIFR +G   +V  ++   DR  + + +  DV  V  LLKL+LRELPEP +P    +++  +  V Y  D  + LD ++  L  LP  N++LLK+LC FL EV+ + E N+M   +LA +F PN  R +D  D   E+  TNS++ +    F+K +D LF+ E + +S Y
Sbjct:   96 VNTGNKQFGVPLEEVT--KSRDGSPIPWVLAKIVHYLSQCGLKHEGIFRVSGNHKVVESLKATFDRDGDADLEECDVMAVAGLLKLFLRELPEPPVPQALTTDFIKVHEV-YGDDNPDCLDELRALLDKLPYLNYELLKFLCHFLVEVSMNEENNKMSTMALAIVFGPNFFRCKDGLDGLREQGHTNSIVCM----FLKEYDQLFKDEGDEISPY 303          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Nematostella
Match: EDO47995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ0])

HSP 1 Score: 105.145 bits (261), Expect = 2.794e-24
Identity = 64/196 (32.65%), Postives = 99/196 (50.51%), Query Frame = 3
Query:  453 LFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWD--NPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNIL-RDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            +FG PL     HLK +   +  ++ EC  Y+ E  L+E+G+FR  G    + +++   D    +    + DVH +  +LK YLRELPEPL+ F+ YD         D+   L      +  LP  N   L+YL  FL ++A +SE N+M  S++A + +PNI+  +QDT   +      V +  V A I+ H   F
Sbjct:  252 VFGCPLE---EHLKVQRRSIAFVLEECLTYLHEEALQEQGLFRMAGSSGKIRKLKAAFDAGMVDLTEFDCDVHAITGVLKQYLRELPEPLMTFALYDDWIQAASIQDSGARLQAYWGLVDKLPKANKDNLRYLICFLGKLADYSEVNKMTASNIAIVIAPNIIYSEQDTSDAINLHHTGVQSSIVEALIQHHSWFF 444          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Nematostella
Match: EDO46865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI7])

HSP 1 Score: 89.7373 bits (221), Expect = 6.243e-19
Identity = 61/200 (30.50%), Postives = 105/200 (52.50%), Query Frame = 3
Query:  510 VPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRAN------YEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKE---KLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILR---DQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSKYDGDS 1070
            +P ++  C ++I+ +GL   GIFR +G  + +  M++L +           W   D++ V  LL++Y REL +PL P S+Y        R   NE  D++++    +  LP   ++++KYL  FL +V+ HSE N+M+  +LA +F P +LR   +QD   Y +   N ++ V     IK++D +F     P + +D D 
Sbjct:  441 IPEVVESCVRFIKRFGLDHPGIFRLSGSSTDINDMKQLFECGRDPLAGLNHW--KDINAVAGLLRVYFRELEDPLFPSSHYQQFIEAS-RFPTNE--DVIRQVTCVINELPDSVNRVMKYLFKFLKQVSEHSEQNKMDAHNLAVVFGPTLLRIPSEQDMITY-QSHVNGMMEV----IIKNYDQVF-----PQNDFDTDG 625          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 89.7373 bits (221), Expect = 8.268e-19
Identity = 58/167 (34.73%), Postives = 85/167 (50.90%), Query Frame = 3
Query:  450 GLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDR----ANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILR 935
            G+FG  +  V      E   +P I+  C + I + GL+E GI+R +G  S V +++E  D     A       D+H V  L K+YLR+LPEPL     YD         DA E  + + E  + LP PN     YL   L +VA  SE ++M +++L+ +F PN+LR
Sbjct:  608 GVFGVDIETVT---SRESCDIPLIVIGCVREIEKRGLEEVGIYRLSGASSDVKRLKEGFDENSQSALVLVSEADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMADAEEKRETMLELFQSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLR 771          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Medaka
Match: arhgap24 (Rho GTPase activating protein 24 [Source:NCBI gene;Acc:101171426])

HSP 1 Score: 201.83 bits (512), Expect = 5.371e-56
Identity = 110/323 (34.06%), Postives = 180/323 (55.73%), Query Frame = 3
Query:   84 GREPQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKI-XXXXXXXXXXXXDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            G +P++  +   +I C WL+KQGG  KT   R+FVL  + LYY+ ++ ++   G I    N             +F F ++P   +E +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + +   N   P ++ +C  +IR++GL+EEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IPF  Y+   A    I  ++ + +  +K  +  LP  N+ LLKY+  FL EV S+S  N+M + +LA +F PNI+R +  DP        ++   +A  I  HD LF
Sbjct:   15 GGQPRSEAQRSTVIRCGWLRKQGGFVKTWHTRWFVLRGDQLYYYKDEEETKALGAIFLPGNKVTEHTTSGDEGGKFIFEVIPGADRERMTANHETYLLMASTQNDMEDWVKTIRRVIWAPFGGGIFGQKLEETVRYERRFGNKLAPMLVEQCVDFIRQWGLREEGLFRLPGQANLVKELQDAFDCGEKPSFD-GNTDVHTVASLLKLYLRELPEPVIPFHKYEEFLACSKLIGKDDEMGVKQLKTLVEGLPPVNYNLLKYISRFLDEVQSYSGVNKMSVQNLATVFGPNIMRPKIEDPVTIMEGTVLVQQLMAVMIGRHDVLF 336          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Medaka
Match: arhgap24 (Rho GTPase activating protein 24 [Source:NCBI gene;Acc:101171426])

HSP 1 Score: 187.578 bits (475), Expect = 8.082e-51
Identity = 110/354 (31.07%), Postives = 182/354 (51.41%), Query Frame = 3
Query:   84 GREPQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKI-XXXXXXXXXXXXDKANSEFNFSILPEI-------------------------------GKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN-YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVD---RANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDL--VKEKLRLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            G +P++  +   +I C WL+KQGG  KT   R+FVL  + LYY+ ++ ++   G I    N             +F F ++P++                                +E +  NH  Y L  + +++ + W+  +++ ++   GGG+FG  L   + + +   N   P ++ +C  +IR++GL+EEG+FR  GQ +LV ++++  D   + +++  N DVHTV SLLKLYLRELPEP+IPF  Y+   A    I  ++ + +  +K  +  LP  N+ LLKY+  FL EV S+S  N+M + +LA +F PNI+R +  DP        ++   +A  I  HD LF
Sbjct:   15 GGQPRSEAQRSTVIRCGWLRKQGGFVKTWHTRWFVLRGDQLYYYKDEEETKALGAIFLPGNKVTEHTTSGDEGGKFIFEVIPDMMSDGGFQFRQNTFFLFRHAVFESGCTFGTGADRERMTANHETYLLMASTQNDMEDWVKTIRRVIWAPFGGGIFGQKLEETVRYERRFGNKLAPMLVEQCVDFIRQWGLREEGLFRLPGQANLVKELQDAFDCGEKPSFD-GNTDVHTVASLLKLYLRELPEPVIPFHKYEEFLACSKLIGKDDEMGVKQLKTLVEGLPPVNYNLLKYISRFLDEVQSYSGVNKMSVQNLATVFGPNIMRPKIEDPVTIMEGTVLVQQLMAVMIGRHDVLF 367          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Medaka
Match: si:dkey-191m6.4 (Rho GTPase activating protein 22 [Source:NCBI gene;Acc:101159226])

HSP 1 Score: 175.637 bits (444), Expect = 4.911e-47
Identity = 107/318 (33.65%), Postives = 167/318 (52.52%), Query Frame = 3
Query:  114 EDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKI--XXXXXXXXXXXXDKANSEFNFSILPE-IG-KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKE-EYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDAN--ENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHS-ENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFE 1037
            E  +   WLKKQ    K  + R+FVL  + L+++ ++ ++  +G I      +       D+      F I+P   G K+    +H    L  N + +   W+  +++ ++   GGG+FG  L   + + K+      P ++ +C  +IRE GL EEG+FR  GQ +LV +++E  D  +      N D+HTV SLLKLYLRELPEP+IPF  Y+        +  N  E +  + +++  LP PN+ LLKY+C FL EV SHS EN+M + +LA +F PNILR +  DP       S++   +   I+ H  L+  E
Sbjct:   27 EGALKAGWLKKQRSIMKNWQLRWFVLRSDQLFFYKDEEETKPQGCIPLQGCQVNELAANPDEPGRHL-FEIVPGGTGEKDRTPISHESVLLMANSQTDMDDWVKAIRRVIWAPFGGGIFGQRLEDTVQYEKKFGPRLAPLLVEQCVDFIRERGLDEEGLFRMPGQANLVKELQEAFDCGDKPLFDSNTDIHTVASLLKLYLRELPEPVIPFYQYEDFLTCAQLLAKNEEEGVQELGKQVGTLPQPNYNLLKYICKFLDEVQSHSNENKMSVQNLATVFGPNILRPKMEDPVSLMEGTSLVQHLMTVLIREHKRLYTRE 343          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Medaka
Match: si:dkey-191m6.4 (Rho GTPase activating protein 22 [Source:NCBI gene;Acc:101159226])

HSP 1 Score: 175.252 bits (443), Expect = 1.303e-46
Identity = 107/318 (33.65%), Postives = 167/318 (52.52%), Query Frame = 3
Query:  114 EDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKI--XXXXXXXXXXXXDKANSEFNFSILPE-IG-KELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKE-EYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDAN--ENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHS-ENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFE 1037
            E  +   WLKKQ    K  + R+FVL  + L+++ ++ ++  +G I      +       D+      F I+P   G K+    +H    L  N + +   W+  +++ ++   GGG+FG  L   + + K+      P ++ +C  +IRE GL EEG+FR  GQ +LV +++E  D  +      N D+HTV SLLKLYLRELPEP+IPF  Y+        +  N  E +  + +++  LP PN+ LLKY+C FL EV SHS EN+M + +LA +F PNILR +  DP       S++   +   I+ H  L+  E
Sbjct:  110 EGALKAGWLKKQRSIMKNWQLRWFVLRSDQLFFYKDEEETKPQGCIPLQGCQVNELAANPDEPGRHL-FEIVPGGTGEKDRTPISHESVLLMANSQTDMDDWVKAIRRVIWAPFGGGIFGQRLEDTVQYEKKFGPRLAPLLVEQCVDFIRERGLDEEGLFRMPGQANLVKELQEAFDCGDKPLFDSNTDIHTVASLLKLYLRELPEPVIPFYQYEDFLTCAQLLAKNEEEGVQELGKQVGTLPQPNYNLLKYICKFLDEVQSHSNENKMSVQNLATVFGPNILRPKMEDPVSLMEGTSLVQHLMTVLIREHKRLYTRE 426          
BLAST of Rho GTPase activating protein 24 vs. Ensembl Medaka
Match: si:dkey-191m6.4 (Rho GTPase activating protein 22 [Source:NCBI gene;Acc:101159226])

HSP 1 Score: 160.614 bits (405), Expect = 8.151e-42
Identity = 87/234 (37.18%), Postives = 131/234 (55.98%), Query Frame = 3
Query:  354 NHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKE-EYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEW--DNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDAN--ENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHS-ENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFE 1037
            +H    L  N + +   W+  +++ ++   GGG+FG  L   + + K+      P ++ +C  +IRE GL EEG+FR  GQ +LV +++E  D  +      N D+HTV SLLKLYLRELPEP+IPF  Y+        +  N  E +  + +++  LP PN+ LLKY+C FL EV SHS EN+M + +LA +F PNILR +  DP       S++   +   I+ H  L+  E
Sbjct:   91 SHESVLLMANSQTDMDDWVKAIRRVIWAPFGGGIFGQRLEDTVQYEKKFGPRLAPLLVEQCVDFIRERGLDEEGLFRMPGQANLVKELQEAFDCGDKPLFDSNTDIHTVASLLKLYLRELPEPVIPFYQYEDFLTCAQLLAKNEEEGVQELGKQVGTLPQPNYNLLKYICKFLDEVQSHSNENKMSVQNLATVFGPNILRPKMEDPVSLMEGTSLVQHLMTVLIREHKRLYTRE 324          
BLAST of Rho GTPase activating protein 24 vs. Planmine SMEST
Match: SMESG000036427.1 (SMESG000036427.1)

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 517/518 (99.81%), Postives = 517/518 (99.81%), Query Frame = 3
Query:   66 MRRNITGREPQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKIXXXXXXXXXXXXDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSKYDGDSRYTDEDSYSLKSALSYINCATLLSPNDDSSKSTDSISRMKNSPTRVQSMIIINDNLSNAFELTRSQDTVLNTVPRPKLELTDFSEKTPILPKKFSLSNGTPVNKDNGCTKFSCDQCRNFQNELNQITQDRDRVQKLLDKKSQTCKQLQEEISTLRTEFLILKQKTENNCDLSDVLDYFQINKR 1619
            MRRNITGREPQ LFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKISLKNLELSELEEDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSKYDGDSRYTDEDSYSLKSALSYINCATLLSPNDDSSKSTDSISRMKNSPTRVQSMIIINDNLSNAFELTRSQDTVLNTVPRPKLELTDFSEKTPILPKKFSLSNGTPVNKDNGCTKFSCDQCRNFQNELNQITQDRDRVQKLLDKKSQTCKQLQEEISTLRTEFLILKQKTENNCDLSDVLDYFQINKR
Sbjct:    1 MRRNITGREPQILFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYFANQTKSILKGKISLKNLELSELEEDKANSEFNFSILPEIGKELINENHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASHSENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFEFEYEPLSKYDGDSRYTDEDSYSLKSALSYINCATLLSPNDDSSKSTDSISRMKNSPTRVQSMIIINDNLSNAFELTRSQDTVLNTVPRPKLELTDFSEKTPILPKKFSLSNGTPVNKDNGCTKFSCDQCRNFQNELNQITQDRDRVQKLLDKKSQTCKQLQEEISTLRTEFLILKQKTENNCDLSDVLDYFQINKR 518          
BLAST of Rho GTPase activating protein 24 vs. Planmine SMEST
Match: SMESG000032128.1 (SMESG000032128.1)

HSP 1 Score: 95.9005 bits (237), Expect = 8.292e-21
Identity = 64/195 (32.82%), Postives = 104/195 (53.33%), Query Frame = 3
Query:  456 FGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRA---NYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVASH-SENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLF 1028
            F  PL  +L H       +P +I +   Y++ +GL+ EGIF ++     V +++E  D+    N+E D  D H    +LK++LR+L EPL+ F  YD +  +      N+ + + +  +  LP  N+++L YL TFLTEVA+H S+N M   SL  +F  N++  +     V  +T S I   V   I ++DD+F
Sbjct:  287 FEVPLSYILAH--NGGGSLPFVIQKTVTYLQIFGLEVEGIFLRSVSPDTVKRVKEKFDKGEDVNFE-DYGDPHVPAVILKIFLRQLTEPLLTFELYDEIVKIHNLPPKNKIIAIKRMIMDYLPDENYEVLNYLITFLTEVAAHSSQNHMTAISLGVVFGANLIWSKQL---VSLTTMSFINNFVQHLITNYDDIF 475          
BLAST of Rho GTPase activating protein 24 vs. Planmine SMEST
Match: SMESG000008305.1 (SMESG000008305.1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.012e-20
Identity = 68/193 (35.23%), Postives = 104/193 (53.89%), Query Frame = 3
Query:  456 FGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNP---DVHTVCSLLKLYLRELPEPLIPFSNYDSLKAV----GYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTE-VASHSENRMEISSLAKIFSPNILR-DQDTDPY-VEESTNSVITVTVAAF 1004
            FG  L+ ++   KEE+  VPRI+   C+++   GL+ EGIFR NG    V  ++ L +  NY  D     DV+ V S+LKL++RELP+ L+P     +L+ V     Y  +    ++  K  L LLP  N  LLKY+C FLT+ V   + N+M   +L  +F PNI R   D +   ++   N+++T  +  F
Sbjct:   31 FGISLKKLIE--KEEFAKVPRIVTNICEFLLINGLETEGIFRVNGNNKAVESIKLLFEE-NYSLDMSSYTDVYAVASVLKLFIRELPDGLVP--EKIALQFVEIFKKYLNNIENCIEEFKHLLSLLPQENFNLLKYICQFLTKIVEKETVNKMNGINLGIVFGPNIFRCSHDMEGLKLQSGMNNIMTCFIIHF 218          
BLAST of Rho GTPase activating protein 24 vs. Planmine SMEST
Match: SMESG000008305.1 (SMESG000008305.1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.395e-20
Identity = 68/193 (35.23%), Postives = 104/193 (53.89%), Query Frame = 3
Query:  456 FGTPLRLVLPHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNP---DVHTVCSLLKLYLRELPEPLIPFSNYDSLKAV----GYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTE-VASHSENRMEISSLAKIFSPNILR-DQDTDPY-VEESTNSVITVTVAAF 1004
            FG  L+ ++   KEE+  VPRI+   C+++   GL+ EGIFR NG    V  ++ L +  NY  D     DV+ V S+LKL++RELP+ L+P     +L+ V     Y  +    ++  K  L LLP  N  LLKY+C FLT+ V   + N+M   +L  +F PNI R   D +   ++   N+++T  +  F
Sbjct:   18 FGISLKKLIE--KEEFAKVPRIVTNICEFLLINGLETEGIFRVNGNNKAVESIKLLFEE-NYSLDMSSYTDVYAVASVLKLFIRELPDGLVP--EKIALQFVEIFKKYLNNIENCIEEFKHLLSLLPQENFNLLKYICQFLTKIVEKETVNKMNGINLGIVFGPNIFRCSHDMEGLKLQSGMNNIMTCFIIHF 205          
BLAST of Rho GTPase activating protein 24 vs. Planmine SMEST
Match: SMESG000052108.1 (SMESG000052108.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.242e-17
Identity = 62/200 (31.00%), Postives = 104/200 (52.00%), Query Frame = 3
Query:  453 LFGTPLRLVLPHLKEEYNY---VPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMR-ELVDRANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSNY-DSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVAS-HSENRMEISSLAKIFSPNILRDQDTDPYVEE-STNSVITVTVAAFIKSHDDLFE 1031
            ++G  L+L+L     E +Y   +P +I+    +IR YGL  +GIFR +G  + + +++   + +   E    D+H +  L KL+LRE+P  LIP+S   D +KA        ENLD +  +L  LPVP++ LLK+ C  LT V      N M   +L  +F P           +E+ S  ++   T +  I+++++LF+
Sbjct:   29 VYGKDLKLLL-----EISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIH-KKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTS------IEDFSLLTIANTTTSILIQNYNELFK 216          
The following BLAST results are available for this feature:
BLAST of Rho GTPase activating protein 24 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP243.245e-5735.87Rho GTPase activating protein 24 [Source:HGNC Symb... [more]
ARHGAP228.810e-4533.86Rho GTPase activating protein 22 [Source:HGNC Symb... [more]
ARHGAP221.013e-4433.86Rho GTPase activating protein 22 [Source:HGNC Symb... [more]
ARHGAP245.604e-4336.03Rho GTPase activating protein 24 [Source:HGNC Symb... [more]
ARHGAP249.478e-4336.48Rho GTPase activating protein 24 [Source:HGNC Symb... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tag-3256.144e-2034.13WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3254.199e-1934.13WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3254.658e-1934.13WW domain-containing protein tag-325 [Source:UniP... [more]
pac-17.008e-1835.15GTPase-activating protein pac-1 [Source:UniProtKB... [more]
rga-87.218e-1832.34Rho GTPase Activating protein [Source:UniProtKB/T... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CdGAPr2.116e-1936.08gene:FBgn0032821 transcript:FBtr0300967[more]
CdGAPr2.116e-1936.08gene:FBgn0032821 transcript:FBtr0300966[more]
CdGAPr2.154e-1936.08gene:FBgn0032821 transcript:FBtr0332179[more]
CdGAPr2.154e-1936.08gene:FBgn0032821 transcript:FBtr0081318[more]
RhoGAP5A2.841e-1932.56gene:FBgn0029778 transcript:FBtr0070785[more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap249.928e-5835.65Rho GTPase activating protein 24 [Source:ZFIN;Acc:... [more]
ARHGAP225.573e-5035.24si:dkey-191m6.4 [Source:ZFIN;Acc:ZDB-GENE-121214-1... [more]
arhgap228.358e-4935.47Rho GTPase activating protein 22 [Source:ZFIN;Acc:... [more]
arhgap245.995e-4536.95Rho GTPase activating protein 24 [Source:ZFIN;Acc:... [more]
arhgap241.472e-4437.04Rho GTPase activating protein 24 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP242.046e-5735.28Rho GTPase activating protein 24 [Source:NCBI gene... [more]
palm21.441e-3935.56paralemmin 2 [Source:Xenbase;Acc:XB-GENE-6039054][more]
svopl1.717e-3630.17SVOP like [Source:Xenbase;Acc:XB-GENE-994336][more]
svopl7.089e-3430.68SVOP like [Source:Xenbase;Acc:XB-GENE-994336][more]
palm22.616e-3033.80paralemmin 2 [Source:Xenbase;Acc:XB-GENE-6039054][more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgap241.777e-5635.96Rho GTPase activating protein 24 [Source:MGI Symbo... [more]
Arhgap221.120e-4533.65Rho GTPase activating protein 22 [Source:MGI Symbo... [more]
Arhgap241.003e-4337.55Rho GTPase activating protein 24 [Source:MGI Symbo... [more]
Arhgap241.003e-4337.55Rho GTPase activating protein 24 [Source:MGI Symbo... [more]
Arhgap241.003e-4337.55Rho GTPase activating protein 24 [Source:MGI Symbo... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N264|RHG24_HUMAN1.558e-5635.87Rho GTPase-activating protein 24 OS=Homo sapiens O... [more]
sp|Q8C4V1|RHG24_MOUSE1.194e-5535.96Rho GTPase-activating protein 24 OS=Mus musculus O... [more]
sp|Q5U2Z7|RHG24_RAT8.361e-5534.78Rho GTPase-activating protein 24 OS=Rattus norvegi... [more]
sp|Q8BL80|RHG22_MOUSE7.838e-4533.65Rho GTPase-activating protein 22 OS=Mus musculus O... [more]
sp|Q7Z5H3|RHG22_HUMAN4.231e-4433.86Rho GTPase-activating protein 22 OS=Homo sapiens O... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Y5S56.964e-7440.00Rho GTPase activating protein 24 OS=Echinococcus m... [more]
A0A068WII69.349e-7440.00Rho GTPase activating protein 24 OS=Echinococcus g... [more]
A0A5J4P3M82.331e-7134.91Rho GTPase-activating protein 22/24/25 OS=Paragoni... [more]
A0A4S2M4Z24.371e-7138.89Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M3Z27.144e-7038.89Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-191m6.43.121e-5135.35rho GTPase-activating protein 22 [Source:NCBI gene... [more]
ARHGAP222.508e-4735.93Rho GTPase activating protein 22 [Source:HGNC Symb... [more]
arhgap241.486e-4135.90Rho GTPase activating protein 24 [Source:ZFIN;Acc:... [more]
arhgap255.989e-3933.01Rho GTPase activating protein 25 [Source:ZFIN;Acc:... [more]
si:ch211-247j9.11.786e-3644.44si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001850.11.318e-3430.80pep scaffold:Pmarinus_7.0:GL478209:54363:80813:1 g... [more]
si:ch211-247j9.13.866e-3438.84si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
ENSPMAT00000004676.15.972e-2232.16pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-... [more]
ENSPMAT00000000404.12.580e-2035.64pep scaffold:Pmarinus_7.0:GL476366:629540:661972:1... [more]
ARHGAP153.214e-2029.31Rho GTPase activating protein 15 [Source:HGNC Symb... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BEM23.475e-1325.10Rho GTPase activating protein (RhoGAP); involved i... [more]
RGA13.791e-1328.86GTPase-activating protein for polarity-establishme... [more]
RGD11.238e-1228.57GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
BAG75.215e-1229.57Rho GTPase activating protein (RhoGAP); stimulates... [more]
RGA25.625e-1229.61GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO497925.340e-3032.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478421.981e-2535.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479952.794e-2432.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468656.243e-1930.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474418.268e-1934.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap245.371e-5634.06Rho GTPase activating protein 24 [Source:NCBI gene... [more]
arhgap248.082e-5131.07Rho GTPase activating protein 24 [Source:NCBI gene... [more]
si:dkey-191m6.44.911e-4733.65Rho GTPase activating protein 22 [Source:NCBI gene... [more]
si:dkey-191m6.41.303e-4633.65Rho GTPase activating protein 22 [Source:NCBI gene... [more]
si:dkey-191m6.48.151e-4237.18Rho GTPase activating protein 22 [Source:NCBI gene... [more]
back to top
BLAST of Rho GTPase activating protein 24 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036427.10.000e+099.81SMESG000036427.1[more]
SMESG000032128.18.292e-2132.82SMESG000032128.1[more]
SMESG000008305.16.012e-2035.23SMESG000008305.1[more]
SMESG000008305.16.395e-2035.23SMESG000008305.1[more]
SMESG000052108.11.242e-1731.00SMESG000052108.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017618 ID=SMED30017618|Name=Rho GTPase activating protein 24|organism=Schmidtea mediterranea sexual|type=transcript|length=1629bp
CGCCTATTTTAATTTTAGATATTTTATTAATTTACAAATTTTTATGATAA
TTCACCAATAATATTATGAGACGTAATATAACAGGCCGAGAACCACAAAA
TCTTTTTAAAAATGAAGATATAATTTATTGCAATTGGTTGAAAAAACAAG
GTGGCAAGTTTAAAACACTGAGGCGCCGATATTTTGTATTAGTCAAAAAT
GTTCTTTACTATTTTGCTAATCAAACGAAGAGTATTTTGAAAGGTAAAAT
AAGTTTAAAAAATCTTGAATTGTCCGAACTCGAAGAAGACAAAGCCAACT
CTGAATTCAATTTCAGTATTTTACCAGAAATTGGTAAAGAATTGATCAAC
GAAAATCATAATAAATACTTTCTCTCTACCAATGATAAAGATGAAGCTCA
AAAATGGATTTTCTATTTAAAACAGTCCATGTATTTAGATAGAGGAGGAG
GTTTATTTGGAACCCCCCTCCGACTTGTTTTGCCACATTTGAAAGAGGAG
TATAATTACGTACCAAGGATTATTCATGAATGTTGTCAGTACATTAGAGA
ATACGGATTAAAGGAAGAAGGAATTTTCAGGAAAAACGGTCAGCTAAGCT
TAGTGATGCAAATGAGAGAGCTAGTTGATCGAGCTAATTATGAATGGGAT
AACCCCGATGTTCATACAGTTTGTTCATTGTTGAAATTGTATCTAAGAGA
ACTGCCAGAGCCTTTGATTCCGTTTTCAAATTATGACAGTCTCAAAGCTG
TTGGTTATCGAATTGATGCTAATGAAAATCTCGATTTAGTCAAGGAAAAA
CTGAGGCTGCTTCCTGTTCCTAATCATCAACTTTTGAAGTACTTGTGCAC
ATTTCTTACTGAGGTTGCTAGTCACTCTGAAAACCGTATGGAGATATCCA
GTCTTGCAAAGATATTTTCTCCTAATATCTTGCGTGATCAAGATACTGAT
CCATACGTCGAAGAATCCACAAACAGTGTCATCACTGTTACAGTTGCTGC
TTTTATTAAGAGCCATGATGATTTATTTGAATTCGAATACGAGCCACTCA
GTAAGTATGATGGGGATTCAAGATACACAGACGAGGATTCCTATTCACTC
AAGAGTGCGCTTTCTTATATAAATTGTGCTACTCTTTTATCCCCAAATGA
CGATTCAAGCAAGAGTACGGATTCTATTTCAAGAATGAAGAACTCTCCGA
CACGCGTGCAATCCATGATAATTATTAATGATAATCTGTCAAATGCATTT
GAATTGACTCGTTCTCAAGACACAGTCTTAAATACAGTTCCTCGCCCAAA
GTTAGAGTTAACAGATTTTTCAGAAAAAACGCCGATTTTACCAAAAAAGT
TTTCGTTGTCTAACGGAACCCCTGTAAATAAGGATAATGGTTGTACAAAG
TTTTCATGTGATCAATGCAGAAATTTTCAGAATGAATTGAATCAGATAAC
TCAAGATCGAGATCGAGTGCAAAAATTACTTGACAAGAAATCACAGACTT
GTAAACAGCTTCAGGAAGAAATTTCCACTTTGAGAACTGAGTTTCTCATA
TTGAAACAAAAGACAGAAAATAACTGTGATTTATCAGATGTTTTAGATTA
TTTTCAGATTAATAAACGTTAAATATGTG
back to top

protein sequence of SMED30017618-orf-1

>SMED30017618-orf-1 ID=SMED30017618-orf-1|Name=SMED30017618-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MRRNITGREPQNLFKNEDIIYCNWLKKQGGKFKTLRRRYFVLVKNVLYYF
ANQTKSILKGKISLKNLELSELEEDKANSEFNFSILPEIGKELINENHNK
YFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYNYVP
RIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANYEWDNPDVH
TVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKLRLLP
VPNHQLLKYLCTFLTEVASHSENRMEISSLAKIFSPNILRDQDTDPYVEE
STNSVITVTVAAFIKSHDDLFEFEYEPLSKYDGDSRYTDEDSYSLKSALS
YINCATLLSPNDDSSKSTDSISRMKNSPTRVQSMIIINDNLSNAFELTRS
QDTVLNTVPRPKLELTDFSEKTPILPKKFSLSNGTPVNKDNGCTKFSCDQ
CRNFQNELNQITQDRDRVQKLLDKKSQTCKQLQEEISTLRTEFLILKQKT
ENNCDLSDVLDYFQINKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000198RhoGAP_dom
IPR001849PH_domain
IPR011993PH-like_dom_sf
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 451..499
NoneNo IPR availablePANTHERPTHR15228:SF24coord: 11..338
NoneNo IPR availablePANTHERPTHR15228FAMILY NOT NAMEDcoord: 11..338
NoneNo IPR availableCDDcd00159RhoGAPcoord: 150..308
e-value: 2.1245E-47
score: 160.16
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 17..123
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 147..318
e-value: 4.9E-54
score: 195.5
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 150..294
e-value: 1.3E-41
score: 142.0
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 133..321
score: 39.748
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 19..125
e-value: 2.3E-9
score: 47.1
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 20..122
e-value: 5.8E-17
score: 62.1
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 18..123
score: 14.141
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 13..122
e-value: 2.1E-19
score: 71.9
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 123..332
e-value: 2.7E-51
score: 175.7
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 130..321