Alpha-mannosidase

Overview
NameAlpha-mannosidase
Smed IDSMED30017604
Length (bp)3227
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-mannosidase (SMED30017604) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-mannosidase (SMED30017604) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-mannosidase (SMED30017604) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-mannosidase (SMED30017604) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017604

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017604SMESG000018139.1 dd_Smed_v4_8703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017604SMESG000018139.1 dd_Smed_v4_8703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2A1 (mannosidase alpha class 2A member 1 [Source:HGNC Symbol;Acc:HGNC:6824])

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 407/1061 (38.36%), Postives = 605/1061 (57.02%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRII--YFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL------KKDKIK-MFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYS--------------ERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNF--IEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPV--HQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEI-------PKLTIHRLKLNCYAGYISEGSCKFLRKKSP--LMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y  + F + DGGVWKQGF + Y   +     L+VFVVPHSH DPGW+KT ++YF+D TQ I N+M+  L ++   KFI +E+ Y  KWW+ I   +KD VK LI+N QLEIVTGGWVM DEAT HY ++I+QL +GH WL+NN+   P +GWAIDPFG+S  M YLL ++G+++M+IQRVHY +KK  A  K LEF W+Q WD  +   I CHMMPF+SYD+PHTCGPDP ICCQFDF R+    F CPWG  P  I   NV+ RA MLLDQYRKK+ L+     +L PLGDDFRY    EW +Q++NY +L DYMN Q ++ V+I+FG LSD+FD+L      ++DK + MFP LSGD F+YADR DHYW+GYFTSRPF K +DRI+ +HLRAAEI+   +L   +KYK      F  S L+  +  +RR L LFQHHDA+ GT+K  VVVD+  +L +++             +L+  IGNS F  I+ D     SYS              +   + N I +     RY+ ++N L Q R  LV + +   T    +++  +  + ++ Q++ ++  A   +   + +SF+ +I PL  +  +IL +  S+++ +   ++   +++S  F     +++E       + L+NS   L  +  TG ++ +        +++N+ F  YG    R+ SGAYLF+PDG      + +   +    G +Y EV       +H ++L+ + G+   ++++ NIVDIRK  N EI+M I +D +   + F+ D N +Q   R T  K+P+Q NVYPMT  +YI+    D+  ++ LLS QS GV         S++N   IEV +DR L QDDNRGL + + DN++ +  +R+L E     +S  N E  + +VS   L++ +   +  H +    N  +S    L G+ S L    LPCD HL+N +T  +++         L +HR   +C   + S+G+  F        L++ + +   ++ +   SLS            +I ++ M+I T+ +  
Sbjct:  131 MLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGWLKTFNDYFRDKTQYIFNNMVLKLKEDSRRKFIWSEISYLSKWWDIIDIQKKDAVKSLIENGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIGVKPRSGWAIDPFGHSPTMAYLLNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFRT-KVLLAPLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRDKGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAHKYKI---NKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLM------------VLEKIIGNSAFLLILKDKLTYDSYSPDTFLEMDLKQKSQDSLPQKNIIRLSAE-PRYLVVYNPLEQDRISLVSVYVSSPT----VQVFSASGKPVEVQVSAVWDTANTISETAYEISFRAHIPPLGLKVYKILESASSNSHLADYVLYKNKVEDSGIFTIKNMINTEEG-----ITLENSFVLLRFDQ-TGLMKQMMTKEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTCFFDHVTHRVRLYHIQGIEGQSVEVSNIVDIRKVYNREIAMKISSD-IKSQNRFYTDLNGYQIQPRMTLSKLPLQANVYPMTTMAYIQ----DAKHRLTLLSAQSLGV---------SSLNSGQIEVIMDRRLMQDDNRGLEQGIQDNKITANLFRILLEK----RSAVNTEEEKKSVSYPSLLSHITSSLMNHPVIPMANKFSSPTLELQGEFSPLQS-SLPCDIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCR--FSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQL 1143          
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2A2 (mannosidase alpha class 2A member 2 [Source:HGNC Symbol;Acc:HGNC:6825])

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 403/1057 (38.13%), Postives = 592/1057 (56.01%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKY----KYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISD---TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYG----------LPCDYHLINFKTNINE---IP----KLTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTY 3127
            M  + E L F + DGGVW+QGF + Y   D     L+VFVVPHSH DPGWIKT D+Y+ + TQ ILNSM+  L ++P  +F+ AEV +F KWW+ I+  ++  V++L+ N QLEI TGGWVM DEA +HY ++I+QL +GH WL+ NL  TP +GWA+DPFGYS  MPYLL+++ + +M+IQRVHY IKK  A++  LEF W+Q WDS++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ NV  RA +LLDQYRKK+ L+   N +LVPLGDDFRY   +EW  Q+ NY +L D+ N +   +V+ +FG LSDYFD+L K        +   FP LSGD FSYADR+DHYWTGY+TSRPF K LDR+L  HLR AE++ SL+  +  +     +Y LS     +LL E    +RRTL LFQHHDA+ GT+K  VVVD+  +LL ++   + V  +AA  ++  +     FD       VD+ +   +   +   I + ++  R+V LFN L Q R  +V   + V++ R  ++++    Q +  QI+  +  A E   + + VS  + +   A     +      D   T  SSV I+L+  + S++  + F +   +S  + +  L N   ++  +  TG ++ +  +  + + ++++    YG R S++ SGAYLF+PDGE           +   EG  + EVVA  +     ++L+ + G+   ++DI ++VDIR   N E+++ I TD +     FF D N FQ   R+   K+P+Q N YPM   +YI+    D+ +++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + L DN+     +RLL E          +  G    S  Q  +   YP     + + + N+    L   +  L G G          LPCD+HL+N +T   E   +P     L +HR   +C     + G +C   + K  L  S+F  + + ++   SL+    +       D+ +  M+I T+
Sbjct:  131 MLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLF-RSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDF---TLLTE----ARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSS-PRFVVLFNPLEQERFSMVS--LLVNSPR--VRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLP--ALGLGVLQLQLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDF-ALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEVVAYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELALHIHTD-IDSQGIFFTDLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQ----DAQKRLTLHTAQALGV---SSLKDGQ----LEVILDRRLMQDDNRGLGQGLKDNKRTCNRFRLLLE---------RRTVG----SEVQDSHSTSYPSLLSHLTSMYLNAPALALPVARMQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGLEAKNLGFNCTTSQGKVAL-GSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPMEIATF 1145          
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2A2 (mannosidase alpha class 2A member 2 [Source:HGNC Symbol;Acc:HGNC:6825])

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 403/1057 (38.13%), Postives = 592/1057 (56.01%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKY----KYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISD---TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYG----------LPCDYHLINFKTNINE---IP----KLTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTY 3127
            M  + E L F + DGGVW+QGF + Y   D     L+VFVVPHSH DPGWIKT D+Y+ + TQ ILNSM+  L ++P  +F+ AEV +F KWW+ I+  ++  V++L+ N QLEI TGGWVM DEA +HY ++I+QL +GH WL+ NL  TP +GWA+DPFGYS  MPYLL+++ + +M+IQRVHY IKK  A++  LEF W+Q WDS++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ NV  RA +LLDQYRKK+ L+   N +LVPLGDDFRY   +EW  Q+ NY +L D+ N +   +V+ +FG LSDYFD+L K        +   FP LSGD FSYADR+DHYWTGY+TSRPF K LDR+L  HLR AE++ SL+  +  +     +Y LS     +LL E    +RRTL LFQHHDA+ GT+K  VVVD+  +LL ++   + V  +AA  ++  +     FD       VD+ +   +   +   I + ++  R+V LFN L Q R  +V   + V++ R  ++++    Q +  QI+  +  A E   + + VS  + +   A     +      D   T  SSV I+L+  + S++  + F +   +S  + +  L N   ++  +  TG ++ +  +  + + ++++    YG R S++ SGAYLF+PDGE           +   EG  + EVVA  +     ++L+ + G+   ++DI ++VDIR   N E+++ I TD +     FF D N FQ   R+   K+P+Q N YPM   +YI+    D+ +++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + L DN+     +RLL E          +  G    S  Q  +   YP     + + + N+    L   +  L G G          LPCD+HL+N +T   E   +P     L +HR   +C     + G +C   + K  L  S+F  + + ++   SL+    +       D+ +  M+I T+
Sbjct:  131 MLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLF-RSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDF---TLLTE----ARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSS-PRFVVLFNPLEQERFSMVS--LLVNSPR--VRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLP--ALGLGVLQLQLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDF-ALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEVVAYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELALHIHTD-IDSQGIFFTDLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQ----DAQKRLTLHTAQALGV---SSLKDGQ----LEVILDRRLMQDDNRGLGQGLKDNKRTCNRFRLLLE---------RRTVG----SEVQDSHSTSYPSLLSHLTSMYLNAPALALPVARMQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGLEAKNLGFNCTTSQGKVAL-GSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPMEIATF 1145          
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2A2 (mannosidase alpha class 2A member 2 [Source:HGNC Symbol;Acc:HGNC:6825])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 325/777 (41.83%), Postives = 469/777 (60.36%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKY----KYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISD---TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTD 2341
            M  + E L F + DGGVW+QGF + Y   D     L+VFVVPHSH DPGWIKT D+Y+ + TQ ILNSM+  L ++P  +F+ AEV +F KWW+ I+  ++  V++L+ N QLEI TGGWVM DEA +HY ++I+QL +GH WL+ NL  TP +GWA+DPFGYS  MPYLL+++ + +M+IQRVHY IKK  A++  LEF W+Q WDS++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ NV  RA +LLDQYRKK+ L+   N +LVPLGDDFRY   +EW  Q+ NY +L D+ N +   +V+ +FG LSDYFD+L K        +   FP LSGD FSYADR+DHYWTGY+TSRPF K LDR+L  HLR AE++ SL+  +  +     +Y LS     +LL E    +RRTL LFQHHDA+ GT+K  VVVD+  +LL ++   + V  +AA  ++  +     FD       VD+ +   +   +   I + ++  R+V LFN L Q R  +V   + V++ R  ++++    Q +  QI+  +  A E   + + VS  + +   A     +      D   T  SSV I+L+  + S++  + F +   +S  + +  L N   ++  +  TG ++ +  +  + + ++++    YG R S++ SGAYLF+PDGE           +   EG  + EVVA  +     ++L+ + G+   ++DI ++VDIR   N E+++ I TD
Sbjct:  131 MLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLF-RSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDF---TLLTE----ARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSS-PRFVVLFNPLEQERFSMVS--LLVNSPR--VRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLP--ALGLGVLQLQLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDF-ALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEVVAYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELALHIHTD 891          
BLAST of Alpha-mannosidase vs. Ensembl Human
Match: MAN2A2 (mannosidase alpha class 2A member 2 [Source:HGNC Symbol;Acc:HGNC:6825])

HSP 1 Score: 532.332 bits (1370), Expect = 2.084e-174
Identity = 273/571 (47.81%), Postives = 370/571 (64.80%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKY----KYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQIN 1735
            M  + E L F + DGGVW+QGF + Y   D     L+VFVVPHSH DPGWIKT D+Y+ + TQ ILNSM+  L ++P  +F+ AEV +F KWW+ I+  ++  V++L+ N QLEI TGGWVM DEA +HY ++I+QL +GH WL+ NL  TP +GWA+DPFGYS  MPYLL+++ + +M+IQRVHY IKK  A++  LEF W+Q WDS++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ NV  RA +LLDQYRKK+ L+   N +LVPLGDDFRY   +EW  Q+ NY +L D+ N +   +V+ +FG LSDYFD+L K        +   FP LSGD FSYADR+DHYWTGY+TSRPF K LDR+L  HLR AE++ SL+  +  +     +Y LS     +LL E    +RRTL LFQHHDA+ GT+K  VVVD+  +LL ++   + V  +AA  ++  +     FD       VD+ +   +   +   I + ++  R+V LFN L Q R  +V   + V++ R  ++++    Q +  QI+
Sbjct:  131 MLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLF-RSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDF---TLLTE----ARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSS-PRFVVLFNPLEQERFSMVS--LLVNSPR--VRVLSEEGQPLAVQIS 688          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-2 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2PJ74])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 373/967 (38.57%), Postives = 539/967 (55.74%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXX-PHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYF--RCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYF---DSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAE------FNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRE---------TSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKV-DGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKE--FGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT 2890
            M  LY++  F + DGGVWKQG+K+EY  E VK +     +V PHSH DPGWI T +EY+   T+ IL+ M   L ++  M+FI+AE+ +FE WW   +   K +VK  ++  + EIVTGGWVMTDEA AHY SMI +L +GH W++N+L  +  P + W+IDPFG S  MP+LL  + I N VIQRVHY +K+ LA  K LEF W+Q + S     +  H+MPF+SYD+PHTCGP+PS+CCQFDF R+      C WG  P +I D+NV  RAEM+ DQYRKK+ L+ N N +  PLGDDFRY  + EW+ QY NY KL +YMN + EWNV  +FG LSDYF   D+      +  P+ SGD F+YADR DHYW+GYFTSRPF K LDR+L ++LR+AEI  +L+    N  + G+     ++ + EK+  +RR LSLFQHHD V GT+K HVV+D+  ++++A+   + + + A   +L  +  N         +D  +       +     I  N    V LFN+LS+ R     I I+VD+   G++   +   + K Q++P+    E        N    + F L++GP+     R+    + +T  S V I      N+  FK   + S ++S  +    +KN   +   +   G I+    L       LN  F  YGAR+S+           +GAYLF+PDGE   ++  S + I+  +GE+  +V A       IL+ + +  GL    ID++N VD+R + N+E+++   +  V   DEFF D N  Q I+R+   K+P Q N YPM+   YIE    D T ++ + S Q+ GV    ++  G     IE+ LDR L+ DDNRGL + + DN+     +R++ E      SG+ KE   G  +   +     L YP+ +M +      S+ S  V Q+       L CD HL+ F+T
Sbjct:  145 MLDLYDTWKFENPDGGVWKQGWKIEYDAEKVKSLPRLEVIVIPHSHCDPGWIMTFEEYYNRQTRNILDGMAKHLAEKDEMRFIYAEISFFETWWRDQADEIKKKVKGYLEAGKFEIVTGGWVMTDEANAHYHSMITELFEGHEWIQNHLGKSAIPQSHWSIDPFGLSPSMPHLLTSANITNAVIQRVHYSVKRELALKKNLEFYWRQLFGSTGHPDLRSHIMPFYSYDIPHTCGPEPSVCCQFDFRRMPEGGKSCDWGIPPQKINDDNVAHRAEMIYDQYRKKSQLFKN-NVIFQPLGDDFRYDIDFEWNSQYENYKKLFEYMNSKSEWNVHAQFGTLSDYFKKLDTAISASGEQLPTFSGDFFTYADRDDHYWSGYFTSRPFYKQLDRVLQHYLRSAEIAFTLA----NIEEEGMV----EAKIFEKLVTARRALSLFQHHDGVTGTAKDHVVLDYGQKMIDALNACEDILSEALVVLLGIDSTNK------MQMDEHRVNENLLPEKRVYKIGQN----VVLFNTLSRNRN--EPICIQVDSLDAGVE---ADPPIKKQQVSPVIAYDEEKKTLVVKNGIFELCFMLSLGPMESVSFRL----VKNTTTSKVEI---ITNNAAEFK---ETSFKSSSTSGDFTVKNDKVEAEFDGENGMIKRATSLVDDKPIDLNSHFIHYGARKSKRKFANGNEDNPAGAYLFLPDGEARELKKQSSDWIL-VKGEVVQKVFATPNNDLKILQTYTLYQGL--PWIDLDNEVDVRSKENFELALRFSSS-VNSGDEFFTDLNGMQMIKRRRQTKLPTQANFYPMSAGVYIE----DDTTRMSIHSAQALGV---SSLSSGQ----IEIMLDRRLSSDDNRGLQQGVRDNKRTVAHFRIVIEPMSS-SSGNKKEERVGFHSHVGHLATWSLHYPLVKM-IGDATPKSISSKNVEQE-------LNCDLHLVTFRT 1053          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-3 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:O01574])

HSP 1 Score: 422.935 bits (1086), Expect = 2.897e-130
Identity = 292/982 (29.74%), Postives = 496/982 (50.51%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK----DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIK----IMGSGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLF-IPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEP----LVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGL--PCDYHLINFKTNINEIPKLTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPE 3091
            P +H+DPGW++T + Y K   Q IL++M  F++K   M+F+ AE V+FE+WW+  ++  K+ VKKL+   +LE+ TG WVMTDEA  ++   ++ + +G  ++  N    P T W+ DPFGYS  +PYL KKSG++  VI R+H+ +K+ L S K + F+W+Q++D+  +  +   ++P+  YD+ ++CG D S+CC+FDF R+ ++ CP G  P +IT+ NV  +AE L++Q  K + +Y     +L+  GDDFR+   +EW+ Q+ N+I + D +NK     VEI+FG  +DYF+ L+K    +K    P++SGD F Y      YWTGY+T+RPF K   R+L + +R  +I+LS+  +   + K G +         ++++ +RR L+LFQHHDA+ GTSK  V+ ++ ++LL+A        +  +  I+  N+  S       D+D      +       + ++++ E+ + +FNS         H+    D  +I +K    I+    ++I+ Q+ P FQ ++   +   + F+  + PL+  +V++   G S        I   +  N+ +   ++ ++S  S  N    L+    K+  +  TG I+ V  L   SK+    +F  Y         GAYL  +      IIE+  L       G L   +  ++      L +  V+G     +DI   +DI KE N E+     T +  P    + DS   Q +RR  F K+P+Q N YPM  A+ ++S      +++ ++S   +G R  ++         +E+ +DRILNQDD +GL        +D + V   ++L+F D  +    +N  +   +  + Q +  +IYP   MF      N  P      + +     L  PCD  L+  +   +    L ++R    C +  +  G+C    K S  +  +   +  K V K  LSG   +G  +K E
Sbjct:  143 PFTHVDPGWLETFERYTKSTNQ-ILDNMHQFMMKNEKMRFMWAEFVFFERWWSLQNEQVKEDVKKLVTEGRLELATGSWVMTDEANPYFPVSVDNIVEGFQFIHKNFGIKPQTMWSNDPFGYSNSVPYLFKKSGVHRTVINRIHHKLKQTLQSQKAIPFKWRQYFDATGEDDVLTQILPYTHYDILNSCGSDASVCCEFDFKRMTHWSCP-GPKPEKITNANVAAKAEKLVNQLEKMSEMY-KAPVILMMHGDDFRFDMIEEWNQQHDNFIPVFDEINKGSR--VEIRFGTFTDYFNDLEKWYSNNKDSEPPTVSGDFFPYMCALGDYWTGYYTTRPFFKRQGRLLHSLIRNGDIMLSMLRVNLKQRKIGENV--------KRLEAARRNLALFQHHDAITGTSKVSVMDNY-SELLHA--------SIVSTNIVLENLTKS-------DIDLYPRIHDGIELQTIVDLESS-EKEIRIFNS---------HLFEITDVFKIRVKEREVIVSIDGKIIEAQLEPFFQKSKVEKDSFLLLFQATVLPLSMMKVKV-QRGDSGGLTKMAKIEAKDT-NAWDLGSSWTIASSTSAPN----LETPYFKVSNDPITGAIQSVNKLSDNSKFHCQQSFYNY----KEAGGGAYLMRLHTNPKEIIEYQWLKV----SGPLRQSIYQKSTNVLQRLSIHNVEGPSGEEVDISMSIDITKERNTELMTRFSTKWDKPLT--YTDSVGMQLLRRD-FYKLPVQSNYYPMPTAAVLQS----GKQRLSIVSNVEHGARFLES-------GTVEINIDRILNQDDGKGLGTGPDAIPIDMKPVDMKFKLIF-DSLESDPTENSRYSTHSFRAQQAVQTIIYP-PMMF------NRPPKKEEDIEEIEEISNLKFPCDIQLLTVRPLEDNKQLLILYRHATVCSSQKV--GNCGGELKSS--LMDLLIKLGAKQVQKTDLSGVTRVGGIIKVE 1045          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-1 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q20829])

HSP 1 Score: 223.402 bits (568), Expect = 5.593e-60
Identity = 227/851 (26.67%), Postives = 375/851 (44.07%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYF---KDDTQP-----ILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWD-SENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPV----EITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLS---GDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEK-IDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF---VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSR--ETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLF-SHILKLFKVDGLLSHTIDIENIVD-IRKESNYEISMVIKTDF---VAPSDEFFVDSNCFQFIRR--------KTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPL 2632
            PH+H D GWIKTVD+YF   K +  P     I N+++D L+K P+ +F  AE  +  +W+ + S   + Q++KL+KN Q+EI+ GGWV  DEAT+HY  +I+Q+  G   L+        P TGW IDPFG+S+ M  + ++ G +++   R+HY+ K+    +K LEF W    D ++NK         FF+       GP    C  +D +      C  G+DP+     I   NVK + +  +D  + +A  + + N V++ +G DF+Y     W   Y N  KL+ Y+N      V + +   + Y  +++       P+LS    D F YA  +  YWTGYFTSRP  K +       +R A  +L L+          L  + N     +  I+  R   +L QHHDAV GT+K +V  D++ QL   +   + V     +++  + +            D         N+     I  + E  V +FNS  +     + IP    T      +  +   +++ QI   FQ+ +  +       +   + + PL +  V +      +       +H  N       +K F  + E  + N+Y++            + GY+  + +  +K K  +   F  Y    S+  + SGAY+F P  +  I     L   V   G + +EV  +   F S  ++L +      + I+ E IV  I KE+   I+    T +   V   ++ F DSN  Q + R        +  D  PI GN YP+T   YI+    D   +  +++ ++ G+     +        +E+ L R    DD+ G+ E L
Sbjct:   42 PHTHDDLGWIKTVDQYFWGAKPELVPVGVQYIYNTVIDELLKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQNDEATSHYVDIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIHYLEKQIRLKNKTLEFMWNTSDDITDNKLFTGA----FFN----DNYGPPEGFC--WDSL------C--GDDPIMDNLNIEGYNVKEKVDAFVDHVKNQA-AHQSTNQVMLLMGSDFQYTNANSW---YVNLDKLIKYVNADTSKKVRVIYSTPACYTKAVQAKT----PTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGM-------IRQASCMLQLA--------KQLDVIANLGPEDDSDIEILREASALVQHHDAVTGTAKENVTRDYEKQLAKGVSEVEVVINDFMKKMNPDGL------------DPKLVLCPLINETICKPINGSSEFSVVIFNSNGRYFNGTIRIPYSQKT----AVLRDAHKNVLESQIVETFQIDQLKDTDRLPYEIHVFVRVPPLGYTTVFV------EKGSKPERVHFNN-------RKKFNTNVE--IQNEYLIAG--------FDSQGYLSYITEKATKKKRSIRQEFFYYEGIDSKDDQPSGAYIFRPKTQQPIALTSKLALEV-VPGAIINEVRQKVSPFVSQQIRLPRG----KNYIEFEWIVGPIPKETKNPITKEFVTRYTTEVHSKNQSFTDSNGRQAMERFFDGATSFEYSDTEPIAGNYYPITSFGYIK----DENAQFSVITDRAQGMVASDGV--------VEIMLHRRCFYDDHFGVEEAL 795          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-1 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q20829])

HSP 1 Score: 223.402 bits (568), Expect = 5.593e-60
Identity = 227/851 (26.67%), Postives = 375/851 (44.07%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYF---KDDTQP-----ILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWD-SENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPV----EITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLS---GDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEK-IDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF---VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSR--ETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLF-SHILKLFKVDGLLSHTIDIENIVD-IRKESNYEISMVIKTDF---VAPSDEFFVDSNCFQFIRR--------KTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPL 2632
            PH+H D GWIKTVD+YF   K +  P     I N+++D L+K P+ +F  AE  +  +W+ + S   + Q++KL+KN Q+EI+ GGWV  DEAT+HY  +I+Q+  G   L+        P TGW IDPFG+S+ M  + ++ G +++   R+HY+ K+    +K LEF W    D ++NK         FF+       GP    C  +D +      C  G+DP+     I   NVK + +  +D  + +A  + + N V++ +G DF+Y     W   Y N  KL+ Y+N      V + +   + Y  +++       P+LS    D F YA  +  YWTGYFTSRP  K +       +R A  +L L+          L  + N     +  I+  R   +L QHHDAV GT+K +V  D++ QL   +   + V     +++  + +            D         N+     I  + E  V +FNS  +     + IP    T      +  +   +++ QI   FQ+ +  +       +   + + PL +  V +      +       +H  N       +K F  + E  + N+Y++            + GY+  + +  +K K  +   F  Y    S+  + SGAY+F P  +  I     L   V   G + +EV  +   F S  ++L +      + I+ E IV  I KE+   I+    T +   V   ++ F DSN  Q + R        +  D  PI GN YP+T   YI+    D   +  +++ ++ G+     +        +E+ L R    DD+ G+ E L
Sbjct:   42 PHTHDDLGWIKTVDQYFWGAKPELVPVGVQYIYNTVIDELLKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQNDEATSHYVDIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIHYLEKQIRLKNKTLEFMWNTSDDITDNKLFTGA----FFN----DNYGPPEGFC--WDSL------C--GDDPIMDNLNIEGYNVKEKVDAFVDHVKNQA-AHQSTNQVMLLMGSDFQYTNANSW---YVNLDKLIKYVNADTSKKVRVIYSTPACYTKAVQAKT----PTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGM-------IRQASCMLQLA--------KQLDVIANLGPEDDSDIEILREASALVQHHDAVTGTAKENVTRDYEKQLAKGVSEVEVVINDFMKKMNPDGL------------DPKLVLCPLINETICKPINGSSEFSVVIFNSNGRYFNGTIRIPYSQKT----AVLRDAHKNVLESQIVETFQIDQLKDTDRLPYEIHVFVRVPPLGYTTVFV------EKGSKPERVHFNN-------RKKFNTNVE--IQNEYLIAG--------FDSQGYLSYITEKATKKKRSIRQEFFYYEGIDSKDDQPSGAYIFRPKTQQPIALTSKLALEV-VPGAIINEVRQKVSPFVSQQIRLPRG----KNYIEFEWIVGPIPKETKNPITKEFVTRYTTEVHSKNQSFTDSNGRQAMERFFDGATSFEYSDTEPIAGNYYPITSFGYIK----DENAQFSVITDRAQGMVASDGV--------VEIMLHRRCFYDDHFGVEEAL 795          
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Match: aman-1 (Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q20829])

HSP 1 Score: 223.402 bits (568), Expect = 5.593e-60
Identity = 227/851 (26.67%), Postives = 375/851 (44.07%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYF---KDDTQP-----ILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWD-SENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPV----EITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLS---GDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEK-IDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF---VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSR--ETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLF-SHILKLFKVDGLLSHTIDIENIVD-IRKESNYEISMVIKTDF---VAPSDEFFVDSNCFQFIRR--------KTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPL 2632
            PH+H D GWIKTVD+YF   K +  P     I N+++D L+K P+ +F  AE  +  +W+ + S   + Q++KL+KN Q+EI+ GGWV  DEAT+HY  +I+Q+  G   L+        P TGW IDPFG+S+ M  + ++ G +++   R+HY+ K+    +K LEF W    D ++NK         FF+       GP    C  +D +      C  G+DP+     I   NVK + +  +D  + +A  + + N V++ +G DF+Y     W   Y N  KL+ Y+N      V + +   + Y  +++       P+LS    D F YA  +  YWTGYFTSRP  K +       +R A  +L L+          L  + N     +  I+  R   +L QHHDAV GT+K +V  D++ QL   +   + V     +++  + +            D         N+     I  + E  V +FNS  +     + IP    T      +  +   +++ QI   FQ+ +  +       +   + + PL +  V +      +       +H  N       +K F  + E  + N+Y++            + GY+  + +  +K K  +   F  Y    S+  + SGAY+F P  +  I     L   V   G + +EV  +   F S  ++L +      + I+ E IV  I KE+   I+    T +   V   ++ F DSN  Q + R        +  D  PI GN YP+T   YI+    D   +  +++ ++ G+     +        +E+ L R    DD+ G+ E L
Sbjct:   42 PHTHDDLGWIKTVDQYFWGAKPELVPVGVQYIYNTVIDELLKNPDRRFSFAETGFLWRWYTSNSDFDRHQLQKLVKNGQIEIIGGGWVQNDEATSHYVDIIDQMTLGLQRLEQIFGECGKPVTGWQIDPFGHSREMANIYREMGYSSVYFARIHYLEKQIRLKNKTLEFMWNTSDDITDNKLFTGA----FFN----DNYGPPEGFC--WDSL------C--GDDPIMDNLNIEGYNVKEKVDAFVDHVKNQA-AHQSTNQVMLLMGSDFQYTNANSW---YVNLDKLIKYVNADTSKKVRVIYSTPACYTKAVQAKT----PTLSVKHDDFFPYASGRHSYWTGYFTSRPAFKGM-------IRQASCMLQLA--------KQLDVIANLGPEDDSDIEILREASALVQHHDAVTGTAKENVTRDYEKQLAKGVSEVEVVINDFMKKMNPDGL------------DPKLVLCPLINETICKPINGSSEFSVVIFNSNGRYFNGTIRIPYSQKT----AVLRDAHKNVLESQIVETFQIDQLKDTDRLPYEIHVFVRVPPLGYTTVFV------EKGSKPERVHFNN-------RKKFNTNVE--IQNEYLIAG--------FDSQGYLSYITEKATKKKRSIRQEFFYYEGIDSKDDQPSGAYIFRPKTQQPIALTSKLALEV-VPGAIINEVRQKVSPFVSQQIRLPRG----KNYIEFEWIVGPIPKETKNPITKEFVTRYTTEVHSKNQSFTDSNGRQAMERFFDGATSFEYSDTEPIAGNYYPITSFGYIK----DENAQFSVITDRAQGMVASDGV--------VEIMLHRRCFYDDHFGVEEAL 795          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: alpha-Man-IIa (gene:FBgn0011740 transcript:FBtr0334302)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 339/937 (36.18%), Postives = 530/937 (56.56%), Query Frame = 2
Query:   47 IINFNY*MTKLYESLDFTDNDGGVWKQGFKVEY-AMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYF--RCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL---KKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRIL-QNNIGNSQFDQIIFDVDNLK---SYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQL----------AEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQ-LKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTN 2794
            + N +  M +LY+ + F D DGGVWKQG+ ++Y  ++     KLKVFVVPHSH DPGWI+T +EY++ DT+ IL++ L  L   P MKFI AE+ YF ++++ + +N+K Q+K ++KN QLE VTGGWVM DEA +H+ +++ QL +G +WLK  +N TPT  WAIDPFG+S  MPY+L+KSG  NM+IQR HY +KK LA  +QLEF W+Q WD++   ++  HMMPF+SYD+PHTCGPDP +CCQFDF R+  F   CPW   P  I+D+NV  R+++L+DQ++KKA LY   N +L+PLGDDFR+K   EW +Q  NY +L +++N Q  +NV+ +FG L +YFD++   ++     FP+LSGD F+YADR D+YW+GY+TSRP+ K +DR+LM+++RAAE++ +    +H        +    + + E+++ +RR LSLFQHHD + GT+K HVVVD++ ++  A+K  Q V   +  R+L + +I +  F    F +D+ +   S  E       +       ++V + N+L   R+ LV   +        + +    N  ++ Q++P++             + +  ++ + FK  + P+      +L    S    +S   +L   KN  +               + + L+         S  G ++ ++         ++  F KYG R   + SGAYLF+P+G  S +E      +V  +G+L   V     L S + +     G      +I N+VDI    N EI M ++T  +   D F+ D N  QFI+R+  DK+P+Q N YP+    +IE    D+  ++ LL+ Q  G   G ++  G     +E+  DR L  DD RGL + ++DN+ V   YRL+ E     ++  +    G  T ++++    L+ P+ +     N
Sbjct:  102 VPNVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRT-NVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQAHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRAAEMLSA----WH--------SWDGMARIEERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVMQQSVYRLLTKPSIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHVVMHNTLPHWREQLVDFYVSSPF----VSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIFKARVPPMGLA-TYVLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREISLRVGNGPTLAFSEQGLLKSIQLTQDSPHVPVHFKFLKYGVRSHGDRSGAYLFLPNGPASPVELGQPVVLV-TKGKLESSVSV--GLPSVVHQTIMRGG----APEIRNLVDIGSLDNTEIVMRLET-HIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSGMFIE----DANTRLTLLTGQPLG---GSSLASGE----LEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVLEKVNNCVRPSELHPAGYLTSAAHKASQSLLDPLDKFIFAEN 1001          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: alpha-Man-IIa (gene:FBgn0011740 transcript:FBtr0082031)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 339/937 (36.18%), Postives = 530/937 (56.56%), Query Frame = 2
Query:   47 IINFNY*MTKLYESLDFTDNDGGVWKQGFKVEY-AMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYF--RCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL---KKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRIL-QNNIGNSQFDQIIFDVDNLK---SYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQL----------AEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQ-LKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTN 2794
            + N +  M +LY+ + F D DGGVWKQG+ ++Y  ++     KLKVFVVPHSH DPGWI+T +EY++ DT+ IL++ L  L   P MKFI AE+ YF ++++ + +N+K Q+K ++KN QLE VTGGWVM DEA +H+ +++ QL +G +WLK  +N TPT  WAIDPFG+S  MPY+L+KSG  NM+IQR HY +KK LA  +QLEF W+Q WD++   ++  HMMPF+SYD+PHTCGPDP +CCQFDF R+  F   CPW   P  I+D+NV  R+++L+DQ++KKA LY   N +L+PLGDDFR+K   EW +Q  NY +L +++N Q  +NV+ +FG L +YFD++   ++     FP+LSGD F+YADR D+YW+GY+TSRP+ K +DR+LM+++RAAE++ +    +H        +    + + E+++ +RR LSLFQHHD + GT+K HVVVD++ ++  A+K  Q V   +  R+L + +I +  F    F +D+ +   S  E       +       ++V + N+L   R+ LV   +        + +    N  ++ Q++P++             + +  ++ + FK  + P+      +L    S    +S   +L   KN  +               + + L+         S  G ++ ++         ++  F KYG R   + SGAYLF+P+G  S +E      +V  +G+L   V     L S + +     G      +I N+VDI    N EI M ++T  +   D F+ D N  QFI+R+  DK+P+Q N YP+    +IE    D+  ++ LL+ Q  G   G ++  G     +E+  DR L  DD RGL + ++DN+ V   YRL+ E     ++  +    G  T ++++    L+ P+ +     N
Sbjct:  101 VPNVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQTFEEYYQHDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKNGQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMPYILQKSGFKNMLIQRTHYSVKKELAQQRQLEFLWRQIWDNKGDTALFTHMMPFYSYDIPHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELYRT-NVLLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQAHFNVQAQFGTLQEYFDAVHQAERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRAAEMLSA----WH--------SWDGMARIEERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVMQQSVYRLLTKPSIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHVVMHNTLPHWREQLVDFYVSSPF----VSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKYRIIFKARVPPMGLA-TYVLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREISLRVGNGPTLAFSEQGLLKSIQLTQDSPHVPVHFKFLKYGVRSHGDRSGAYLFLPNGPASPVELGQPVVLV-TKGKLESSVSV--GLPSVVHQTIMRGG----APEIRNLVDIGSLDNTEIVMRLET-HIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSGMFIE----DANTRLTLLTGQPLG---GSSLASGE----LEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVLEKVNNCVRPSELHPAGYLTSAAHKASQSLLDPLDKFIFAEN 1000          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: alpha-Man-IIb (gene:FBgn0026616 transcript:FBtr0334593)

HSP 1 Score: 430.254 bits (1105), Expect = 2.860e-131
Identity = 340/1142 (29.77%), Postives = 537/1142 (47.02%), Query Frame = 2
Query:  119 WKQGFKVEYAME--DXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFW------DSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDY-MNKQKEWNVEIKFGILSDYFDSLK---KDKIKMFPSLSGDMFSYAD----RQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLS-TVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLL----NAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQ-TNGERYV----------------------YLFNSLSQPRQLLVHIPIEVDTERI---GIKIMG-SGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVH---IHLYNIK-NSMNFKKNFQV---------------------SSENSLLNKY------VVLKNSLKKLHINSTTGYIELVEDLYSKSK----YKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLN-----TIVHFEGELYDEV-VAENKLFSHILKLFKVDGLLSHTIDIENIVDIR-----KESNYEISMVIKTDFVA-----------PSDE--------FFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDN----KEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT----NINEIPK----LTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPE----------DICMNLMDIDTYAVHF 3139
            W +GF+  +  +  D ++  LK+ VVPHSH DPGW+KT   YF+ D++ ILN ++  + +  +M FI +E+ + + WW+     ++  +K+LI   ++EI TGGWVMTDEA  H   M++QL +GH WLKNNLN TP  GW+IDPFG+   +PYLL  +     +IQR+HY  K+  A  +  +F WK +W      DSE   S+  H MPF  Y +  +CGP P IC  FDF +I      +      ITD+N++ +A++LL+QY + A L+ + N  L+P+GDDFRY  ++E   QY+NY KL+D+ M  ++ +N +I+FG  SDYF+++K   KD    FP+  GD F Y+D     +  YW+GYFT+RPF K+L   L + LR+AEIV +L+     + K   +  ++ ++  +E I  +RR L LFQHHDA+ GTSKA V+ D+  +L     N +KM +       Q+    + G   F    F+ DN      +      + IQ  NG+                          L+NSL+Q R       +EV T R+    +KI+   G +L   QINP++ + +        S    +G     R+R         + + +    +  Y ++ + +NFK+N                        SS  S+          + L+N   +L  +  +G+++ +     K +     + NI F  Y  R ++  SGAYLF  D E S  E + L       I+   G +  +V V      +H +++F     L   I +EN +D       +E+   +  V   D +A           P D         F+ D N FQ+  R     I I+GN +P+T  ++I+    DS  ++ LL+  + G     +   G     +EV LDR    DD RG+ E +VD+ +    + LL ED   L  G +      +   +  + QL N L YP +  FV       + + L+    LL    LPCD HL   +T     +   P     L +HR   +C    +S G    +    PL      +V +  ++  ++    + G + K            +I +  M++ T+ + F
Sbjct:  148 WDRGFEERFDAQKKDKQRPPLKIIVVPHSHNDPGWLKTFTNYFQSDSRQILNLLVTKMQEYTDMTFIWSEISFLQLWWDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLKNNLNVTPKVGWSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGDFIWKPYWRSRKDKDSEAG-SLLTHNMPFDIYSIKGSCGPHPFICLNFDFRKIPGEYTEYSVKAQFITDDNLESKAQLLLEQYARTASLFPH-NVALIPVGDDFRYNKDREVDQQYQNYKKLIDHIMANRRLYNADIRFGTPSDYFEAIKERMKDHTPGFPTFKGDFFVYSDIFSEGRPAYWSGYFTTRPFYKLLSSELEHQLRSAEIVFTLAYNTARQAKRENAIKIYEKN--YELIINARRNLGLFQHHDAITGTSKAAVMRDYAMRLFESTQNMVKMQESCLELLLQKGQPRHHG---FLLSEFERDNFNKLPRK------MPIQMANGDESTPTVPAGEGGAGGSSSSGSVGSFVLYNSLAQKR-------LEVVTLRVQHPNVKIVNDKGVELNHIQINPVWNITDTYEQGLGTSVSGTVG-----RIRTSTRQFEVMFVAELEPLSLSTYRVQVDEVNFKRNIATIYCDDCTESQPASVSPPEEIESSPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELLKPLQCNIKFAAY--RSAQFHSGAYLFKTDPEQSEAEKEVLEGYTDMRIIITSGPIASDVTVIYGPFLAHTVRIFNTRTHLDAAIYVENDIDFEPPPKNRETELFMRFVTNIDNIAQAPMQRDPLKEPVDAATMPELPVFYSDQNGFQYHERIKVPAIGIEGNYFPITSGAFIQ----DSRLRLTLLTTHAQG---AASYEPGQ----LEVMLDRRTLYDDYRGMGEGVVDSRLTRHKFWLLVED---LPGGQHVTQPPSYKVLSQQAQQLANALRYPPNLYFVSNLEQPELAAALLPLVRLLPKGPLPCDVHLTTLRTLSDPELQLFPSASALLVLHRQGFDC---SVSAGRELSMEAICPLSSKGLGNVQLGRLSLHTIEATSLTGTEQKSSRESYHIRSLAEISLEPMELRTFNLTF 1245          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: alpha-Man-IIb (gene:FBgn0026616 transcript:FBtr0345238)

HSP 1 Score: 430.254 bits (1105), Expect = 2.860e-131
Identity = 340/1142 (29.77%), Postives = 537/1142 (47.02%), Query Frame = 2
Query:  119 WKQGFKVEYAME--DXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFW------DSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDY-MNKQKEWNVEIKFGILSDYFDSLK---KDKIKMFPSLSGDMFSYAD----RQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLS-TVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLL----NAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQ-TNGERYV----------------------YLFNSLSQPRQLLVHIPIEVDTERI---GIKIMG-SGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVH---IHLYNIK-NSMNFKKNFQV---------------------SSENSLLNKY------VVLKNSLKKLHINSTTGYIELVEDLYSKSK----YKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLN-----TIVHFEGELYDEV-VAENKLFSHILKLFKVDGLLSHTIDIENIVDIR-----KESNYEISMVIKTDFVA-----------PSDE--------FFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDN----KEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT----NINEIPK----LTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPE----------DICMNLMDIDTYAVHF 3139
            W +GF+  +  +  D ++  LK+ VVPHSH DPGW+KT   YF+ D++ ILN ++  + +  +M FI +E+ + + WW+     ++  +K+LI   ++EI TGGWVMTDEA  H   M++QL +GH WLKNNLN TP  GW+IDPFG+   +PYLL  +     +IQR+HY  K+  A  +  +F WK +W      DSE   S+  H MPF  Y +  +CGP P IC  FDF +I      +      ITD+N++ +A++LL+QY + A L+ + N  L+P+GDDFRY  ++E   QY+NY KL+D+ M  ++ +N +I+FG  SDYF+++K   KD    FP+  GD F Y+D     +  YW+GYFT+RPF K+L   L + LR+AEIV +L+     + K   +  ++ ++  +E I  +RR L LFQHHDA+ GTSKA V+ D+  +L     N +KM +       Q+    + G   F    F+ DN      +      + IQ  NG+                          L+NSL+Q R       +EV T R+    +KI+   G +L   QINP++ + +        S    +G     R+R         + + +    +  Y ++ + +NFK+N                        SS  S+          + L+N   +L  +  +G+++ +     K +     + NI F  Y  R ++  SGAYLF  D E S  E + L       I+   G +  +V V      +H +++F     L   I +EN +D       +E+   +  V   D +A           P D         F+ D N FQ+  R     I I+GN +P+T  ++I+    DS  ++ LL+  + G     +   G     +EV LDR    DD RG+ E +VD+ +    + LL ED   L  G +      +   +  + QL N L YP +  FV       + + L+    LL    LPCD HL   +T     +   P     L +HR   +C    +S G    +    PL      +V +  ++  ++    + G + K            +I +  M++ T+ + F
Sbjct:  148 WDRGFEERFDAQKKDKQRPPLKIIVVPHSHNDPGWLKTFTNYFQSDSRQILNLLVTKMQEYTDMTFIWSEISFLQLWWDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLKNNLNVTPKVGWSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGDFIWKPYWRSRKDKDSEAG-SLLTHNMPFDIYSIKGSCGPHPFICLNFDFRKIPGEYTEYSVKAQFITDDNLESKAQLLLEQYARTASLFPH-NVALIPVGDDFRYNKDREVDQQYQNYKKLIDHIMANRRLYNADIRFGTPSDYFEAIKERMKDHTPGFPTFKGDFFVYSDIFSEGRPAYWSGYFTTRPFYKLLSSELEHQLRSAEIVFTLAYNTARQAKRENAIKIYEKN--YELIINARRNLGLFQHHDAITGTSKAAVMRDYAMRLFESTQNMVKMQESCLELLLQKGQPRHHG---FLLSEFERDNFNKLPRK------MPIQMANGDESTPTVPAGEGGAGGSSSSGSVGSFVLYNSLAQKR-------LEVVTLRVQHPNVKIVNDKGVELNHIQINPVWNITDTYEQGLGTSVSGTVG-----RIRTSTRQFEVMFVAELEPLSLSTYRVQVDEVNFKRNIATIYCDDCTESQPASVSPPEEIESSPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELLKPLQCNIKFAAY--RSAQFHSGAYLFKTDPEQSEAEKEVLEGYTDMRIIITSGPIASDVTVIYGPFLAHTVRIFNTRTHLDAAIYVENDIDFEPPPKNRETELFMRFVTNIDNIAQAPMQRDPLKEPVDAATMPELPVFYSDQNGFQYHERIKVPAIGIEGNYFPITSGAFIQ----DSRLRLTLLTTHAQG---AASYEPGQ----LEVMLDRRTLYDDYRGMGEGVVDSRLTRHKFWLLVED---LPGGQHVTQPPSYKVLSQQAQQLANALRYPPNLYFVSNLEQPELAAALLPLVRLLPKGPLPCDVHLTTLRTLSDPELQLFPSASALLVLHRQGFDC---SVSAGRELSMEAICPLSSKGLGNVQLGRLSLHTIEATSLTGTEQKSSRESYHIRSLAEISLEPMELRTFNLTF 1245          
BLAST of Alpha-mannosidase vs. Ensembl Fly
Match: alpha-Man-IIb (gene:FBgn0026616 transcript:FBtr0083179)

HSP 1 Score: 430.254 bits (1105), Expect = 2.860e-131
Identity = 340/1142 (29.77%), Postives = 537/1142 (47.02%), Query Frame = 2
Query:  119 WKQGFKVEYAME--DXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFW------DSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDY-MNKQKEWNVEIKFGILSDYFDSLK---KDKIKMFPSLSGDMFSYAD----RQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLS-TVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLL----NAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQ-TNGERYV----------------------YLFNSLSQPRQLLVHIPIEVDTERI---GIKIMG-SGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVH---IHLYNIK-NSMNFKKNFQV---------------------SSENSLLNKY------VVLKNSLKKLHINSTTGYIELVEDLYSKSK----YKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLN-----TIVHFEGELYDEV-VAENKLFSHILKLFKVDGLLSHTIDIENIVDIR-----KESNYEISMVIKTDFVA-----------PSDE--------FFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDN----KEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT----NINEIPK----LTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPE----------DICMNLMDIDTYAVHF 3139
            W +GF+  +  +  D ++  LK+ VVPHSH DPGW+KT   YF+ D++ ILN ++  + +  +M FI +E+ + + WW+     ++  +K+LI   ++EI TGGWVMTDEA  H   M++QL +GH WLKNNLN TP  GW+IDPFG+   +PYLL  +     +IQR+HY  K+  A  +  +F WK +W      DSE   S+  H MPF  Y +  +CGP P IC  FDF +I      +      ITD+N++ +A++LL+QY + A L+ + N  L+P+GDDFRY  ++E   QY+NY KL+D+ M  ++ +N +I+FG  SDYF+++K   KD    FP+  GD F Y+D     +  YW+GYFT+RPF K+L   L + LR+AEIV +L+     + K   +  ++ ++  +E I  +RR L LFQHHDA+ GTSKA V+ D+  +L     N +KM +       Q+    + G   F    F+ DN      +      + IQ  NG+                          L+NSL+Q R       +EV T R+    +KI+   G +L   QINP++ + +        S    +G     R+R         + + +    +  Y ++ + +NFK+N                        SS  S+          + L+N   +L  +  +G+++ +     K +     + NI F  Y  R ++  SGAYLF  D E S  E + L       I+   G +  +V V      +H +++F     L   I +EN +D       +E+   +  V   D +A           P D         F+ D N FQ+  R     I I+GN +P+T  ++I+    DS  ++ LL+  + G     +   G     +EV LDR    DD RG+ E +VD+ +    + LL ED   L  G +      +   +  + QL N L YP +  FV       + + L+    LL    LPCD HL   +T     +   P     L +HR   +C    +S G    +    PL      +V +  ++  ++    + G + K            +I +  M++ T+ + F
Sbjct:  148 WDRGFEERFDAQKKDKQRPPLKIIVVPHSHNDPGWLKTFTNYFQSDSRQILNLLVTKMQEYTDMTFIWSEISFLQLWWDQAHPTKQRALKRLIDAGRIEITTGGWVMTDEANVHIYPMLDQLIEGHQWLKNNLNVTPKVGWSIDPFGHGSTVPYLLSGANFEGTIIQRIHYAWKQWFARQQSGDFIWKPYWRSRKDKDSEAG-SLLTHNMPFDIYSIKGSCGPHPFICLNFDFRKIPGEYTEYSVKAQFITDDNLESKAQLLLEQYARTASLFPH-NVALIPVGDDFRYNKDREVDQQYQNYKKLIDHIMANRRLYNADIRFGTPSDYFEAIKERMKDHTPGFPTFKGDFFVYSDIFSEGRPAYWSGYFTTRPFYKLLSSELEHQLRSAEIVFTLAYNTARQAKRENAIKIYEKN--YELIINARRNLGLFQHHDAITGTSKAAVMRDYAMRLFESTQNMVKMQESCLELLLQKGQPRHHG---FLLSEFERDNFNKLPRK------MPIQMANGDESTPTVPAGEGGAGGSSSSGSVGSFVLYNSLAQKR-------LEVVTLRVQHPNVKIVNDKGVELNHIQINPVWNITDTYEQGLGTSVSGTVG-----RIRTSTRQFEVMFVAELEPLSLSTYRVQVDEVNFKRNIATIYCDDCTESQPASVSPPEEIESSPTSVFEARGKPAGDIQLENPHMRLLFDEKSGFLKTITRKNQKKELLKPLQCNIKFAAY--RSAQFHSGAYLFKTDPEQSEAEKEVLEGYTDMRIIITSGPIASDVTVIYGPFLAHTVRIFNTRTHLDAAIYVENDIDFEPPPKNRETELFMRFVTNIDNIAQAPMQRDPLKEPVDAATMPELPVFYSDQNGFQYHERIKVPAIGIEGNYFPITSGAFIQ----DSRLRLTLLTTHAQG---AASYEPGQ----LEVMLDRRTLYDDYRGMGEGVVDSRLTRHKFWLLVED---LPGGQHVTQPPSYKVLSQQAQQLANALRYPPNLYFVSNLEQPELAAALLPLVRLLPKGPLPCDVHLTTLRTLSDPELQLFPSASALLVLHRQGFDC---SVSAGRELSMEAICPLSSKGLGNVQLGRLSLHTIEATSLTGTEQKSSRESYHIRSLAEISLEPMELRTFNLTF 1245          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2a1 (mannosidase, alpha, class 2A, member 1 [Source:ZFIN;Acc:ZDB-GENE-060526-31])

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 400/1056 (37.88%), Postives = 601/1056 (56.91%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK----DKIKM------FPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF-VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVS------SYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT--------NINEIPKLTIHRLKLNCYAGYISEGS---CKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y+ L F + DGGVWKQGF + Y   +     L+VFVVPHSH DPGW+KT D+Y++D TQ ILN+M+  L ++   K I +E+ YF KWW++I   ++D V++L++N QLE+ TGGWVM DEA AHY +MI+QL +GH WL+ NL   P TGWA+DPFG++    YLLK +G++NM+IQRVHY +KK  +S K LEF W+Q WD ++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  ITD NV+ RA+ LLDQYRKK+ L+     +L PLGDDFRY    EW  Q+ NY KL DYMN   E +V+ +FG +SDYF +L+K    D + M       P +SGD F+YADR DHYW+GYFTSRPF K +DR+L ++LRAAE++ SL+L   N  KYG  + +     ++ +  +RR L LFQHHDA+AGT K  VVVD+  +L ++I   + V   +A  ++  +      D  +    +D+++   +   + N + +     R + + N L Q R  +V + +        ++++ +  Q+++ Q++ +++ A       F +SF  +  PL     +++      T  S         + S +  ++F+   ++      VV++N   +L I+  TG +E +     +S++++ + F  YG   S++ SGAYLF+PD E +I        I   +G L+ EV       +H L+L+   G+   +++I N VDIR E+N EI+M I +D  +  D FF D N +Q   RKT  K+P+Q N YPMT   Y++    DS+ ++ LL+ QS G    K+         +EV +DR LNQDDNRGL + ++DN++ +  +RLL E  K++   +N+    ++        SY  +N   +P+  M V  +     PS +V    L   +  PCD HL+N +           +E   L +HR   +C  G+ +  +   C   R K  L K +  D+ +K +   SLS    +  + +P++I +  M+I TY +  
Sbjct:  129 MLDVYDLLRFDNPDGGVWKQGFDISYQENEWDNEPLQVFVVPHSHNDPGWLKTFDDYYRDQTQHILNNMVVKLHEDSRRKMIWSEISYFAKWWDSIDGQKQDAVRRLVENGQLEVATGGWVMPDEANAHYFAMIDQLVEGHQWLERNLGVKPKTGWAVDPFGHTATQAYLLKLAGLSNMLIQRVHYSVKKHFSSQKTLEFFWRQNWDQDSSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRISCPWRIPPQAITDNNVQERAQTLLDQYRKKSKLFRT-KVLLAPLGDDFRYTEAVEWDQQFENYQKLFDYMNSHPELHVKAQFGTISDYFQALRKSTGMDPVGMNVGHLALPVVSGDFFTYADRDDHYWSGYFTSRPFYKRMDRMLESYLRAAEVLYSLTLA--NIQKYGQPSDYPAGENYKLLTEARRNLGLFQHHDAIAGTGKDWVVVDYGTRLFHSILNVKRVIVSSAHWLVLKDKQTYHNDPSKAFLQMDDVQQSQDALPRKNVLEVH-GKPRLLVVSNPLEQARTSMVTVYVNTPN----VRVVSALGQVVRAQVSAVWKDASHATADVFQLSFVAHAAPLGLSVYQLIEVMEPRTDASKYMFLQEGRQLSDSKLEHFRQFYQDD--GAPVVIENPHLRLSISGATGLLEKMMLKEDESEHQMKVEFVWYGTTSSKDKSGAYLFLPDKEATIYSPSQPPVIRVTKGTLFSEVTTTFAHITHTLRLYNTQGVEGQSVEICNTVDIRGETNREIAMRITSDLNS-KDRFFTDLNGYQVQPRKTMAKLPLQANFYPMTSMLYLQ----DSSARLSLLTAQSLGAASLKS-------GQLEVIMDRRLNQDDNRGLGQGVLDNKITANSFRLLLE--KRISVEENEATAPYSYPSILSHMSYMYLN---HPLISMAVSQHL--EAPS-VVPYSPLKASF--PCDMHLVNLRAIQSKEEGGAASEQAALILHRKGFDC--GFSNRNTGLLCTSTRGKIDLEK-LLTDLKVKSITPVSLSLMHTLSSESRPQEISLKAMEIRTYRLEL 1149          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2a2 (mannosidase, alpha, class 2A, member 2 [Source:ZFIN;Acc:ZDB-GENE-110331-1])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 391/983 (39.78%), Postives = 564/983 (57.38%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYK--YGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQI--IFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISD-TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPV--HQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT--------NINEIPKLTIHRLKLNC 2941
            M  +Y  L+F + DGGVWKQGF++ Y   +     L+VFVVPHSH DPGWIKT D+Y+ D TQ ILN+M+  + ++P  KFI +E+ YF KWW +   ++++ ++KLI + QLE+VTGGWVMTDEA AHY +MI+QL +GH WL+ NL  TP +GWA+DPFG+S  MPYLLK++ I++M+IQRVHY IKK  A+++ LEF W+Q WD E+   + CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  I D NV  RA +LLDQYRKK+ L+     +LVPLGDDFRY    EW  QY NY KL DYMN   E +V+ +F  LSDYFD++ K        +   +P LSGD F+YADR+DHYW+GY+TSRPF K LDRIL +HLR AEI+ SL+ + H ++    G   V + SLL +    +RR + LFQHHDA+ GT+K  VV+D+ N+LL ++   + V   AA  ++  N    +F Q     + D+ ++  +   +   I ++++  RY+ LFN + Q R  LV   + V++ R  ++++    Q +  Q++  +  A E +   +  SF   +  L      +  +  S  T  S   + +     S+       V S+      + +   SL  L  +  TG +E +       + ++ I F  YG R S++ SGAYLF+PDG            +   EG L+ EVVA  + F   +++  V G+   ++DI  +VDIR ++N E++M   TD +   D F+ D N FQ   R+ F K+P+Q N YPM   +YI+    DS  ++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + L DN+  +  +RLL E     +S   K      VS   L++ +   +  H++              +   + L G  LPCD+HL+N ++        + +    L +HRL L+C
Sbjct:  131 MLDVYSLLNFDNVDGGVWKQGFEITYEPNEWDDEPLQVFVVPHSHNDPGWIKTFDKYYNDQTQHILNNMVTKMAEDPRRKFIWSEISYFAKWWESADVHKQEVMRKLILSGQLEMVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGVTPRSGWAVDPFGHSATMPYLLKRANISSMLIQRVHYSIKKHFAATRSLEFMWRQAWDIESSTDMFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAINDANVAERAGVLLDQYRKKSKLF-RSKVLLVPLGDDFRYDKALEWDQQYLNYQKLFDYMNSHPEMHVKAQFATLSDYFDAVYKANGVTSGARPPDYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYSLA-VAHARHAGVEGRYPVSDYSLLTD----ARRNIGLFQHHDAITGTAKEAVVIDYGNRLLRSLVGLKRVIINAAHFLIIKNKDIYRFYQTEPFLETDDRRATQDSLPQRTLIELESS-PRYLVLFNPVEQERLCLVT--VLVNSAR--VRVLTEDGQTLPVQLSAQWMSATEMSGEVYQASFMARLPALGLAVFHLYDSADSPMTLRSETLLRVPGRGQSIRGLDPLPVRSQTVDGQPFYIQSQSL-TLGFSGATGLLESIRRKDDPQEVRVQIQFLTYGTRPSKDKSGAYLFLPDGNAKPYSQREAPIVRVVEGPLFAEVVAHYQHFQQTVRIHNVPGVDGLSLDITTMVDIRDQNNKELAMRFVTD-IQSGDTFYTDLNGFQIQPRRYFQKLPLQANFYPMPSTAYIQ----DSQYRLTLHTAQALGV---TSLASGQ----LEVILDRRLMQDDNRGLGQGLKDNKRTANRFRLLLER----RSNSAKPVDSRPVSFPSLLSHMTSTILNHEVLALPVLPRKHGVPPMRTFAPLAG-TLPCDFHLLNLRSIQSPQDAHSPSPYMALLLHRLGLDC 1084          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2a2 (mannosidase, alpha, class 2A, member 2 [Source:ZFIN;Acc:ZDB-GENE-110331-1])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 391/983 (39.78%), Postives = 564/983 (57.38%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYK--YGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQI--IFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISD-TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPV--HQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT--------NINEIPKLTIHRLKLNC 2941
            M  +Y  L+F + DGGVWKQGF++ Y   +     L+VFVVPHSH DPGWIKT D+Y+ D TQ ILN+M+  + ++P  KFI +E+ YF KWW +   ++++ ++KLI + QLE+VTGGWVMTDEA AHY +MI+QL +GH WL+ NL  TP +GWA+DPFG+S  MPYLLK++ I++M+IQRVHY IKK  A+++ LEF W+Q WD E+   + CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  I D NV  RA +LLDQYRKK+ L+     +LVPLGDDFRY    EW  QY NY KL DYMN   E +V+ +F  LSDYFD++ K        +   +P LSGD F+YADR+DHYW+GY+TSRPF K LDRIL +HLR AEI+ SL+ + H ++    G   V + SLL +    +RR + LFQHHDA+ GT+K  VV+D+ N+LL ++   + V   AA  ++  N    +F Q     + D+ ++  +   +   I ++++  RY+ LFN + Q R  LV   + V++ R  ++++    Q +  Q++  +  A E +   +  SF   +  L      +  +  S  T  S   + +     S+       V S+      + +   SL  L  +  TG +E +       + ++ I F  YG R S++ SGAYLF+PDG            +   EG L+ EVVA  + F   +++  V G+   ++DI  +VDIR ++N E++M   TD +   D F+ D N FQ   R+ F K+P+Q N YPM   +YI+    DS  ++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + L DN+  +  +RLL E     +S   K      VS   L++ +   +  H++              +   + L G  LPCD+HL+N ++        + +    L +HRL L+C
Sbjct:  131 MLDVYSLLNFDNVDGGVWKQGFEITYEPNEWDDEPLQVFVVPHSHNDPGWIKTFDKYYNDQTQHILNNMVTKMAEDPRRKFIWSEISYFAKWWESADVHKQEVMRKLILSGQLEMVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGVTPRSGWAVDPFGHSATMPYLLKRANISSMLIQRVHYSIKKHFAATRSLEFMWRQAWDIESSTDMFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAINDANVAERAGVLLDQYRKKSKLF-RSKVLLVPLGDDFRYDKALEWDQQYLNYQKLFDYMNSHPEMHVKAQFATLSDYFDAVYKANGVTSGARPPDYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYSLA-VAHARHAGVEGRYPVSDYSLLTD----ARRNIGLFQHHDAITGTAKEAVVIDYGNRLLRSLVGLKRVIINAAHFLIIKNKDIYRFYQTEPFLETDDRRATQDSLPQRTLIELESS-PRYLVLFNPVEQERLCLVT--VLVNSAR--VRVLTEDGQTLPVQLSAQWMSATEMSGEVYQASFMARLPALGLAVFHLYDSADSPMTLRSETLLRVPGRGQSIRGLDPLPVRSQTVDGQPFYIQSQSL-TLGFSGATGLLESIRRKDDPQEVRVQIQFLTYGTRPSKDKSGAYLFLPDGNAKPYSQREAPIVRVVEGPLFAEVVAHYQHFQQTVRIHNVPGVDGLSLDITTMVDIRDQNNKELAMRFVTD-IQSGDTFYTDLNGFQIQPRRYFQKLPLQANFYPMPSTAYIQ----DSQYRLTLHTAQALGV---TSLASGQ----LEVILDRRLMQDDNRGLGQGLKDNKRTANRFRLLLER----RSNSAKPVDSRPVSFPSLLSHMTSTILNHEVLALPVLPRKHGVPPMRTFAPLAG-TLPCDFHLLNLRSIQSPQDAHSPSPYMALLLHRLGLDC 1084          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-52])

HSP 1 Score: 252.677 bits (644), Expect = 1.706e-69
Identity = 242/945 (25.61%), Postives = 411/945 (43.49%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYFKDD--------TQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSIC----CQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMN--KQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQ-LAEFNNNQHFVS----FKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGA-----RRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEG-ELYDEVVAENKLF----SHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRK-----TFD---KIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVD-----NEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKT---NFTNSVPSNLVGQKSLLTGY--GLPCDYHLI 2878
            PH+H D GW+KTVD+YF  D         Q IL+S++D L K+P  +FI+ E  +F +WW   ++N +  V +L+   +LE + GGW M+DEAT HYS++I+Q+  G  +L +       P   W IDPFG+++    +  + G +     R+ Y  K R   +K++E  W+    SE   S+   +   F+  +P+   P    C    C    IR         +DP ++ D NV    +  L+   K+A  Y   N++++ +G DF+Y+    W   Y+N  KL+ Y+N  + K   + + +   S Y   L       +P  + D F YAD    +WTGYFTSRP LK+ +R+  + L+    +  L          G  T  +        D  RR + + QHHDAV+GT K HV  D+  +L       + + + +   +  +       + +   V  L   S +F+ N              ++N L +  +  V +P+          +  +  + +  ++ P+ +   E   N+ F      F++   PL +               S+  I +   +  ++  KN   SS          ++N   K+  +STTG +  + +L ++   +L   F  Y A     + S + SGAY+F P+     I    ++     +   LY+ V    + F    S +++L++    L     +   V +      E+   + TD +  S  F+ DSN  + + R+     T+D     PI GN YP+   +YI+    D  R++ +++ +S G     +I+ GS    +E+ L R L  DD RG+ EPL +     + +V++G  LL                  T+S  +   DL  P+ Q  V     +F +  PS   G K   +G    LP   HL+
Sbjct:   50 PHTHDDVGWLKTVDQYFYGDRNNIQHAGVQYILDSVIDQLQKDPARRFIYVETAFFYRWWRQQNQNTRRIVTQLVNEGRLEFINGGWCMSDEATTHYSAVIDQMTLGLRFLNDTFGECGRPRVAWHIDPFGHAREHASIFAQMGYDGFFFGRLDYQDKDRRMKTKEMEMLWRA---SE---SLTPPIADLFTGVLPNGYNPPEGFCWDQSCDDAPIR---------DDP-DLEDYNVDEIVQKFLNASHKQADYYKT-NHIIMTMGSDFQYENANLW---YKNMDKLIKYVNALQAKGSKLNVLYSTPSCYLQELNLANF-TWPMKTDDFFPYADDAHDFWTGYFTSRPALKLYERLSNSRLQTCNQLEVL----------GGPTSTSGPFGEGDSDTMRRAMGVAQHHDAVSGTEKQHVANDYARRLATGWAHCEVLVSNSLAVLSGSEAPRVFCENLNISVCPLTESSHKFSMN--------------VYNPLGRTVRWPVRLPVNGSV----YNVTDANGKAVDSEVIPLSKSRKEVRQNRGFAKSELVFQVEAPPLGY---------------STYIISMVQDQPPVSRSKNAVPSS----------IQNKFLKVTFDSTTGLLSSLTNLETQQTIRLTQNFFWYNASAGNNKESHQPSGAYIFRPNSSDPFI----ISKTAEIQAVSLYNSVQEVTQRFSPWVSQVVRLYEDRRELELEWTV-GPVPVEDGLGKEVITRLDTD-IQSSGYFYTDSNGREVLERRKDYRPTWDLKQTEPIAGNYYPINSRAYIK----DDKRQLTVVTDRSQG---ASSIYNGS----LEIMLHRRLLYDDFRGVGEPLSEPGEFAHGLVARGRLLL------------------TLSPPEAAADLHRPLAQSMVLQPLLSFQDGAPS--PGTKLEFSGLQAALPPAVHLL 883          
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Match: man2a1 (mannosidase, alpha, class 2A, member 1 [Source:ZFIN;Acc:ZDB-GENE-060526-31])

HSP 1 Score: 229.95 bits (585), Expect = 1.084e-66
Identity = 109/209 (52.15%), Postives = 149/209 (71.29%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSE 694
            M  +Y+ L F + DGGVWKQGF + Y   +     L+VFVVPHSH DPGW+KT D+Y++D TQ ILN+M+  L ++   K I +E+ YF KWW++I   ++D V++L++N QLE+ TGGWVM DEA AHY +MI+QL +GH WL+ NL   P TGWA+DPFG++    YLLK +G++NM+IQRVHY +KK  +S K LEF W+Q W  +
Sbjct:  129 MLDVYDLLRFDNPDGGVWKQGFDISYQENEWDNEPLQVFVVPHSHNDPGWLKTFDDYYRDQTQHILNNMVVKLHEDSRRKMIWSEISYFAKWWDSIDGQKQDAVRRLVENGQLEVATGGWVMPDEANAHYFAMIDQLVEGHQWLERNLGVKPKTGWAVDPFGHTATQAYLLKLAGLSNMLIQRVHYSVKKHFSSQKTLEFFWRQNWGEQ 337          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: man2a1 (mannosidase, alpha, class 2A, member 1 [Source:NCBI gene;Acc:100036612])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 410/1044 (39.27%), Postives = 589/1044 (56.42%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYK--YGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFN-NNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFED-WKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT---NINEIPK----LTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAV 3133
            M  +Y+ L F + DGGVWKQGF + Y   +     L+VF+VPHSH DPGW+KT D+YF+D TQ ILN+M+  L ++ N KF+ +E+ YF KWW+ I   +K+ VK+LI+ +Q EIVTGGWVM DEAT HY S+++QL +GH WL+ NL   P +GWAIDPFG+S  M Y+LK SG++NM+IQRVHY IKK  AS + LEF W+Q WD  +   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  I + NV+ RA M+LDQYRKK+ LY     +LVPLGDDFRY    EW  QY NY KL  YMN   E +V+ +FG +SDYF +L+K         + FP LSGD F+YADR DHYW+GYFTSRPF K L+R++ +HLRAAEI+ S +L+  NK+       +V +  LL E    +RR L LFQHHDA+ GT+K  VVVD+  +L +++   + V   AA  ++  +     ++     F +D+++   +   +   I I T   RY+ ++N   Q R  +V       +      I  SG  L K QI+ ++        + + VSF   +  L     +++    S++  +   I +     ++N   NF++   N ++   V ++N+  KL   S++G +E ++       + + + F  YG   +R+ SGAYLF+PDGE           +    G ++ EVV   K  +H ++L+ V GL   + +I N+VDIR E N EI M I +D +     F+ D N +Q   R+T  K+PIQ NVYPMT  +YI+    D   ++ L S QS GV   K+         +EVFLDR L QDDNRGL + + DN++ S  +RLL E  + + +  D K     ++ S+     L +PV  M   ++  +SV  N      L     +PCD HL+N +T    +  IP     L +HR   +C       G  C   + K  + + +F+  +I+ +   SL+      +     +I ++ MDI T+ +
Sbjct:   46 MLDVYDILPFDNPDGGVWKQGFDISYDEHEWDNEPLQVFLVPHSHNDPGWLKTFDDYFRDQTQHILNNMVIKLQEDKNRKFMWSEISYFSKWWDGIDNQKKEAVKRLIELEQFEIVTGGWVMPDEATPHYFSLVDQLIEGHQWLEKNLGVKPKSGWAIDPFGHSPTMAYILKSSGLSNMLIQRVHYSIKKYFASKQTLEFFWRQNWDLGHSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVSCPWRVPPEVINEGNVQHRAWMILDQYRKKSKLY-RTKVLLVPLGDDFRYTDSLEWDQQYENYQKLFSYMNSHPELHVKAQFGTISDYFKALRKAGNVDDPNSQSFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRLERVMESHLRAAEILYSFALVQMNKFDKLQSFPSVEHYKLLTE----ARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMNLKRVIIDAAHVLVLKDKDTYAYNPSSPFFSMDDVQPSQDSLPQKTVIKI-TEIPRYLTVYNPTEQERYSVV---SVYVSSSKVKVISASGKAL-KAQISAVWNGDSAPLQDMYQVSFLAYLPALGLAVYKLVEAENSESIKADYTIFVQGKHKNINSDGNFRIKEVNIVVGD-VTIENTYLKLWF-SSSGLLEKIQSKEDGKTHGVKVDFIWYGTTNNRDKSGAYLFLPDGEAKPYINADPPVVRVTHGSIFSEVVVFFKHLTHTVRLYNVHGLEGQSPEITNVVDIRGEFNREIVMRITSD-INSKHRFYTDLNGYQIQPRRTLSKLPIQANVYPMTSMAYIQ----DDASRLTLHSAQSLGVASSKS-------GQLEVFLDRRLMQDDNRGLGQGVQDNKITSNLFRLLLEKRFGKDEKEDEKPVSYPSILSHITSMFLNHPVIPMAATSDSGSSVLLNAF----LPLTSSMPCDVHLLNLRTIQAKVGPIPSDEAALILHRKGFDCKFSNKDLGLLCSTTQGKVSVHR-LFNGFNIESLIPSSLTLMHSSSNSKNTTEIRISTMDIKTFRI 1060          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: man2a2 (mannosidase, alpha, class 2A, member 2 [Source:NCBI gene;Acc:448465])

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 389/986 (39.45%), Postives = 561/986 (56.90%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKD-------KIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKY----KYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQII--FDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQ-LAEFNNNQHFVSFKLNIGPLAFERVRILATGISDT---YCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDL--IYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINE---IPK----LTIHRLKLNC 2941
            M  +Y  L F + DGGVWKQGF + Y  ++     L+VFVVPHSH DPGWIKT D+Y+ D TQ ILN+M+  L ++P  KFI +E+ +F KWW+ I+  ++  V++L+ + QLE+ TGGWVM DEA  HY +MI+Q+ +GH WLK NL+ TP +GWA+DPFG+S  MPY+L++S + +M+IQRVHY IKK  A+++ LEF W+Q WD ++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  ITD NV  RA +LLDQY+KK+ LY     VLVPLGDDFRY   +EW  Q+ NY KL DYMN   E +V+ +FG LSDYFD+L K        K   FP +SGD FSYADR+DHYWTGY+TSRPF K +DR+L +HLR AEI+ SL++ +  K     KY LS   + +LL +    +RR L LFQHHDA+ GT+K  VV+D+  +LL+++   + +   AA  ++  +     +D  +  F  D  +   E   +   I + T   RYV +FN + Q R  +V + +        ++++    Q +  Q++P++Q + + N + + VS       L F + R L +  SD     C   ++ L+ +   ++ +    +  E   + K   L N             ++ ++    + + K+N+ F  YG R S++ SGAYLF+PDGE           +   EG  Y EV  + +    +++L+ + G    ++DI +++DIR   N EI+M + TD +   D FF D N FQ   R+ F K+P+Q N YPM   +YI+    D   ++ L + Q+ GV   K          +EV LDR L QDDNRGL + L DN+ +   +R+  E     +S  NK  G   VS   L++ +  ++  H   V        P+    Q    T   LPCD+H++N +T   E   +P     L +HR   +C
Sbjct:  131 MLDVYTQLPFDNVDGGVWKQGFDITYDPKEWDNEPLQVFVVPHSHNDPGWIKTFDKYYYDQTQHILNNMVVKLHEDPRRKFIWSEISFFSKWWDNINSQKRAAVRRLVASGQLEMTTGGWVMPDEANTHYFAMIDQMIEGHQWLKKNLDATPRSGWAVDPFGHSSTMPYILRRSNLTSMLIQRVHYSIKKHFAATQSLEFMWRQTWDPDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFRRLPGGRINCPWKVPPRAITDSNVAERANILLDQYKKKSKLY-RSKVVLVPLGDDFRYDKIQEWDAQFLNYQKLFDYMNSHPELHVQAQFGTLSDYFDALYKRMGVVPGIKPPDFPVVSGDFFSYADREDHYWTGYYTSRPFYKSMDRVLESHLRGAEILYSLAINHARKAGTESKYPLS---DYALLTD----ARRNLGLFQHHDAITGTAKEAVVIDYGVRLLHSLMNLKRIIINAAHYLVVADKEKYHYDHSVPFFSTDESRLTQESLPEKTVIKL-TASPRYVVVFNPVEQNRLCVVSLLVNT----YNVRVLTEDGQPVAAQLSPVWQSVTDMNPDVYQVS------DLFFAQ-RNLPSKYSDCSFKVCRLTYLQLFFLIYPIDIRVCVPILHECKSIIKTFCLFN-------------VQSIKRAGEEQEQKINMQFLIYGTRTSKDKSGAYLFLPDGEAKPYTPKDPPVVKVTEGPFYSEVTCQYQHVQQVMRLYNLPGTEGLSLDISSLIDIRDHVNKEIAMRLSTD-IQSEDIFFTDLNGFQIQPRRFFKKLPLQANFYPMPTMAYIQ----DEQNRLTLHTAQALGVSSLKN-------GELEVILDRRLMQDDNRGLGQGLKDNKRLCSRFRIQMEK----RSAGNKSQGNQPVSFPSLLSHMTSMHLNHDPLVMAVSNEKSPALKSFQPLSAT---LPCDFHILNLRTLQAEDDGLPSPDMALILHRKGFDC 1064          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: man2a2 (mannosidase, alpha, class 2A, member 2 [Source:NCBI gene;Acc:448465])

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 389/983 (39.57%), Postives = 561/983 (57.07%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKD-------KIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKY----KYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQII--FDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQ-LAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDL--IYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINE---IPK----LTIHRLKLNC 2941
            M  +Y  L F + DGGVWKQGF + Y  ++     L+VFVVPHSH DPGWIKT D+Y+ D TQ ILN+M+  L ++P  KFI +E+ +F KWW+ I+  ++  V++L+ + QLE+ TGGWVM DEA  HY +MI+Q+ +GH WLK NL+ TP +GWA+DPFG+S  MPY+L++S + +M+IQRVHY IKK  A+++ LEF W+Q WD ++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  ITD NV  RA +LLDQY+KK+ LY     VLVPLGDDFRY   +EW  Q+ NY KL DYMN   E +V+ +FG LSDYFD+L K        K   FP +SGD FSYADR+DHYWTGY+TSRPF K +DR+L +HLR AEI+ SL++ +  K     KY LS   + +LL +    +RR L LFQHHDA+ GT+K  VV+D+  +LL+++   + +   AA  ++  +     +D  +  F  D  +   E   +   I + T   RYV +FN + Q R  +V + +        ++++    Q +  Q++P++Q + + N + + VS       L F + R L +  SD+  S   + L   +++         S E  ++   +  K +    ++ S       ++    + + K+N+ F  YG R S++ SGAYLF+PDGE           +   EG  Y EV  + +    +++L+ + G    ++DI +++DIR   N EI+M + TD +   D FF D N FQ   R+ F K+P+Q N YPM   +YI+    D   ++ L + Q+ GV   K          +EV LDR L QDDNRGL + L DN+ +   +R+  E     +S  NK  G   VS   L++ +  ++  H   V        P+    Q    T   LPCD+H++N +T   E   +P     L +HR   +C
Sbjct:  131 MLDVYTQLPFDNVDGGVWKQGFDITYDPKEWDNEPLQVFVVPHSHNDPGWIKTFDKYYYDQTQHILNNMVVKLHEDPRRKFIWSEISFFSKWWDNINSQKRAAVRRLVASGQLEMTTGGWVMPDEANTHYFAMIDQMIEGHQWLKKNLDATPRSGWAVDPFGHSSTMPYILRRSNLTSMLIQRVHYSIKKHFAATQSLEFMWRQTWDPDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFRRLPGGRINCPWKVPPRAITDSNVAERANILLDQYKKKSKLY-RSKVVLVPLGDDFRYDKIQEWDAQFLNYQKLFDYMNSHPELHVQAQFGTLSDYFDALYKRMGVVPGIKPPDFPVVSGDFFSYADREDHYWTGYYTSRPFYKSMDRVLESHLRGAEILYSLAINHARKAGTESKYPLS---DYALLTD----ARRNLGLFQHHDAITGTAKEAVVIDYGVRLLHSLMNLKRIIINAAHYLVVADKEKYHYDHSVPFFSTDESRLTQESLPEKTVIKL-TASPRYVVVFNPVEQNRLCVVSLLVNT----YNVRVLTEDGQPVAAQLSPVWQSVTDMNPDVYQVS------DLFFAQ-RNLPSKYSDSLHSPPRLLLLYGRST---------SGEPGVI---IPHKATFCLFNVQS-------IKRAGEEQEQKINMQFLIYGTRTSKDKSGAYLFLPDGEAKPYTPKDPPVVKVTEGPFYSEVTCQYQHVQQVMRLYNLPGTEGLSLDISSLIDIRDHVNKEIAMRLSTD-IQSEDIFFTDLNGFQIQPRRFFKKLPLQANFYPMPTMAYIQ----DEQNRLTLHTAQALGVSSLKN-------GELEVILDRRLMQDDNRGLGQGLKDNKRLCSRFRIQMEK----RSAGNKSQGNQPVSFPSLLSHMTSMHLNHDPLVMAVSNEKSPALKSFQPLSAT---LPCDFHILNLRTLQAEDDGLPSPDMALILHRKGFDC 1055          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: man2a2 (mannosidase, alpha, class 2A, member 2 [Source:NCBI gene;Acc:448465])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 378/982 (38.49%), Postives = 552/982 (56.21%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKD-------KIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKY----KYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQII--FDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDL--IYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINE---IPK----LTIHRLKLNC 2941
            M  +Y  L F + DGGVWKQGF + Y  ++     L+VFVVPHSH DPGWIKT D+Y+ D TQ ILN+M+  L ++P  KFI +E+ +F KWW+ I+  ++  V++L+ + QLE+ TGGWVM DEA  HY +MI+Q+ +GH WLK NL+ TP +GWA+DPFG+S  MPY+L++S + +M+IQRVHY IKK  A+++ LEF W+Q WD ++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  ITD NV  RA +LLDQY+KK+ LY     VLVPLGDDFRY   +EW  Q+ NY KL DYMN   E +V+ +FG LSDYFD+L K        K   FP +SGD FSYADR+DHYWTGY+TSRPF K +DR+L +HLR AEI+ SL++ +  K     KY LS   + +LL +    +RR L LFQHHDA+ GT+K  VV+D+  +LL+++   + +   AA  ++  +     +D  +  F  D  +   E   +   I + T   RYV +FN + Q R  +V + +        ++++    Q +  Q++P++Q                               ++D     ++  +Y + +    ++N        +L+K  ++      +  +     ++ ++    + + K+N+ F  YG R S++ SGAYLF+PDGE           +   EG  Y EV  + +    +++L+ + G    ++DI +++DIR   N EI+M + TD +   D FF D N FQ   R+ F K+P+Q N YPM   +YI+    D   ++ L + Q+ GV   K          +EV LDR L QDDNRGL + L DN+ +   +R+  E   +  +G+    G F VS   L++ +  ++  H   V        P+    Q    T   LPCD+H++N +T   E   +P     L +HR   +C
Sbjct:  143 MLDVYTQLPFDNVDGGVWKQGFDITYDPKEWDNEPLQVFVVPHSHNDPGWIKTFDKYYYDQTQHILNNMVVKLHEDPRRKFIWSEISFFSKWWDNINSQKRAAVRRLVASGQLEMTTGGWVMPDEANTHYFAMIDQMIEGHQWLKKNLDATPRSGWAVDPFGHSSTMPYILRRSNLTSMLIQRVHYSIKKHFAATQSLEFMWRQTWDPDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFRRLPGGRINCPWKVPPRAITDSNVAERANILLDQYKKKSKLY-RSKVVLVPLGDDFRYDKIQEWDAQFLNYQKLFDYMNSHPELHVQAQFGTLSDYFDALYKRMGVVPGIKPPDFPVVSGDFFSYADREDHYWTGYYTSRPFYKSMDRVLESHLRGAEILYSLAINHARKAGTESKYPLS---DYALLTD----ARRNLGLFQHHDAITGTAKEAVVIDYGVRLLHSLMNLKRIIINAAHYLVVADKEKYHYDHSVPFFSTDESRLTQESLPEKTVIKL-TASPRYVVVFNPVEQNRLCVVSLLVNT----YNVRVLTEDGQPVAAQLSPVWQ------------------------------SVTD-----MNPDVYQVSDLFFAQRNLPSKYSELMLSKAKLIGYHFSVIWPSFCLFNVQSIKRAGEEQEQKINMQFLIYGTRTSKDKSGAYLFLPDGEAKPYTPKDPPVVKVTEGPFYSEVTCQYQHVQQVMRLYNLPGTEGLSLDISSLIDIRDHVNKEIAMRLSTD-IQSEDIFFTDLNGFQIQPRRFFKKLPLQANFYPMPTMAYIQ----DEQNRLTLHTAQALGVSSLKN-------GELEVILDRRLMQDDNRGLGQGLKDNKRLCSRFRIQME---KRSAGNKVSVGPFPVSFPSLLSHMTSMHLNHDPLVMAVSNEKSPALKSFQPLSAT---LPCDFHILNLRTLQAEDDGLPSPDMALILHRKGFDC 1058          
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Match: man2a1 (mannosidase, alpha, class 2A, member 1 [Source:NCBI gene;Acc:100036612])

HSP 1 Score: 654.825 bits (1688), Expect = 0.000e+0
Identity = 409/1042 (39.25%), Postives = 581/1042 (55.76%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYK--YGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFN-NNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFED-WKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT---NINEIPK----LTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAV 3133
            M  +Y+ L F + DGGVWKQGF + Y   +     L+VF+VPHSH DPGW+KT D+YF+D TQ ILN+M+  L ++ N KF+ +E+ YF KWW+ I   +K+ VK+LI+ +Q EIVTGGWVM DEAT HY S+++QL +GH WL+ NL   P +GWAIDPFG+S  M Y+LK SG++NM+IQRVHY IKK  AS + LEF W+Q WD  +   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  I + NV+ RA M+LDQYRKK+ LY     +LVPLGDDFRY    EW  QY NY KL  YMN   E +V+ +FG +SDYF +L+K         + FP LSGD F+YADR DHYW+GYFTSRPF K L+R++ +HLRAAEI+ S +L+  NK+       +V +  LL E    +RR L LFQHHDA+ GT+K  VVVD+  +L +++   + V   AA  ++  +     +        N  S      KN    +     RY+ ++N   Q R  +V       +      I  SG  L K QI+ ++        + + VSF   +  L     +++    S++  +   I +     ++N   NF++   N ++   V ++N+  KL   S++G +E+         + + + F  YG   +R+ SGAYLF+PDGE           +    G ++ EVV   K  +H ++L+ V GL   + +I N+VDIR E N EI M I +D +     F+ D N +Q   R+T  K+PIQ NVYPMT  +YI+    D   ++ L S QS GV   K+         +EVFLDR L QDDNRGL + + DN++ S  +RLL E  + + +  D K     ++ S+     L +PV  M   ++  +SV  N      L     +PCD HL+N +T    +  IP     L +HR   +C       G  C   + K  + + +F+  +I+ +   SL+      +     +I ++ MDI T+ +
Sbjct:  133 MLDVYDILPFDNPDGGVWKQGFDISYDEHEWDNEPLQVFLVPHSHNDPGWLKTFDDYFRDQTQHILNNMVIKLQEDKNRKFMWSEISYFSKWWDGIDNQKKEAVKRLIELEQFEIVTGGWVMPDEATPHYFSLVDQLIEGHQWLEKNLGVKPKSGWAIDPFGHSPTMAYILKSSGLSNMLIQRVHYSIKKYFASKQTLEFFWRQNWDLGHSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVSCPWRVPPEVINEGNVQHRAWMILDQYRKKSKLY-RTKVLLVPLGDDFRYTDSLEWDQQYENYQKLFSYMNSHPELHVKAQFGTISDYFKALRKAGNVDDPNSQSFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRLERVMESHLRAAEILYSFALVQMNKFDKLQSFPSVEHYKLLTE----ARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMNLKRVIIDAAHVLVLKDKDTYAY--------NPSSPFFSMVKNILPSVYY---RYLTVYNPTEQERYSVV---SVYVSSSKVKVISASGKAL-KAQISAVWNGDSAPLQDMYQVSFLAYLPALGLAVYKLVEAENSESIKADYTIFVQGKHKNINSDGNFRIKEVNIVVGD-VTIENTYLKLWF-SSSGLLEVRLCKEDGKTHGVKVDFIWYGTTNNRDKSGAYLFLPDGEAKPYINADPPVVRVTHGSIFSEVVVFFKHLTHTVRLYNVHGLEGQSPEITNVVDIRGEFNREIVMRITSD-INSKHRFYTDLNGYQIQPRRTLSKLPIQANVYPMTSMAYIQ----DDASRLTLHSAQSLGVASSKS-------GQLEVFLDRRLMQDDNRGLGQGVQDNKITSNLFRLLLEKRFGKDEKEDEKPVSYPSILSHITSMFLNHPVIPMAATSDSGSSVLLNAF----LPLTSSMPCDVHLLNLRTIQAKVGPIPSDEAALILHRKGFDCKFSNKDLGLLCSTTQGKVSVHR-LFNGFNIESLIPSSLTLMHSSSNSKNTTEIRISTMDIKTFRI 1135          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2a2 (mannosidase 2, alpha 2 [Source:MGI Symbol;Acc:MGI:2150656])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 400/1053 (37.99%), Postives = 597/1053 (56.70%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQS---LLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQ--IIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISDTYC--SSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGY-----GLPCDYHLINFKTNINE--IP----KLTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  + E L F + +GGVW+QGF + Y+  D     L+VFVVPHSH DPGWIKT D+Y+ + TQ ILNSM+  L ++P  +F+ AEV +F KWW+ IS  ++  V++L+ N QLEI TGGWVM DEA +HY ++++QL +GH WL+ NL  TP +GWA+DPFG+S  MPYLL+++ + +M+IQRVHY IKK  A++  LEF W+Q WDS++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ NV  RA +LLDQYRKK+ L+   N +LVPLGDDFRY   +EW  Q+ NY +L D++N + E++V+ +FG LS+YFD+L K        +   FP LSGD FSYADR+DHYWTGY+TSRPF K LDR+L  HLR AEI+ SL+L +    + GL+  +  S   LL E    +RRTL LFQHHDA+ GT+K  VVVD+  +LL ++   + V   AA  ++  +     FD       +D+ +   +   +   I + ++  R+V +FN L Q R  L  + + V++ R  ++++    Q +  QI+  +  A +   + + VS  + +  L    V  L   +   Y   SSV ++L  +K S++ +  F V   +S  + + +  N   ++  +  TG ++ +  +  + + ++ + F  YG R S++ SGAYLF+PD E           +   EG  + EV    + F  +++L+ + G+   ++D+   VDIR   N E+++ I TD +     FF D N FQ   R+   K+P+Q N YPM   +YI+    DS R++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + L DN++    +RLL E    +    ++E  E + S   L++ L      M++ T       +   G    L  +      LPCD+HL+N +    E  +P     L +HR   +C     + G +C   + K  L  S+F  + + ++   SL+    +       DI +  M+I T+ +  
Sbjct:  131 MLTVSEDLPFDNVEGGVWRQGFDISYSPNDWDTEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKSRLF-RSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQAQFGTLSEYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEILYSLALAHAR--RSGLAGQYPLSDFALLTE----ARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQVIINAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHDALPERTVIRLDSS-PRFVVVFNPLEQER--LSVVSLLVNSPR--VRVLSEEGQPLSVQISVHWSSATDMVPDVYQVSVPVRLPGLGLG-VLQLQPDLDGPYTLQSSVRVYLNGVKLSVSRQSAFPVRVVDSGASDFAI-SNRYMQVWFSGLTGLLKSIRRVDEEQEQQMELEFLVYGTRTSKDKSGAYLFLPDSEAKPYVPKKPPVLRVTEGPFFSEVAVYYEHFHQVIRLYNLPGVEGLSLDMSFQVDIRDYVNKELALRIHTD-IDSQGTFFTDLNGFQIQPRQYLKKLPLQANFYPMPVMAYIQ----DSQRRLTLHTAQALGV---SSLGNGQ----LEVILDRRLMQDDNRGLGQGLKDNKITCNRFRLLLERRTTMSPEVHQE-QERSTSYPSLLSHLT----SMYLSTPPLVLPVAKRQGTSPALRSFHPLASPLPCDFHLLNLRMLPAEDTLPATDSALILHRKGFDCGLEAKNLGFNCTTSQGKLAL-GSLFHGLDVTFLQPTSLTLLYPLASPSNSTDISLEPMEISTFRLRL 1151          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2a1 (mannosidase 2, alpha 1 [Source:MGI Symbol;Acc:MGI:104669])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 393/1052 (37.36%), Postives = 600/1052 (57.03%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL-------KKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAI-KMSQFVFTYAAQRILQN-NIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQ-LAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSL-LNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSY-QLMNDLIYP-VHQMFVKTNFTNSVPS---NLVGQKSLLTGYGLPCDYHLINFKTNINEIPK-------LTIHRLKLNCYAGYISEG---SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y+ + F + DGGVWKQGF ++Y  ++     L+VFVVPHSH DPGW+KT ++YF+D TQ I N+M+  L ++ + KF+ +E+ Y  KWW+ I   +K+ VK L++N QLEIVTGGWVM DEAT HY ++I+QL +GH WL+ NL   P +GWAIDPFG+S  M YLLK++G ++M+IQRVHY IKK  +  K LEF W+Q WD  +   I CHMMPF+SYD+PHTCGPDP ICCQFDF R+   R  CPWG  P  I+  NV+ RA+MLLDQYRKK+ L+     +L PLGDDFR+    EW +Q RNY +L  YMN Q    V+I+FG LSDYFD+L       KK    +FP+LSGD F+YADR DHYW+GYFTSRPF K +DRI+ + +RAAEI+  L+L    KYK      F  S  +  +  +RR L LFQHHDA+ GT+K  VVVD+  +L  ++  + + +   A   IL++  +  S   +   ++D  +S  +   +   I +     RY+ ++N   Q R  +V I +   T    +K++    + ++ Q++ ++  +   +   + VSF  +I PL  +  +IL     ++  SS H+  Y + N+    +N     +N +     + ++N    +  +  +G +E V       +++L + F  YG    R+ SGAYLF+PDG+G          +    G +Y +V    +  +H ++L+ + G+   ++++ NIV+IR   N EI M I +  +   + ++ D N +Q   R+T  K+P+Q NVYPM   +YI+    D+  ++ LLS QS G     ++  G     IEVF+DR L QDDNRGL + + DN++ +  +R+L E     +S  N E  + +  SY  L++ +    ++  F+    +  +PS    L+ +  LL    LPCD HL+N +T  +++ K       L +HR   +C   + S G    C   + K  ++K +F+  +++ +   SLS      D     ++ ++ M+I T+ +  
Sbjct:  130 MLDVYDLIPFDNPDGGVWKQGFDIKYEADEWDHEPLQVFVVPHSHNDPGWLKTFNDYFRDKTQYIFNNMVLKLKEDSSRKFMWSEISYLAKWWDIIDIPKKEAVKSLLQNGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLEKNLGVKPRSGWAIDPFGHSPTMAYLLKRAGFSHMLIQRVHYAIKKHFSLHKTLEFFWRQNWDLGSATDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYRKKSKLFRT-KVLLAPLGDDFRFSEYTEWDLQCRNYEQLFSYMNSQPHLKVKIQFGTLSDYFDALEKAVAAEKKSSQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRIRAAEILYQLALKQAQKYKI---NKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGDSAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPQKIIIQLSAQEPRYLVVYNPFEQERHSVVSIRVNSAT----VKVLSDSGKPVEVQVSAVWNDMRTISQAAYEVSFLAHIPPLGLKVFKIL-----ESQSSSSHLADYVLYNNDGLAENGIFHVKNMVDAGDAITIENPFLAIWFD-RSGLMEKVRRKEDSRQHELKVQFLWYGTTNKRDKSGAYLFLPDGQGQPYVSLRPPFVRVTRGRIYSDVTCFLEHVTHKVRLYNIQGIEGQSMEVSNIVNIRNVHNREIVMRISSK-INNQNRYYTDLNGYQIQPRRTMSKLPLQANVYPMCTMAYIQ----DAEHRLTLLSAQSLG---ASSMASGQ----IEVFMDRRLMQDDNRGLGQGVHDNKITANLFRILLEK----RSAVNMEEEKKSPVSYPSLLSHMTSSFLNHPFLPMVLSGQLPSPAFELLSEFPLLQS-SLPCDIHLVNLRTIQSKMGKGYSDEAALILHRKGFDCQ--FSSRGIGLPCSTTQGKMSVLK-LFNKFAVESLVPSSLSLMHSPPDAQNMSEVSLSPMEISTFRIRL 1147          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2a2 (mannosidase 2, alpha 2 [Source:MGI Symbol;Acc:MGI:2150656])

HSP 1 Score: 468.774 bits (1205), Expect = 4.710e-153
Identity = 224/419 (53.46%), Postives = 293/419 (69.93%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEI-VLSLSLIYHNKYKYGLS 1294
            M  + E L F + +GGVW+QGF + Y+  D     L+VFVVPHSH DPGWIKT D+Y+ + TQ ILNSM+  L ++P  +F+ AEV +F KWW+ IS  ++  V++L+ N QLEI TGGWVM DEA +HY ++++QL +GH WL+ NL  TP +GWA+DPFG+S  MPYLL+++ + +M+IQRVHY IKK  A++  LEF W+Q WDS++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ NV  RA +LLDQYRKK+ L+   N +LVPLGDDFRY   +EW  Q+ NY +L D++N + E++V+ +FG LS+YFD+L K        +   FP LSGD FSYADR+DHYWTGY+TSRPF K LDR+L  HLR+A    L     +H   + G S
Sbjct:  131 MLTVSEDLPFDNVEGGVWRQGFDISYSPNDWDTEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKSRLF-RSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQAQFGTLSEYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRSAYTGPLPAPRCHHGNRQGGSS 548          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2b1 (mannosidase 2, alpha B1 [Source:MGI Symbol;Acc:MGI:107286])

HSP 1 Score: 222.631 bits (566), Expect = 2.708e-59
Identity = 248/1039 (23.87%), Postives = 447/1039 (43.02%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYF--------KDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNL--NYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALL---YDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWN--VEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIK------CQINPIFQLAEFNNN-QHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKY----GARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAE-NKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRK-------TFDKI-PIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSK--GYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDL--IYPVH-QMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEIPKLTIHRLKLNCYAGYISEGSCKFLRKKSPL-MKSMFDDVSIKYVNKFSLSGNQVIG-------------------DKVKPEDICMNLMDIDTY 3127
            PH+H D GW+KTVD+Y+            Q IL+S++  L+++P  +FI+ E+ +F +WW   +   +D V+ L++  +LE V GGWVM DEA  HY ++++Q+  G  +L++    +  P   W IDPFG+S+    L  + G +   + R+ Y  + +L   K+L  R ++ W + +  S+       F+  +P+   P   +C  +D +      C   + PV     + +  A+ L++ + K A     +   N+ ++ +G DF Y+    W   ++N  KL+  +N Q+     V + +   + Y   L K  +  +     D F YAD    +WTGYF+SRP LK  +R+  N L+    + +L     N   YG     + + L E        +++ QHHDAV+GT++ +VV D+  QL       + + + A  R+       S   ++   +  +   SERF               V L+N L +    +V +P+              GN ++K         N +   + ++   Q  + F  ++  L F    +          S ++   +N+ +     K+  V          +V++N   +   +S TG +  +E+L       ++  F  Y    G   S + SGAY+F P+  G  I       I   +  L  EV    +   S +++L+K    L     +  I  +R +   E+     T       +FF DSN  + ++R+       T ++  P+ GN YP+    YI     D   ++ +L+ +S G   G ++  GS    +E+ + R L  DD+RG+ EPL++ +   K  G  L+        +  ++   E  V + Q++  L    P H +   KT F+       + Q+       LP   HL+   T     PK+ + RL+   +   + E S + L     L ++++F   +I Y+ + +L+ NQ +                     K+ P  + +  M+I T+
Sbjct:   69 PHTHDDVGWLKTVDQYYYGILSDVQHASVQYILDSVVSSLLEKPTRRFIYVEMAFFSRWWKQQTSATQDAVRNLVRQGRLEFVNGGWVMNDEAATHYGAIVDQMTLGLRFLQDTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFFLGRIDY--QDKLNRKKKL--RMEELWRASD--SLEPPAADLFTGVLPNNYNPPKYLC--WDVL------C--TDPPVVDNPRSPEFNAKTLVNYFLKLASSQKGFYRTNHTVMTMGSDFHYENANMW---FKNMDKLIRLVNAQQVNGSLVHVLYSTPTCYLWELNKANLT-WTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVGPEANVGPYGSG---DSAPLQE-------AMAVLQHHDAVSGTARQNVVNDYARQLAAGWGPCEVLVSNALARLSHYKQNFSFCRELNISICPVSQTSERFQ--------------VTLYNPLGRKVDQMVRLPVY------------EGNFIVKDPHDKNISSNVVMVPSYYSETYQWELLFPASVPALGFSTYSV-------AKMSDLNHQAHNLLSRPRKHKSHHV----------LVIENKYMRATFDSGTGLLMKIENLEQNLSLPVSQGFFWYNASVGDEESSQASGAYIFRPN-VGKPIPVSRWAQISLVKTALVQEVHQNFSAWCSQVIRLYKGQRHLELEWTVGPI-PVRDDWGKEVISRFDTPMKT-KGQFFTDSNGREILKRRDDYRPTWTLNQTEPVAGNYYPVNTRIYIT----DGQMQLTVLTDRSQG---GSSLQDGS----LELMVHRRLLVDDDRGVSEPLLETDTGDKVRGRHLVLLSSVSDAAARHRLLAEQEVLAPQVVLSLGGSSPYHSRATPKTQFSG------LRQE-------LPPQVHLL---TLARWGPKMLLLRLE---HQFALKEDSDRNLSSPVTLNVQNLFQTFTINYLQETTLAANQPLSRASRLKWMTNTGPTSYPEPSKLDPTSVTLKPMEIRTF 1001          
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Match: Man2b2 (mannosidase 2, alpha B2 [Source:MGI Symbol;Acc:MGI:1195262])

HSP 1 Score: 176.407 bits (446), Expect = 1.609e-44
Identity = 117/410 (28.54%), Postives = 193/410 (47.07%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTI-SKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDP---VEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQ-KEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYG-LSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHV 1402
            PHSH+D GW+ TV E  +     +  +++  L++    +FI  E  +F  WW+ + S+ QK QV++L+   +LE V GG VM DEA  H    I QL +GH +L       P   W +DPFG S   P L   +G N  +I R+ Y +K  +  ++ L+F W        +  I  H+M  +SY  P            ++ + +     P G  P     +T  N+ + AE L+   +++A  +    +VL P G D ++      S+Q+ N   L+DY+N++  ++ + +++  L+DYF +L    +        D   Y+      WTG++TSR  LK L R     L A E + +       +Y +   S   + +   +++   R  +S  QHHDA+ GT    V
Sbjct:   33 PHSHMDVGWVFTVQESMRAYAANVYTTVVAELVRGGQRRFIAVEQEFFRLWWDGVASEQQKQQVRQLLHEGRLEFVLGGQVMHDEAVTHLDDQILQLTEGHGFLYETFGIRPQFSWHVDPFGASATTPTLFALAGFNAHLISRIDYDLKDAMQEAQMLQFVWHGSPSLSGQQEIFTHVMDHYSYCTPSHIPFSNRSGFYWNGVAVFPEPPPDGVYPNMSEPVTGANIHLYAEALVANVKQRAAWFRT-PHVLWPWGCDKQFFNA---SVQFDNMDPLLDYINQRTAQFGISVQYATLNDYFQALHATNMTWGIRDHQDFLPYSSEPLQAWTGFYTSRSTLKGLARQASALLYAGESMFT-------RYMWPDPSGTLDPTWALQQLQQLRWAVSEVQHHDAITGTESPKV 431          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|Q16706|MA2A1_HUMAN (Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 407/1061 (38.36%), Postives = 605/1061 (57.02%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRII--YFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL------KKDKIK-MFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYS--------------ERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNF--IEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPV--HQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEI-------PKLTIHRLKLNCYAGYISEGSCKFLRKKSP--LMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y  + F + DGGVWKQGF + Y   +     L+VFVVPHSH DPGW+KT ++YF+D TQ I N+M+  L ++   KFI +E+ Y  KWW+ I   +KD VK LI+N QLEIVTGGWVM DEAT HY ++I+QL +GH WL+NN+   P +GWAIDPFG+S  M YLL ++G+++M+IQRVHY +KK  A  K LEF W+Q WD  +   I CHMMPF+SYD+PHTCGPDP ICCQFDF R+    F CPWG  P  I   NV+ RA MLLDQYRKK+ L+     +L PLGDDFRY    EW +Q++NY +L DYMN Q ++ V+I+FG LSD+FD+L      ++DK + MFP LSGD F+YADR DHYW+GYFTSRPF K +DRI+ +HLRAAEI+   +L   +KYK      F  S L+  +  +RR L LFQHHDA+ GT+K  VVVD+  +L +++             +L+  IGNS F  I+ D     SYS              +   + N I +     RY+ ++N L Q R  LV + +   T    +++  +  + ++ Q++ ++  A   +   + +SF+ +I PL  +  +IL +  S+++ +   ++   +++S  F     +++E       + L+NS   L  +  TG ++ +        +++N+ F  YG    R+ SGAYLF+PDG      + +   +    G +Y EV       +H ++L+ + G+   ++++ NIVDIRK  N EI+M I +D +   + F+ D N +Q   R T  K+P+Q NVYPMT  +YI+    D+  ++ LLS QS GV         S++N   IEV +DR L QDDNRGL + + DN++ +  +R+L E     +S  N E  + +VS   L++ +   +  H +    N  +S    L G+ S L    LPCD HL+N +T  +++         L +HR   +C   + S+G+  F        L++ + +   ++ +   SLS            +I ++ M+I T+ +  
Sbjct:  131 MLDVYSLISFDNPDGGVWKQGFDITYESNEWDTEPLQVFVVPHSHNDPGWLKTFNDYFRDKTQYIFNNMVLKLKEDSRRKFIWSEISYLSKWWDIIDIQKKDAVKSLIENGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLENNIGVKPRSGWAIDPFGHSPTMAYLLNRAGLSHMLIQRVHYAVKKHFALHKTLEFFWRQNWDLGSVTDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHPGNVQSRARMLLDQYRKKSKLFRT-KVLLAPLGDDFRYCEYTEWDLQFKNYQQLFDYMNSQSKFKVKIQFGTLSDFFDALDKADETQRDKGQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESHLRAAEILYYFALRQAHKYKI---NKFLSSSLYTALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLM------------VLEKIIGNSAFLLILKDKLTYDSYSPDTFLEMDLKQKSQDSLPQKNIIRLSAE-PRYLVVYNPLEQDRISLVSVYVSSPT----VQVFSASGKPVEVQVSAVWDTANTISETAYEISFRAHIPPLGLKVYKILESASSNSHLADYVLYKNKVEDSGIFTIKNMINTEEG-----ITLENSFVLLRFDQ-TGLMKQMMTKEDGKHHEVNVQFSWYGTTIKRDKSGAYLFLPDGNAKPYVYTTPPFVRVTHGRIYSEVTCFFDHVTHRVRLYHIQGIEGQSVEVSNIVDIRKVYNREIAMKISSD-IKSQNRFYTDLNGYQIQPRMTLSKLPLQANVYPMTTMAYIQ----DAKHRLTLLSAQSLGV---------SSLNSGQIEVIMDRRLMQDDNRGLEQGIQDNKITANLFRILLEK----RSAVNTEEEKKSVSYPSLLSHITSSLMNHPVIPMANKFSSPTLELQGEFSPLQS-SLPCDIHLVNLRTIQSKVGNGHSNEAALILHRKGFDCR--FSSKGTGLFCSTTQGKILVQKLLNKFIVESLTPSSLSLMHSPPGTQNISEINLSPMEISTFRIQL 1143          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|P28494|MA2A1_RAT (Alpha-mannosidase 2 OS=Rattus norvegicus OX=10116 GN=Man2a1 PE=1 SV=2)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 397/1052 (37.74%), Postives = 606/1052 (57.60%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL-------KKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAI-KMSQFVFTYAAQRILQN-NIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQ-LAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSL-LNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNT--IVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSY-QLMNDLIYP-VHQMFVKTNFTNSVPS---NLVGQKSLLTGYGLPCDYHLINFKTNINEIPK-------LTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y+ + F + DGGVWKQGF ++Y  ++  +  L+VFVVPHSH DPGW+KT ++YF+D TQ I N+M+  L ++ + KFI +E+ Y  KWW+ I   +K+ VK L++N QLEIVTGGWVM DEAT HY ++I+QL +GH WL+ NL   P +GWAIDPFG+S  M YLLK++G ++M+IQRVHY +KK  +  K LEF W+Q WD  +   I CHMMPF+SYD+PHTCGPDP ICCQFDF R+   R  CPWG  P  I+  NV+ RA+MLLDQYRKK+ L+     +L PLGDDFR+    EW +QYRNY +L  YMN Q    V+I+FG LSDYFD+L       KK    +FP+LSGD F+YADR DHYW+GYFTSRPF K +DRI+ + LR AEI+  L+L    KYK      F  S  +  +  +RR L LFQHHDA+ GT+K  VVVD+  +L  ++  + + +   A   IL++  +  S   +   ++D  +S  +   K N I +     RY+ ++N   Q R  +V + +   T    +K++    + ++ Q++ +++ +   +   + V+F  ++ PL  +  +IL     ++  SS H+  Y + N+    ++     +N +     + ++NS   L  +  +G +E V       + +L + F  YG    R+ SGAYLF+PDG+G    + SL T  +    G +Y +V    +  +H ++L+ + G+   ++++ NIVDIR   N EI M I +  +   + ++ D N +Q   R+T  K+P+Q NVYPM+  +YI+    D+  ++ LLS QS G     ++  G     IEVF+DR L QDDNRGL + + DN++ +  +R+L E     ++G N E  + +  SY  L++ +    ++  F+    +  +PS    L+ +  LL    LPCD HL+N +T  +++ K       L +HR   +C     + G  C   + K  + K +F++ +++     SLS      D     ++ ++ M+I T  +  
Sbjct:  130 MLDVYDLIPFDNPDGGVWKQGFDIKYEADEWDREPLQVFVVPHSHNDPGWLKTFNDYFRDKTQYIFNNMVLKLKEDSSRKFIWSEISYLAKWWDIIDNPKKEAVKSLLQNGQLEIVTGGWVMADEATTHYFALIDQLIEGHQWLEKNLGVKPRSGWAIDPFGHSPTMTYLLKRAGFSHMLIQRVHYSVKKHFSLQKTLEFFWRQNWDLGSTTDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYRKKSKLFRT-KVLLAPLGDDFRFSEYTEWDLQYRNYEQLFSYMNSQPHLKVKIQFGTLSDYFDALEKSVAAEKKGGQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRLRTAEILYHLALKQAQKYKI---NKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGDSAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPKKNIIQLSAQEPRYLVVYNPFEQERHSVVSVRVNSAT----VKVLSDLGKAVEVQVSAVWKDMRTTSQAAYEVAFLAHLPPLGLKVYKIL-----ESQSSSSHLADYFLYNNDGQAESGIFHMKNMVDSGDAITIENSFLTLGFDR-SGLMEKVRRKEDNKQQELKVQFLWYGTTNKRDKSGAYLFLPDGQGQ--PYVSLRTPFVRVTRGRIYSDVTCFLEHVTHKVRLYHIQGIEGQSMEVSNIVDIRSVHNREIVMRISSK-INNQNRYYTDLNGYQIQPRRTMAKLPLQANVYPMSTMAYIQ----DAAHRLTLLSAQSLG---ASSMASGQ----IEVFMDRRLMQDDNRGLGQGVHDNKITANLFRILLEK----RNGMNMEEDKKSPVSYPSLLSHMTSAFLNHPFLPMVLSGQLPSPAIELLSEFRLLQS-SLPCDIHLVNLRTIQSKVGKGYSDEAALILHRKVFDCQLSSRAMGLPCSTTQGKMSIPK-LFNNFAVESFIPSSLSLMHSPPDAQNTSEVSLSPMEISTSRIRL 1147          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|Q8BRK9|MA2A2_MOUSE (Alpha-mannosidase 2x OS=Mus musculus OX=10090 GN=Man2a2 PE=1 SV=2)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 400/1053 (37.99%), Postives = 597/1053 (56.70%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQS---LLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQ--IIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISDTYC--SSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGY-----GLPCDYHLINFKTNINE--IP----KLTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  + E L F + +GGVW+QGF + Y+  D     L+VFVVPHSH DPGWIKT D+Y+ + TQ ILNSM+  L ++P  +F+ AEV +F KWW+ IS  ++  V++L+ N QLEI TGGWVM DEA +HY ++++QL +GH WL+ NL  TP +GWA+DPFG+S  MPYLL+++ + +M+IQRVHY IKK  A++  LEF W+Q WDS++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ NV  RA +LLDQYRKK+ L+   N +LVPLGDDFRY   +EW  Q+ NY +L D++N + E++V+ +FG LS+YFD+L K        +   FP LSGD FSYADR+DHYWTGY+TSRPF K LDR+L  HLR AEI+ SL+L +    + GL+  +  S   LL E    +RRTL LFQHHDA+ GT+K  VVVD+  +LL ++   + V   AA  ++  +     FD       +D+ +   +   +   I + ++  R+V +FN L Q R  L  + + V++ R  ++++    Q +  QI+  +  A +   + + VS  + +  L    V  L   +   Y   SSV ++L  +K S++ +  F V   +S  + + +  N   ++  +  TG ++ +  +  + + ++ + F  YG R S++ SGAYLF+PD E           +   EG  + EV    + F  +++L+ + G+   ++D+   VDIR   N E+++ I TD +     FF D N FQ   R+   K+P+Q N YPM   +YI+    DS R++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + L DN++    +RLL E    +    ++E  E + S   L++ L      M++ T       +   G    L  +      LPCD+HL+N +    E  +P     L +HR   +C     + G +C   + K  L  S+F  + + ++   SL+    +       DI +  M+I T+ +  
Sbjct:  131 MLTVSEDLPFDNVEGGVWRQGFDISYSPNDWDTEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKSRLF-RSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQAQFGTLSEYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEILYSLALAHAR--RSGLAGQYPLSDFALLTE----ARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQVIINAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHDALPERTVIRLDSS-PRFVVVFNPLEQER--LSVVSLLVNSPR--VRVLSEEGQPLSVQISVHWSSATDMVPDVYQVSVPVRLPGLGLG-VLQLQPDLDGPYTLQSSVRVYLNGVKLSVSRQSAFPVRVVDSGASDFAI-SNRYMQVWFSGLTGLLKSIRRVDEEQEQQMELEFLVYGTRTSKDKSGAYLFLPDSEAKPYVPKKPPVLRVTEGPFFSEVAVYYEHFHQVIRLYNLPGVEGLSLDMSFQVDIRDYVNKELALRIHTD-IDSQGTFFTDLNGFQIQPRQYLKKLPLQANFYPMPVMAYIQ----DSQRRLTLHTAQALGV---SSLGNGQ----LEVILDRRLMQDDNRGLGQGLKDNKITCNRFRLLLERRTTMSPEVHQE-QERSTSYPSLLSHLT----SMYLSTPPLVLPVAKRQGTSPALRSFHPLASPLPCDFHLLNLRMLPAEDTLPATDSALILHRKGFDCGLEAKNLGFNCTTSQGKLAL-GSLFHGLDVTFLQPTSLTLLYPLASPSNSTDISLEPMEISTFRLRL 1151          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|P27046|MA2A1_MOUSE (Alpha-mannosidase 2 OS=Mus musculus OX=10090 GN=Man2a1 PE=1 SV=2)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 393/1052 (37.36%), Postives = 600/1052 (57.03%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL-------KKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAI-KMSQFVFTYAAQRILQN-NIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQ-LAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSL-LNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSY-QLMNDLIYP-VHQMFVKTNFTNSVPS---NLVGQKSLLTGYGLPCDYHLINFKTNINEIPK-------LTIHRLKLNCYAGYISEG---SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y+ + F + DGGVWKQGF ++Y  ++     L+VFVVPHSH DPGW+KT ++YF+D TQ I N+M+  L ++ + KF+ +E+ Y  KWW+ I   +K+ VK L++N QLEIVTGGWVM DEAT HY ++I+QL +GH WL+ NL   P +GWAIDPFG+S  M YLLK++G ++M+IQRVHY IKK  +  K LEF W+Q WD  +   I CHMMPF+SYD+PHTCGPDP ICCQFDF R+   R  CPWG  P  I+  NV+ RA+MLLDQYRKK+ L+     +L PLGDDFR+    EW +Q RNY +L  YMN Q    V+I+FG LSDYFD+L       KK    +FP+LSGD F+YADR DHYW+GYFTSRPF K +DRI+ + +RAAEI+  L+L    KYK      F  S  +  +  +RR L LFQHHDA+ GT+K  VVVD+  +L  ++  + + +   A   IL++  +  S   +   ++D  +S  +   +   I +     RY+ ++N   Q R  +V I +   T    +K++    + ++ Q++ ++  +   +   + VSF  +I PL  +  +IL     ++  SS H+  Y + N+    +N     +N +     + ++N    +  +  +G +E V       +++L + F  YG    R+ SGAYLF+PDG+G          +    G +Y +V    +  +H ++L+ + G+   ++++ NIV+IR   N EI M I +  +   + ++ D N +Q   R+T  K+P+Q NVYPM   +YI+    D+  ++ LLS QS G     ++  G     IEVF+DR L QDDNRGL + + DN++ +  +R+L E     +S  N E  + +  SY  L++ +    ++  F+    +  +PS    L+ +  LL    LPCD HL+N +T  +++ K       L +HR   +C   + S G    C   + K  ++K +F+  +++ +   SLS      D     ++ ++ M+I T+ +  
Sbjct:  130 MLDVYDLIPFDNPDGGVWKQGFDIKYEADEWDHEPLQVFVVPHSHNDPGWLKTFNDYFRDKTQYIFNNMVLKLKEDSSRKFMWSEISYLAKWWDIIDIPKKEAVKSLLQNGQLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLEKNLGVKPRSGWAIDPFGHSPTMAYLLKRAGFSHMLIQRVHYAIKKHFSLHKTLEFFWRQNWDLGSATDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYRKKSKLFRT-KVLLAPLGDDFRFSEYTEWDLQCRNYEQLFSYMNSQPHLKVKIQFGTLSDYFDALEKAVAAEKKSSQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRIRAAEILYQLALKQAQKYKI---NKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGDSAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPQKIIIQLSAQEPRYLVVYNPFEQERHSVVSIRVNSAT----VKVLSDSGKPVEVQVSAVWNDMRTISQAAYEVSFLAHIPPLGLKVFKIL-----ESQSSSSHLADYVLYNNDGLAENGIFHVKNMVDAGDAITIENPFLAIWFD-RSGLMEKVRRKEDSRQHELKVQFLWYGTTNKRDKSGAYLFLPDGQGQPYVSLRPPFVRVTRGRIYSDVTCFLEHVTHKVRLYNIQGIEGQSMEVSNIVNIRNVHNREIVMRISSK-INNQNRYYTDLNGYQIQPRRTMSKLPLQANVYPMCTMAYIQ----DAEHRLTLLSAQSLG---ASSMASGQ----IEVFMDRRLMQDDNRGLGQGVHDNKITANLFRILLEK----RSAVNMEEEKKSPVSYPSLLSHMTSSFLNHPFLPMVLSGQLPSPAFELLSEFPLLQS-SLPCDIHLVNLRTIQSKMGKGYSDEAALILHRKGFDCQ--FSSRGIGLPCSTTQGKMSVLK-LFNKFAVESLVPSSLSLMHSPPDAQNMSEVSLSPMEISTFRIRL 1147          
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Match: sp|P49641|MA2A2_HUMAN (Alpha-mannosidase 2x OS=Homo sapiens OX=9606 GN=MAN2A2 PE=2 SV=3)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 403/1057 (38.13%), Postives = 592/1057 (56.01%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKY----KYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISD---TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYG----------LPCDYHLINFKTNINE---IP----KLTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTY 3127
            M  + E L F + DGGVW+QGF + Y   D     L+VFVVPHSH DPGWIKT D+Y+ + TQ ILNSM+  L ++P  +F+ AEV +F KWW+ I+  ++  V++L+ N QLEI TGGWVM DEA +HY ++I+QL +GH WL+ NL  TP +GWA+DPFGYS  MPYLL+++ + +M+IQRVHY IKK  A++  LEF W+Q WDS++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ NV  RA +LLDQYRKK+ L+   N +LVPLGDDFRY   +EW  Q+ NY +L D+ N +   +V+ +FG LSDYFD+L K        +   FP LSGD FSYADR+DHYWTGY+TSRPF K LDR+L  HLR AE++ SL+  +  +     +Y LS     +LL E    +RRTL LFQHHDA+ GT+K  VVVD+  +LL ++   + V  +AA  ++  +     FD       VD+ +   +   +   I + ++  R+V LFN L Q R  +V   + V++ R  ++++    Q +  QI+  +  A E   + + VS  + +   A     +      D   T  SSV I+L+  + S++  + F +   +S  + +  L N   ++  +  TG ++ +  +  + + ++++    YG R S++ SGAYLF+PDGE           +   EG  + EVVA  +     ++L+ + G+   ++DI ++VDIR   N E+++ I TD +     FF D N FQ   R+   K+P+Q N YPM   +YI+    D+ +++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + L DN+     +RLL E          +  G    S  Q  +   YP     + + + N+    L   +  L G G          LPCD+HL+N +T   E   +P     L +HR   +C     + G +C   + K  L  S+F  + + ++   SL+    +       D+ +  M+I T+
Sbjct:  131 MLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINVQKRAAVRRLVGNGQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGYSSTMPYLLRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAERAALLLDQYRKKSQLF-RSNVLLVPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEPGARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHARRSGLAGRYPLSDF---TLLTE----ARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVIIHAAHYLVLGDKETYHFDPEAPFLQVDDTRLSHDALPERTVIQLDSS-PRFVVLFNPLEQERFSMVS--LLVNSPR--VRVLSEEGQPLAVQISAHWSSATEAVPDVYQVSVPVRLP--ALGLGVLQLQLGLDGHRTLPSSVRIYLHGRQLSVSRHEAFPLRVIDSGTSDF-ALSNRYMQVWFSGLTGLLKSIRRVDEEHEQQVDMQVLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLRVTEGPFFSEVVAYYEHIHQAVRLYNLPGVEGLSLDISSLVDIRDYVNKELALHIHTD-IDSQGIFFTDLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQ----DAQKRLTLHTAQALGV---SSLKDGQ----LEVILDRRLMQDDNRGLGQGLKDNKRTCNRFRLLLE---------RRTVG----SEVQDSHSTSYPSLLSHLTSMYLNAPALALPVARMQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAETALILHRKGFDCGLEAKNLGFNCTTSQGKVAL-GSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEPMEIATF 1145          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: R7UWP9 (Alpha-mannosidase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_167403 PE=3 SV=1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 415/1020 (40.69%), Postives = 598/1020 (58.63%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQI--IFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIF-QLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSV--HIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQ-LKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEIPKLT-IHR----LKLNCYAGYISEG----SCKFLRKKSPLMKSMFDDVSIKYVNKFSLS 3055
            M  +Y+ L F + DGG WKQGF + Y+        LKVFVVPHSH DPGW+KT D Y+ + T+ IL++ML+ L   P M+FI+AE+ +F  WW  IS +++ +VK LIK  +LE+VT GWVMTDEA AHY +M++QL +G+ WL N++   P +GWAIDPFGYS  MPYLLK+SG NNM+IQRVHY +KK LA  K+LEFRW+Q WD      + CH+MPF+SYDVPHTCGPDP +CCQFDF R+   +  CPW   PV IT +NV  RAEMLLDQYRKKA+LY N N VL+PLGDDFR+    EW  QY NY +L D++N     N + +FG LSDYF +L +       +  + +P LSGD FSYADR DHYWTGYFTSRPF K LDRIL  +LR AEI+ SL++ Y  K +      F +  L + +  +RR+L LFQHHDA+ GT+K  V+VD+ ++LL+A++  + V T +A  +L  +  +  +      FDVD  +S  +       I + ++    V  +NSLS  R  ++   + V+T  + +    SGN +I  Q++P +    E ++  + + F +++ PL      I  T +   + +++     L +++ +      F +   +    K   ++NS      ++ TG ++ V    S  +  + + F +YG  R++E SGAYLF+PDG+   IE++   T V  +G L  EV        HI++L    GL S ++++ NIVDI KE+N E+ M + +D V   D+ F D N FQ  +RKT+ K+P+Q NVYPM   +YI+    D  +++ LLS QS GV        G    ++EVF DR L+QDDNRGL + ++DN+     +R++FE  K+  KS  N+  G  ++ +    ++LI+PVH + VK  F +S       Q        LPC+ HL+N ++   +  +L  I R    L L  +A   S      +C     K   + S+F+D+ IK      LS
Sbjct:    1 MQNVYDQLPFKNIDGGAWKQGFSISYSDTQFSSQPLKVFVVPHSHCDPGWVKTFDRYYSEQTRHILDNMLEKLEAYPKMRFIYAEISFFSMWWQEISVDKQRRVKNLIKEGRLELVTAGWVMTDEANAHYYAMLDQLIEGNQWLLNHIGVIPESGWAIDPFGYSPTMPYLLKRSGFNNMLIQRVHYEVKKYLAEEKKLEFRWRQTWDHSGTTDMFCHLMPFYSYDVPHTCGPDPKVCCQFDFKRLPGGKVSCPWNVPPVPITPQNVADRAEMLLDQYRKKAMLYKN-NVVLIPLGDDFRFDKAVEWDQQYSNYQQLFDFINNTPRLNAQAQFGTLSDYFHALHERAGTAVNEVPESYPVLSGDFFSYADRDDHYWTGYFTSRPFYKRLDRILEANLRGAEILYSLAVSYARKLQLA---NFPEKQLMQPLVMARRSLGLFQHHDAITGTAKDFVMVDYGHKLLSALQNMKTVITESAHFLLVKDRTHYVYSSTRPFFDVDETRSTHDSLPAKTTI-VLSDKPVPVAFYNSLSHTRNCVIR--LYVNTPHVEVHD-PSGN-VIVSQVDPFWVSNEEMSSELYKLHFVVSVPPLGLASYSITKTAVGSNHKNTLGSTTFLNSVRKAKLINNAFLI---DVFDGKEFSIQNSEMTASFSAATGMLKHVTSKSSNQEVDVALQFLRYGVARTKEKSGAYLFLPDGQAQPIEYNKPFTRV-IQGPLVSEVHVIIPNVEHIVRLHNSPGLDSLSLEVSNIVDISKETNKELIMRVISD-VQNGDQLFTDLNGFQIHQRKTYSKLPLQANVYPMPTMAYIQ----DHHKRLSLLSAQSLGV-------AGLQSGWLEVFQDRRLSQDDNRGLGQGVLDNKRTPTKFRMMFEFLKEDAKSPPNQAAGYPSLQAQLASSELIHPVHVLPVKNPFGSSAQLAPTFQP---LSQQLPCEVHLVNLRSLQGDTAELEFIPRQDFGLILQTHAADCSLPTRGLTCPTTAAKI-TIGSLFEDIRIKEAKSSILS 991          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: A0A3Q2UIM7 (Alpha-mannosidase OS=Gallus gallus OX=9031 GN=MAN2A1 PE=3 SV=1)

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 414/1058 (39.13%), Postives = 610/1058 (57.66%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKD-------KIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIG----------IKIMGSGNQLIKCQINPIFQLAEFNNNQHF-VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKN--FQVSS-ENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEF-TVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEI-------PKLTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y+ L F + DGGVWKQGF + Y   +     L+VFVVPHSH DPGW+KT D+YF+D TQ ILN+M+  L ++   KFI +E+ YF KWW+ I   ++D VK+LIK+ Q EIVTGGWVM DEA+AHY S+I+QL +GH WL+ NL   P +GWA+DPFG+S  M YLLK++G +NM+IQR+HY +KK  ++ K LEF W+Q WD  +   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  I   N++ RA M+LDQYRKK+ L+     +L PLGDDFRY    EW  QY+NY KL DYMN   E++V+ +FG LSDYF++L+K+          +FP LSGD F+YADR  HYW+GYFTSRPF K LDR+L +HLRAAEI+ SL+LI    +KY   +VF     ++ +  +RR L LFQHHDA+ GTSK  VVVD+  +L +++   + V   +A  ++  + G   +D       +D+++S  +       I +              SQPR LL+H P   D ER            +K++    + +  QI+ ++  A   +++ + VSF  ++ PL     ++L    S+   +  +I++   ++S+  K +  F++   +NS+ N  ++L+NS  KL  + T+G +E +        +++ + F  YG   +R+ SGAYLF+PDG+     F    T+    G+++ EVV      +H ++L+ V GL   ++++ NIVDIR E N E++M I +D +   + F+VD N +Q   R T  K+P+Q N+YPMT  +YI+    DS  ++ L S QS GV   K          +EV +DR L QDDNRGL + + DN++ +  +RLL E        + K    F ++ S+   + L +PV  M   TN  + VP  L     L++   +PCD H++N +T  +++         L +HR   +C       G  C   + K  + K +F+  S++ +   SLS      D     +I M+ M+I+T+ +  
Sbjct:  133 MLDVYDILPFDNPDGGVWKQGFDITYNENEWDSAPLQVFVVPHSHNDPGWLKTFDDYFRDQTQHILNNMVIKLQEDNRRKFIWSEISYFSKWWDGIDSQRRDAVKRLIKDGQFEIVTGGWVMPDEASAHYFSLIDQLIEGHQWLERNLGVKPKSGWAVDPFGHSPTMAYLLKRAGFSNMLIQRIHYSVKKYFSAQKTLEFFWRQNWDLGSSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRVSCPWRVPPEAIHSGNIQHRAWMILDQYRKKSKLF-RTKVLLAPLGDDFRYAESSEWDQQYQNYQKLFDYMNTHPEFHVKAQFGTLSDYFEALRKESNLGEGSSSPLFPVLSGDFFTYADRDHHYWSGYFTSRPFYKRLDRVLESHLRAAEILYSLALI--QSHKYNKMSVFPSVDNYKLLTEARRNLGLFQHHDAITGTSKDWVVVDYGTRLFHSLMNVKKVIIDSAHILILKDKGAYNYDTSTPFLKMDDVQSSQDSLPHKTVIKLT-------------SQPRYLLIHNP--TDQERFSVVSVIVSSPRVKLLSPLGKPVTVQISAVWDGATTVSHEAYQVSFLAHLPPLGLGVYQLLEVPSSEANLAEYNIYMSG-RDSVQEKSDRIFKIKEMQNSVDN--IILENSYMKLWFSGTSGLLEKINTKEDGKNHQMKVEFAWYGTTSNRDKSGAYLFLPDGDAKPYIFTDPPTVRVAHGKIFSEVVCFFHHVTHTMRLYNVQGLEGQSLEVSNIVDIRGEYNRELAMRISSD-INSRNRFYVDLNGYQIQPRLTMSKLPLQANIYPMTTMAYIQ----DSGVRLTLHSAQSLGVASLKN-------GQLEVIMDRRLMQDDNRGLGQGVQDNKITANVFRLLLERRHGTDVNEEKASVSFPSLLSHMTSSFLNHPVIPM--TTNADSGVPEMLNMFSPLMS--SMPCDIHIVNLRTIQSKVDTEPSDEAALILHRKGFDCRFSNRDVGLLCSTTQGKVRVHK-LFNKFSVESLTPASLSLMHSPPDARNMSEINMSSMEINTFRIRL 1152          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: A0A2I0UFF9 (Alpha-mannosidase OS=Limosa lapponica baueri OX=1758121 GN=llap_4919 PE=3 SV=1)

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 412/1049 (39.28%), Postives = 612/1049 (58.34%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKD-------KIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYK--YGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF-VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSS-ENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEF-TVSSYQLMNDLIYPVHQMFVKTNFTNS-VPSNLVGQKSLLTGYGLPCDYHLINFKTNINEI-------PKLTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y+ L F + DGGVWKQGF + Y   +     L+VFVVPHSH DPGW+KT D+YF+D TQ ILN+M+  L ++   KFI +E+ YF KWW+ I   +KD VK+LIK+ Q EIVTGGWVM DEA+ HY ++I+QL +GH WL+ NL   P +GWA+DPFG+S  M YLLK++G +NM+IQRVHY +KK  A+ K LEF W+Q WD  +   I CHMMPF+SYD+PHTCGPDP ICCQFDF R+   R  CPW   P  I   NV+ RA M+LDQYRKK+ L+     +L PLGDDFRY    EW  QY+NY KL DYMN   EW+V+ +FG LSDYF++L+K+           FP LSGD F+YADR  HYW+GYFTSRPF K LDR+L ++LRAAEI+ SL+L+  +K +      +V N  LL E    +RR L LFQHHDA+ GTSK  VVVD+  +L ++I   + V   +A  ++  + G   +D       +D+++S  +   +   I + T+  RY+ ++N   Q R  +V   + V++ R  IKI+    + +  QI+ ++  A   +++ + +SF +++ PL     ++L    S+   +  ++++ N +      K F+++  +NS+ N  ++L+NS  KL  +  +G +E +        +++ + F  YG   +R+ SGAYLF+PDG+     F    TI    G+++ EVV      +H ++L+KV GL   ++++ NIVDIR E N E++M I +D +   + F+ D N +Q   R T  K+P+Q N+YPMT  +YI+    D   ++ L S QS GV   K          +EV +DR L QDDNRGL + + DN++ +  +RLL E        ++K    F ++ S+   + L +PV  M   T + ++ VP  L     L++   +PCD H++N +T  +++         L +HR   +C       G  C   + K  + K +F+   ++ +   SLS      D     +I M+ M+I+T+ +  
Sbjct:  125 MLDVYDILPFDNPDGGVWKQGFDITYNENEWDSEPLQVFVVPHSHNDPGWLKTFDDYFRDQTQHILNNMVIKLQEDNRRKFIWSEISYFSKWWDAIDSQKKDAVKRLIKDGQFEIVTGGWVMPDEASPHYFALIDQLIEGHQWLEKNLGVKPKSGWAVDPFGHSPTMAYLLKRTGFSNMLIQRVHYSVKKHFATQKTLEFFWRQNWDLGSSTDILCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRVSCPWRVPPEAIHAGNVQHRAWMILDQYRKKSKLF-RTKVLLAPLGDDFRYAESSEWDQQYQNYQKLFDYMNSHPEWHVKAQFGTLSDYFEALRKESNLGEKSSNSFFPVLSGDFFTYADRDHHYWSGYFTSRPFYKRLDRVLESYLRAAEILYSLALVQSSKSEKMSVFPSVDNYKLLTE----ARRNLGLFQHHDAITGTSKDWVVVDYGTRLFHSIMNLKKVIIDSAHILILKDKGAYNYDTSTPFLKMDDVQSSQDSLPRKTVIKL-TSQPRYLLIYNPTEQERFSVVS--VNVNSPR--IKILSPVGKPVTVQISAVWDGATTVSHEAYQISFVVHLPPLGLGVYQMLEVQSSEAVLADYNLYMRNSRQEKP-DKLFKITEMQNSVDN--IILENSYMKLWFSGMSGLLEKINTKEDGKNHQMKVEFAWYGTTSNRDKSGAYLFLPDGDAKPYIFTDPPTIRVSHGKIFSEVVCFFHHVTHTMRLYKVQGLEGQSLEVSNIVDIRGEYNRELAMRISSD-INSQNRFYTDLNGYQIQPRLTMSKLPLQANIYPMTTMAYIQ----DVGVRLTLHSAQSLGVASLKN-------GQLEVIMDRRLMQDDNRGLGQGVQDNKITANIFRLLLERRYGTDVNEDKASVSFPSLLSHMTSSFLNHPVIPM---TTYADAGVPEMLNTFSPLMS--SMPCDMHIVNLRTIQSKVDIEPSDEAALILHRKGFDCRFSNRDTGLLCSTTQGKIKVHK-LFNKFRVESLTPTSLSLMHSPPDARNISEINMSSMEINTFRIRL 1142          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: A0A0R4IVS5 (Alpha-mannosidase OS=Danio rerio OX=7955 GN=man2a1 PE=1 SV=1)

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 400/1056 (37.88%), Postives = 601/1056 (56.91%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK----DKIKM------FPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF-VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVS------SYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT--------NINEIPKLTIHRLKLNCYAGYISEGS---CKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y+ L F + DGGVWKQGF + Y   +     L+VFVVPHSH DPGW+KT D+Y++D TQ ILN+M+  L ++   K I +E+ YF KWW++I   ++D V++L++N QLE+ TGGWVM DEA AHY +MI+QL +GH WL+ NL   P TGWA+DPFG++    YLLK +G++NM+IQRVHY +KK  +S K LEF W+Q WD ++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  ITD NV+ RA+ LLDQYRKK+ L+     +L PLGDDFRY    EW  Q+ NY KL DYMN   E +V+ +FG +SDYF +L+K    D + M       P +SGD F+YADR DHYW+GYFTSRPF K +DR+L ++LRAAE++ SL+L   N  KYG  + +     ++ +  +RR L LFQHHDA+AGT K  VVVD+  +L ++I   + V   +A  ++  +      D  +    +D+++   +   + N + +     R + + N L Q R  +V + +        ++++ +  Q+++ Q++ +++ A       F +SF  +  PL     +++      T  S         + S +  ++F+   ++      VV++N   +L I+  TG +E +     +S++++ + F  YG   S++ SGAYLF+PD E +I        I   +G L+ EV       +H L+L+   G+   +++I N VDIR E+N EI+M I +D  +  D FF D N +Q   RKT  K+P+Q N YPMT   Y++    DS+ ++ LL+ QS G    K+         +EV +DR LNQDDNRGL + ++DN++ +  +RLL E  K++   +N+    ++        SY  +N   +P+  M V  +     PS +V    L   +  PCD HL+N +           +E   L +HR   +C  G+ +  +   C   R K  L K +  D+ +K +   SLS    +  + +P++I +  M+I TY +  
Sbjct:  129 MLDVYDLLRFDNPDGGVWKQGFDISYQENEWDNEPLQVFVVPHSHNDPGWLKTFDDYYRDQTQHILNNMVVKLHEDSRRKMIWSEISYFAKWWDSIDGQKQDAVRRLVENGQLEVATGGWVMPDEANAHYFAMIDQLVEGHQWLERNLGVKPKTGWAVDPFGHTATQAYLLKLAGLSNMLIQRVHYSVKKHFSSQKTLEFFWRQNWDQDSSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRISCPWRIPPQAITDNNVQERAQTLLDQYRKKSKLFRT-KVLLAPLGDDFRYTEAVEWDQQFENYQKLFDYMNSHPELHVKAQFGTISDYFQALRKSTGMDPVGMNVGHLALPVVSGDFFTYADRDDHYWSGYFTSRPFYKRMDRMLESYLRAAEVLYSLTLA--NIQKYGQPSDYPAGENYKLLTEARRNLGLFQHHDAIAGTGKDWVVVDYGTRLFHSILNVKRVIVSSAHWLVLKDKQTYHNDPSKAFLQMDDVQQSQDALPRKNVLEVH-GKPRLLVVSNPLEQARTSMVTVYVNTPN----VRVVSALGQVVRAQVSAVWKDASHATADVFQLSFVAHAAPLGLSVYQLIEVMEPRTDASKYMFLQEGRQLSDSKLEHFRQFYQDD--GAPVVIENPHLRLSISGATGLLEKMMLKEDESEHQMKVEFVWYGTTSSKDKSGAYLFLPDKEATIYSPSQPPVIRVTKGTLFSEVTTTFAHITHTLRLYNTQGVEGQSVEICNTVDIRGETNREIAMRITSDLNS-KDRFFTDLNGYQVQPRKTMAKLPLQANFYPMTSMLYLQ----DSSARLSLLTAQSLGAASLKS-------GQLEVIMDRRLNQDDNRGLGQGVLDNKITANSFRLLLE--KRISVEENEATAPYSYPSILSHMSYMYLN---HPLISMAVSQHL--EAPS-VVPYSPLKASF--PCDMHLVNLRAIQSKEEGGAASEQAALILHRKGFDC--GFSNRNTGLLCTSTRGKIDLEK-LLTDLKVKSITPVSLSLMHTLSSESRPQEISLKAMEIRTYRLEL 1149          
BLAST of Alpha-mannosidase vs. TrEMBL
Match: A0A2Y9JRQ0 (Alpha-mannosidase OS=Enhydra lutris kenyoni OX=391180 GN=LOC111148294 PE=3 SV=1)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 412/1047 (39.35%), Postives = 602/1047 (57.50%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRII--YFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKI-------KMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRIL---QNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAE-FNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFK-KNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDL--IYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEI-------PKLTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y  + F + DGGVWKQGF + Y   +     L+VFVVPHSH DPGW+KT D+YF++ TQ I N+M+  L ++   KF+ +E+ Y  KWW+TI K +KD +K L++N Q EIVTGGWVM DEA AHY ++I+QL +GH WL+ NL   P +GW+IDPFG+S  M YLLK++G ++M+IQRVHY IKK  A  K LEF W+Q WD  +   I CHMMPF+SYD+PHTCGPDP ICCQFDF R+    F CPWG  P  I   NV+ RAEMLLDQYRKK+ L+     VL PLGDDFRY    EW  QY+NY  L DYMN   E+NV+I+FG LSDYFD+L K+ +        MFP LSGD F+YADR DHYW+GYFTSRPF K +DRIL +HLRAAEI+   +L    KYK    + F  S  +  +  +RR L LFQHHDA+ GT+K  VVVD+  +L +++   + +  Y+A  ++   +N+  +  FD ++ D+D LK  S+       + + +   RY+ + N   Q R  +V + +   T ++      +  + ++ Q++ ++  A   +   + +SF + I PL  +   IL +  SD + +   +H  NIK+   F  KN + + E+      ++L+NS  KL     +G +E + +     ++++ + F  YG    ++ SGAYLF+PDGE     + +L  +    G  Y +V    +  +H ++L+ + G+   ++++ NIVDIRKE N EI+M I +  +   + F+ D N +Q   R T  K+P+Q NVYPMT  +YI+    D+  ++ LLS QS GV   K+         IEV +DR L QDDNRGL + + DN+V +  +R+L E     +S  N E  + +VS   L++ +   +  H +F  T         L+G+ S L    LPCD HLIN +T  +++         L +HR   +C       G      +   L++ +F   ++  +   SLS      D     +I ++ M+I T+ +  
Sbjct:   83 MLDVYSLIPFDNPDGGVWKQGFDISYLFNEWDSKPLQVFVVPHSHNDPGWLKTFDDYFREMTQYIFNNMVIKLKEDSRRKFMWSEISYLSKWWDTIDKPKKDAIKSLLQNGQFEIVTGGWVMPDEAAAHYFALIDQLIEGHQWLEKNLGVKPRSGWSIDPFGHSPTMAYLLKRAGFSHMLIQRVHYAIKKHFALHKTLEFFWRQNWDLGSGTDIFCHMMPFYSYDIPHTCGPDPKICCQFDFKRLPGGRFGCPWGVPPETIHLGNVQKRAEMLLDQYRKKSKLF-RTTVVLAPLGDDFRYCERTEWDHQYKNYQLLFDYMNSHPEYNVKIQFGTLSDYFDALDKEDVAIRKNSQSMFPVLSGDFFTYADRDDHYWSGYFTSRPFYKRMDRILESHLRAAEILYYFALKQAQKYKI---SKFLSSSHYMTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLTNLKKIIGYSALLLILKDKNSYNSYSFDNLL-DMD-LKQNSQSSLPQKTVIMLSAEPRYLVVCNPSEQERISVVSVYVSSPTAQVS----SASGKPVEIQMSAVWNTASTISQTAYEISFLVQIPPLGLKVYTILESASSDPHLTEYVLHNGNIKDKGIFNMKNVKSTDED------IILENSFVKLRFGQ-SGLMEEMINKEDGKRHEVKVQFSWYGTTSKKDKSGAYLFLPDGEAKPYVYTALPFVRVQHGRFYSDVTCFLEHVTHRVRLYNIQGIDGQSVEVSNIVDIRKEHNREIAMRISSS-INSQNRFYTDLNGYQIQPRMTMSKLPLQANVYPMTTMAYIQ----DAKHRLTLLSAQSLGVSSLKS-------GQIEVIMDRRLMQDDNRGLEQGVHDNKVTANLFRILLEK----RSVVNMEEEKKSVSYPSLVSHVTSFFLNHPVFTMTEKIPVPTLKLLGEFSPLLS-SLPCDIHLINLRTIQSKVDGKHSDEAALILHRKGFDCRFSSRDTGLLCSTTQGKILVQKLFSMFTVTSLIPSSLSLMHSPPDARNISEINLSPMEISTFRIQL 1095          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2a1 (mannosidase alpha class 2A member 1 [Source:NCBI gene;Acc:103023301])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 395/1048 (37.69%), Postives = 599/1048 (57.16%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDK----------IKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD--QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF-VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKN-SMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT-------NINEIPKLTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            M  +Y+ L F + DGGVWKQGF + Y   +     L V VVPHSH DPGW+KT D+YF+D TQ ILN+M+  L+++   K I +E+ YF KWW+ I   ++D VKKLI+  QLEI TGGWVM DEA +HYS+MI+QL +GH WL+ N+   P TGWA+DPFG+S    Y+LK++G++NM+IQRVHY IKK  ++ K LEF W+Q WD ++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ENV+ RA+MLLDQYRKK+ L+     VLVPLGDDFRY   +EW  Q+ NY  L DYMN   E +V+ +FG +SDYF+ L+K                P++SGD F+YADR DHYW+GYFTSRPF K +DRIL +HLRAAEI+ SL+L   +  ++G  + +     ++ + G+RR L LFQHHDA+AGT K  V+VD+  +L +++   + V   +A  ++ ++     +D    +  +D+++   +   +   + I +   R + + N   Q R  +V+I +        ++++ +   L+  QI+ +++ A   + + F +SF  N+ PL    V  L  G+     S+ ++ L +    S++   +F+VS+  + +   V+++N   +L I+++TG ++ ++     S++ + + F  YG   +++ SGAYLF+PDGE           I   +G ++ EV       +H ++L+ V G+    ++I NIVDIR E N EI+M I +D +   D FF D N FQ   R+   K+P+Q N YPMT  +YIE    DS R++ LL+ QS    +G T  K   +   EV +DR LNQDDNRG+ + ++DN++ +  +RL+ E     +    +     +  S +     +Y  H +       +S    L     L + +  PCD HL+N +T         ++   L +HR   +C     + G  C   R K  + + +  ++ +  +   SLS       +   ++I +  M+I TY +  
Sbjct:  131 MMDVYDLLSFDNPDGGVWKQGFDISYEENEWDNEPLHVVVVPHSHNDPGWLKTFDDYFRDQTQHILNNMVVKLLEDVRRKMIWSEISYFAKWWDNIDSQKRDSVKKLIERGQLEIATGGWVMPDEANSHYSAMIDQLLEGHQWLEKNVGVKPRTGWAVDPFGHSSTQAYILKQAGLSNMLIQRVHYSIKKHFSTQKTLEFFWRQNWDHDSSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRISCPWRIPPEPITNENVQQRAKMLLDQYRKKSKLF-RTKVVLVPLGDDFRYTEAQEWDQQFNNYQMLFDYMNSHSELHVQAQFGTISDYFEILRKKAGINEAGMSVGESQLPTVSGDFFTYADRDDHYWSGYFTSRPFYKRMDRILESHLRAAEILYSLALA--STRRFGRPSDYPAVENYKLLTGARRNLGLFQHHDAIAGTGKDWVMVDYGTRLFHSLLNVKRVIASSAHWLVLDDKKAYTYDPSNPVLQIDDVQPAQDSLPRKTVLKI-SKTPRSLVVHNPSEQSRSSVVNIYVNTPH----VRVLTADGHLVIAQISAVWEDATRASTEAFQLSFVANVPPLGLA-VYQLIQGLELQTESAQYLFLKDGGAVSVSGMDHFKVSTPQNAVP--VLIENPHLQLSISASTGLMKTLKLKEDGSEHSVRVEFLWYGTTSNKDKSGAYLFLPDGEAKKYIPSQPPVIRVTKGPVFSEVTTTFTHVTHTVRLYNVKGVDGQAVEISNIVDIRAEFNREIAMRIISD-IGSKDRFFTDLNGFQMQPRRAMAKLPLQANFYPMTSMAYIE----DSLRRLTLLTAQS----LGATSLKSGQL---EVIMDRRLNQDDNRGMGQGVLDNKITANLFRLVLEPRNPTQETKRENTTPLSYPSLRNHISYMYLNHPLMPMATTWDSDMLTLTPYSPLSSSF--PCDIHLVNLRTIQSQEGEGPSDQAALILHRKAFDCNIATSNTGLLCSTTRGKIEI-QELLSELKVSSLEPMSLSLMHESSSRAVDQEITLKPMEIHTYRIQL 1152          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2a2 (mannosidase alpha class 2A member 2 [Source:NCBI gene;Acc:103041860])

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 394/1053 (37.42%), Postives = 589/1053 (55.94%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYK--YGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQI--IFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISD-TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPV--HQMFVKTNFTNSVPSNLVGQKSLLT----GYGLPCDYHLINFKTNINEIPK-------LTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSL----SGNQVIGDKVKPEDICMNLMDIDTY 3127
            M  +Y  L F + DGGVWKQGF++ Y   +     L+VFVVPHSH DPGW+KT D+Y+ D  Q I N+M+  L ++P  KFI +E+ +F KWW++   ++++ ++KLI   QLEIVTGGWVMTDEA AHY +MI+QL +GH WL+ NL   P +GWA+DPFG+S  MPYLLKK+ + +M+IQR+HY IKK  +S++ LEF W+Q WD E+   + CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  ITD NV  RA +LLDQYRKK+ L+     VL+PLGDDFRY    EW  QY NY KL DYMN   E +V+ +FG L+DYF+++ K        +   +P LSGD F+YADR+DHYW+GY+TSRPF K LDRIL +HLR AEI+ SL+ + H ++    G     + SLL +    +RR + LFQHHDA+AGT+K  VV D+  +LL ++   + V   AA  ++  N    +F Q     + D+ ++  +   +   I + ++  RY+ LFN + Q R  L  + + V++ +  ++++    Q +  Q++  +  A + +   +  SF   +  L      +  +  S  T  S   + L     ++       V S+ +    + +   SL  L  + TTG +E +       + ++ + F  YG R S++ SGAYLF+PDG            +   EG L+ EVV   + F   +++  V G+   ++DI  +VDIR ++N E+SM + TD +   D F+ D N FQ   R+ F K+P+Q N YPM   +YI+    DS  ++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + + DN+  +  +RLL E     ++  ++      VS   L++ +   +  H++         +P    G   L T       LPCD+ L+N ++  N+  +       L +HRL L+C     + G +C   + K   + ++F  + ++ +   SL    SG  +    +    I +  M++ TY
Sbjct:  131 MLDVYSLLSFDNVDGGVWKQGFEITYEPSEWDSEPLQVFVVPHSHNDPGWVKTFDKYYNDQMQHIFNNMVVKLAEDPRRKFILSEISFFVKWWDSADAHKQEAIRKLILGGQLEIVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGVIPRSGWAVDPFGHSATMPYLLKKANVTSMLIQRIHYSIKKHFSSTRSLEFMWRQAWDPESGTDLFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAITDANVAERANVLLDQYRKKSKLF-RSKVVLIPLGDDFRYDKSLEWDQQYINYQKLFDYMNSHPEMHVQAQFGTLTDYFNAVYKANGVSQGARPPGYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYSLA-VSHARHAGMEGRYPTSDYSLLTD----ARRNIGLFQHHDAIAGTAKEAVVTDYGTRLLRSLIGLKRVIINAAHFLIMKNKDVYRFYQTEPFLETDDRRATQDSLPQRTLIELDSS-PRYLVLFNPVEQER--LCVVTVLVNSAK--VRVLTEDGQTLPVQLSAQWSSAVQMSGEVYQASFMARLPALGLAVFHLYDSVDSPMTLRSDTLLRLPGRSQTVRGVDPLPVRSQIADPQPFYIQTQSL-TLAFSGTTGLLESIRRKDDPQEVRVQVQFFTYGTRPSKDKSGAYLFLPDGNAKPYTQRDPPIVRVVEGPLFAEVVTYYQHFQQTVRIHNVPGVDGLSLDITTLVDIRDQTNKELSMRLHTD-IQSEDTFYTDLNGFQIQPRRYFQKLPLQANFYPMPTMAYIQ----DSQYRLTLHTAQALGV---TSLASGQ----LEVMLDRRLMQDDNRGLGQGVKDNKRTANRFRLLLER----RTSSSRAVDSGPVSFPSLLSHMTSSILNHEVLA----LPVIPKKR-GVPPLRTFAPLANALPCDFRLLNLRSIQNQDAQSPSLYTALLLHRLGLDCGLEAQNPGFNCTTTQGKL-AVSALFRGLDLQLLQPMSLTLMYSGTPLSNSSI----ISLEPMELSTY 1145          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2a2 (mannosidase alpha class 2A member 2 [Source:NCBI gene;Acc:103041860])

HSP 1 Score: 663.685 bits (1711), Expect = 0.000e+0
Identity = 398/1075 (37.02%), Postives = 598/1075 (55.63%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYK--YGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQI--IFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISD-TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIY--------------PVHQMFVKTNFTNSVPSNLV----------GQKSLLT----GYGLPCDYHLINFKTNINEIPK-------LTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFDDVSIKYVNKFSL----SGNQVIGDKVKPEDICMNLMDIDTY 3127
            M  +Y  L F + DGGVWKQGF++ Y   +     L+VFVVPHSH DPGW+KT D+Y+ D  Q I N+M+  L ++P  KFI +E+ +F KWW++   ++++ ++KLI   QLEIVTGGWVMTDEA AHY +MI+QL +GH WL+ NL   P +GWA+DPFG+S  MPYLLKK+ + +M+IQR+HY IKK  +S++ LEF W+Q WD E+   + CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  ITD NV  RA +LLDQYRKK+ L+     VL+PLGDDFRY    EW  QY NY KL DYMN   E +V+ +FG L+DYF+++ K        +   +P LSGD F+YADR+DHYW+GY+TSRPF K LDRIL +HLR AEI+ SL+ + H ++    G     + SLL +    +RR + LFQHHDA+AGT+K  VV D+  +LL ++   + V   AA  ++  N    +F Q     + D+ ++  +   +   I + ++  RY+ LFN + Q R  L  + + V++ +  ++++    Q +  Q++  +  A + +   +  SF   +  L      +  +  S  T  S   + L     ++       V S+ +    + +   SL  L  + TTG +E +       + ++ + F  YG R S++ SGAYLF+PDG            +   EG L+ EVV   + F   +++  V G+   ++DI  +VDIR ++N E+SM + TD +   D F+ D N FQ   R+ F K+P+Q N YPM   +YI+    DS  ++ L + Q+ GV    ++  G     +EV LDR L QDDNRGL + + DN+  +  +RLL E     ++  ++  G +   S+ ++N +I               PV    + ++ T+S+ ++ V          G   L T       LPCD+ L+N ++  N+  +       L +HRL L+C     + G +C   + K   + ++F  + ++ +   SL    SG  +    +    I +  M++ TY
Sbjct:  131 MLDVYSLLSFDNVDGGVWKQGFEITYEPSEWDSEPLQVFVVPHSHNDPGWVKTFDKYYNDQMQHIFNNMVVKLAEDPRRKFILSEISFFVKWWDSADAHKQEAIRKLILGGQLEIVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNLGVIPRSGWAVDPFGHSATMPYLLKKANVTSMLIQRIHYSIKKHFSSTRSLEFMWRQAWDPESGTDLFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGSRVNCPWKVPPRAITDANVAERANVLLDQYRKKSKLF-RSKVVLIPLGDDFRYDKSLEWDQQYINYQKLFDYMNSHPEMHVQAQFGTLTDYFNAVYKANGVSQGARPPGYPVLSGDFFAYADREDHYWSGYYTSRPFYKNLDRILESHLRGAEILYSLA-VSHARHAGMEGRYPTSDYSLLTD----ARRNIGLFQHHDAIAGTAKEAVVTDYGTRLLRSLIGLKRVIINAAHFLIMKNKDVYRFYQTEPFLETDDRRATQDSLPQRTLIELDSS-PRYLVLFNPVEQER--LCVVTVLVNSAK--VRVLTEDGQTLPVQLSAQWSSAVQMSGEVYQASFMARLPALGLAVFHLYDSVDSPMTLRSDTLLRLPGRSQTVRGVDPLPVRSQIADPQPFYIQTQSL-TLAFSGTTGLLESIRRKDDPQEVRVQVQFFTYGTRPSKDKSGAYLFLPDGNAKPYTQRDPPIVRVVEGPLFAEVVTYYQHFQQTVRIHNVPGVDGLSLDITTLVDIRDQTNKELSMRLHTD-IQSEDTFYTDLNGFQIQPRRYFQKLPLQANFYPMPTMAYIQ----DSQYRLTLHTAQALGV---TSLASGQ----LEVMLDRRLMQDDNRGLGQGVKDNKRTANRFRLLLER----RTSSSRPVGSYAKVSH-MLNKIISHVFGDTEKEAVDSGPVSFPSLLSHMTSSILNHEVLALPVIPKKRGVPPLRTFAPLANALPCDFRLLNLRSIQNQDAQSPSLYTALLLHRLGLDCGLEAQNPGFNCTTTQGKL-AVSALFRGLDLQLLQPMSLTLMYSGTPLSNSSI----ISLEPMELSTY 1171          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2a1 (mannosidase alpha class 2A member 1 [Source:NCBI gene;Acc:103023301])

HSP 1 Score: 516.538 bits (1329), Expect = 3.807e-165
Identity = 248/466 (53.22%), Postives = 322/466 (69.10%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDK----------IKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLL 1429
            M  +Y+ L F + DGGVWKQGF + Y   +     L V VVPHSH DPGW+KT D+YF+D TQ ILN+M+  L+++   K I +E+ YF KWW+ I   ++D VKKLI+  QLEI TGGWVM DEA +HYS+MI+QL +GH WL+ N+   P TGWA+DPFG+S    Y+LK++G++NM+IQRVHY IKK  ++ K LEF W+Q WD ++   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  IT+ENV+ RA+MLLDQYRKK+ L+     VLVPLGDDFRY   +EW  Q+ NY  L DYMN   E +V+ +FG +SDYF+ L+K                P++SGD F+YADR DHYW+GYFTSRPF K +DRIL +HLRAAEI+ SL+L   +  ++G  + +     ++ + G+RR L LFQHHDA+AGT K  V+VD+  + L
Sbjct:  131 MMDVYDLLSFDNPDGGVWKQGFDISYEENEWDNEPLHVVVVPHSHNDPGWLKTFDDYFRDQTQHILNNMVVKLLEDVRRKMIWSEISYFAKWWDNIDSQKRDSVKKLIERGQLEIATGGWVMPDEANSHYSAMIDQLLEGHQWLEKNVGVKPRTGWAVDPFGHSSTQAYILKQAGLSNMLIQRVHYSIKKHFSTQKTLEFFWRQNWDHDSSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRISCPWRIPPEPITNENVQQRAKMLLDQYRKKSKLFRT-KVVLVPLGDDFRYTEAQEWDQQFNNYQMLFDYMNSHSELHVQAQFGTISDYFEILRKKAGINEAGMSVGESQLPTVSGDFFTYADRDDHYWSGYFTSRPFYKRMDRILESHLRAAEILYSLALA--STRRFGRPSDYPAVENYKLLTGARRNLGLFQHHDAIAGTGKDWVMVDYGTRSL 593          

HSP 2 Score: 182.185 bits (461), Expect = 2.722e-46
Identity = 145/525 (27.62%), Postives = 256/525 (48.76%), Query Frame = 2
Query: 1595 GERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKN-SMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT---NINEIPK----LTIHRLKLNCYAGYISEG-SCKFLRKKSPLMKSMFD-DVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHF 3139
            G R + + N   Q R  +V+I +        ++++ +   L+  QI+ +++ A   + +  +SF  N+ PL    V  L  G+     S+ ++ L +    S++   +F+VS+  + +   V+++N   +L I+++TG ++ ++     S++ + + F  YG   +++ SGAYLF+PDGE           I   +G ++ EV       +H ++L+ V G+    ++I NIVDIR E N EI+M I +D +   D FF D N FQ   R+   K+P+Q N YPMT  +YIE    DS R++ LL+ QS    +G T  K   +   EV +DR LNQDDNRG+ + ++DN++ +  +RL+ E     ++   +     +  S +     +Y  H +       +S    L     L + +  PCD HL+N +T    + E P     L +HR   +C     + G  C   R K  L +++ + +  +  +   SLS       +   ++I +  M+I TY +  
Sbjct:  589 GTRSLVVHNPSEQSRSSVVNIYVNTPH----VRVLTADGHLVIAQISAVWEDATRASTE--LSFVANVPPLGLA-VYQLIQGLELQTESAQYLFLKDGGAVSVSGMDHFKVSTPQNAVP--VLIENPHLQLSISASTGLMKTLKLKEDGSEHSVRVEFLWYGTTSNKDKSGAYLFLPDGEAKKYIPSQPPVIRVTKGPVFSEVTTTFTHVTHTVRLYNVKGVDGQAVEISNIVDIRAEFNREIAMRIISD-IGSKDRFFTDLNGFQMQPRRAMAKLPLQANFYPMTSMAYIE----DSLRRLTLLTAQS----LGATSLKSGQL---EVIMDRRLNQDDNRGMGQGVLDNKITANLFRLVLEP----RNPTQENTTPLSYPSLRNHISYMYLNHPLMPMATTWDSDMLTLTPYSPLSSSF--PCDIHLVNLRTIQSQVGEGPSDQAALILHRKAFDCNIATSNTGLLCSTTRGKVTLQRALSNKNTHVSSLEPMSLSLMHESSSRAVDQEITLKPMEIHTYRIQL 1086          
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-52])

HSP 1 Score: 228.409 bits (581), Expect = 1.536e-61
Identity = 250/1043 (23.97%), Postives = 439/1043 (42.09%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYF--------KDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSIC----CQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMN-KQKEWN-VEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEI--VLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAE-------FNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGAR----RSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAE-NKLFSHILKLFKVDGLLSHTIDIE-NIVDIRKESNYEISMVIKTDFVAPSDE-FFVDSNCFQFIRRK-----TFD---KIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVD-----NEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKT---NFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEIPKLTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVK------------------PEDICMNLMDIDTY 3127
            PH+H D GW+KTVD+Y+            Q IL+S++  L K+P  +FI+ E  +F +WW+  S   ++ V +L++  +LE V GGW M+DEA+ HYS++I+Q+  G       L +                   +  + G +     R+ Y  K R    K++E  W+    SE   S+       F+  +P+   P    C    C  D         P  +DP E+ D NV       +   + +A +Y   N++++ +G DF+Y+    W   Y+N  KL+ Y+N +QK  + V + +   S Y   L   K +++P  + D F YAD    +WTGYFTSRP LK  +R+  + L+      VL  S      +  G S               RR +++ QHHDAV+GT K HV  D+  +L       Q + + +   +  +N+     + +   V  L   S+RF+ N              ++N L++P    VH+P+   +      +  S    +  Q+ P+ +  +       +  N+  + F++   PL F    I+  G +                        + ++  S+ NKY+       K   + TTG +  + +L ++   +L+  F  Y A      SR+TSGAY+F P+   +     S   +   +  +  EV  + +   S +++L++     S  +++E  I  +  +      ++ + D    S E F+ DSN  + ++R+     T+D     P+ GN YPM   ++I+    D   ++ +++ +S GV    ++  GS    +E+ L R L  DD RG+ EPL +     + +V +G  LL                  T++  +   D   P+ Q  V     +F +  PS +V   +L     LP   HL+          +     + L     Y S  S  + +  +  ++ MF  + +   ++ SL  NQ   +  +                  P +I +N M+I T+
Sbjct:   26 PHTHDDVGWLKTVDQYYYGGRNYIQHAGVQYILDSVVSELQKDPARRFIYVETAFFHRWWSEQSAKTRNIVTQLVQEGRLEFVNGGWCMSDEASTHYSAVIDQMTLG-------LQHA-----------------SIFAQMGYDGFFFGRLDYQDKGRRMKMKEMEMVWRA---SE---SLKPPTADLFTGVLPNGYNPPAGFCWDQSCSDD---------PVQDDP-ELEDYNVDDLVNKFISISKAQADVYKT-NHIIMTMGSDFQYENAIPW---YKNMDKLIHYVNARQKNGSAVNVLYSTPSCYLQELNLAK-QIWPIKTDDFFPYADDAHDFWTGYFTSRPALKRYERLSNSLLQTCNQLEVLGGSQSRDGPFGKGDSETM------------RRAMAVAQHHDAVSGTEKQHVANDYAKRLGIGWDHCQVLVSNSLAALSGSNVPRVFCENLNISVCPLTEGSKRFSMN--------------VYNPLARPISWSVHLPVNGSS----YSVQDSNGMAVNSQVIPVSKATQNLRRGRGYAKNE--LVFQVQAPPLGFSTYSIILLGRAGA------------------PDEPKRAAPVSMQNKYL-------KATFDPTTGLLSGLTNLETQQSIQLSQNFYWYNASNGNDESRQTSGAYIFRPN-SSTPYTISSKPVVSTLQNSVVQEVRQQFSPWVSQVVRLYEG----SRDLELEWTIGPVPVDDGLGKEVITRLDSSISSAEYFYTDSNGREVLQRRKDYRPTWDLKQTEPVAGNYYPMNSRAFIK----DKGSQLTVVTDRSQGV---SSLNNGS----LEIMLHRRLLYDDYRGVGEPLSEPGEFGDGLVVRGRLLL------------------TLTPPETAADAHRPLAQGMVLQPLLSFQDGTPSAIVEFSALQA--SLPPAVHLLTLS-------QWDKDSVLLRLEHQYESSESKTYSKPVTVNLQKMFSTLKVVGASEMSLGANQWKANMTRLQWNTGNDAHIYTCSNPTPWEITLNPMEIRTF 923          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006368.1 (pep scaffold:Pmarinus_7.0:GL478975:152485:159376:1 gene:ENSPMAG00000005752.1 transcript:ENSPMAT00000006368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 299.286 bits (765), Expect = 1.173e-92
Identity = 137/269 (50.93%), Postives = 183/269 (68.03%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMR 868
            M  +Y  L F + DGGVW+QGF + Y +   ++  L++ VVPHSH DPGW+KT D+Y+ D TQ ILN M+  L+++    F+ AEV +F KWW+     ++  V++L++  QLE VTGGWVMTDEA AHY ++I+Q+ +GH WL   L   P +GWAIDPFG+S  M Y+L+++G+  M+IQRVHY +K+ LA  + LEF W+Q WD      I CHMMPF+SYDVPHTCGPDP +CCQFDF R+   R  CPW   P  IT +NV  R
Sbjct:   96 MLDVYRLLPFDNPDGGVWRQGFDITYDVGAWEQRPLQIIVVPHSHNDPGWLKTFDKYYVDQTQHILNHMVTKLLEDRRRSFVWAEVSFFAKWWDAADSQRRHSVRRLVERGQLEFVTGGWVMTDEANAHYFAIIDQMIEGHQWLHKTLGVRPRSGWAIDPFGHSPTMAYVLRRAGLQAMLIQRVHYAVKRHLAHERSLEFMWRQDWDVGTSTDILCHMMPFYSYDVPHTCGPDPKVCCQFDFKRLPGSRVNCPWKVAPRAITADNVAER 364          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006359.1 (pep scaffold:Pmarinus_7.0:GL478975:144942:162143:1 gene:ENSPMAG00000005729.1 transcript:ENSPMAT00000006359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.96 bits (733), Expect = 8.641e-84
Identity = 208/707 (29.42%), Postives = 330/707 (46.68%), Query Frame = 2
Query:  950 DFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIK-------------MFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFD-----QIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF-VSFKLNIGPLAFERVRI-LATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLT---------------GYGLPCDYHLINFKTNINEIP--------KLTIHRLKLNC 2941
            DFR++T  EW  Q+ NY +L DY+N   E +   +FG LSDYF++L   ++                P L GD F+YADR+DHYW+GYFTSRPF K LDR L  HLRAAE++ SL+  +H   + G++ +        +++G+RR L+LFQHHDA+ GTS+  VV D+  +L+ A+   Q V   A   +L    G S           F  +N+  Y    NK   +   T+  R + + N+L   R  +V + ++     + +   GSG   +  Q++P++  +   + + F + F   +  L     R+ L      T  S   ++L          +     +          ++ +  +   +  TG +  V          L +    YG RRS++ SGAYLF+PDGEG   E      +    G L  EV        H ++L+ + G+   ++++ N+VD+R ++N E+SM + +D V     F  D N FQ   R+ + K+P+Q N YP+   + ++    D+  ++ LL+ Q+ GV    ++  G     +EV LDR L QDDNRGL + L DN      +RLL E     +S D  ++     ++      L +P     V +   N  P  LVG +  L+               G  +PCD HL+N +  + E P         L +HR   +C
Sbjct:    1 DFRFETAHEWEQQFHNYQQLFDYINSHPELHARAQFGTLSDYFEALGVWEVSGNASISPPPPPPPALPVLGGDFFTYADREDHYWSGYFTSRPFFKHLDRRLEAHLRAAELLFSLA-SWHAS-RRGVTPLLPARECFARLEGARRNLALFQHHDAITGTSRELVVSDYAARLMRALADLQRVLVDATLVLLLAEPGRSAASAPSQPSFFFLEENVVDYDSLPNKA--VIKLTSAPRSLVVHNALEWERVCVVSVRVDSPLANV-LTHDGSG---VLAQVDPLWSSSTGMSARAFQLQFLARVPALGLAVYRLTLDAPPVPTVRSDTTLYLPGGGPVPPRTQPLLPLALLPPPTTQFSVETASVEAGFSGRTGMLRWVRLKAGGEPRLLRLDLLWYGTRRSKDKSGAYLFLPDGEGKPYESAERPVVRVTRGPLVSEVTCVYPHVQHSVRLYNLPGVEGLSLEVSNVVDLRDQNNRELSMRVSSD-VESDGNFQTDLNGFQMQPRRFWKKLPLQANFYPVATMALVQ----DARSRLSLLTAQAGGV---ASLADGQ----LEVMLDRRLIQDDNRGLGQGLKDNRRSLSRFRLLLET----RSPDGTKWDATMAAA------LGFPSLLGHVASAALNHPPFVLVGVEQRLSPLVEPPQLLPSFHVLGAPVPCDLHLLNLR--MMEAPGAGPPGEAALLLHRKGFDC 675          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003432.1 (pep scaffold:Pmarinus_7.0:GL488094:1155:3927:-1 gene:ENSPMAG00000003140.1 transcript:ENSPMAT00000003432.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.994 bits (528), Expect = 2.687e-60
Identity = 106/225 (47.11%), Postives = 141/225 (62.67%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDP-GWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDS-ENKYSIN---CHMMP 727
            M  +YE L F + DGG WKQGF + Y     +   L+++VVPHSH DP GWIKT + YF + T+ IL++ +  L ++   +FI AEV Y  KWW      Q+   K+LI   QLEIVTGGWVM DEA  H  +M++Q+ +GH WL+ +L   P +GWAIDPFG+S    YLL+ +GI NM+IQR HY +KK LA  + LEF W+Q W   +    +N   CH MP
Sbjct:   90 MMDVYELLPFDNPDGGAWKQGFDITYEDAAWESTPLQIYVVPHSHNDPAGWIKTFEGYFVEQTKRILDNAMVKLAEDSRRRFIWAEVSYLAKWWEGADAAQRATAKRLIDGGQLEIVTGGWVMPDEANVHVWAMLDQMLEGHQWLERHLGVRPRSGWAIDPFGHSPTNAYLLRAAGIQNMLIQRTHYSVKKHLAHERSLEFHWRQSWGEWQPDAGVNLHHCHTMP 314          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: man2b1 (mannosidase, alpha, class 2B, member 1 [Source:ZFIN;Acc:ZDB-GENE-050327-52])

HSP 1 Score: 218.394 bits (555), Expect = 1.085e-58
Identity = 240/946 (25.37%), Postives = 395/946 (41.75%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYF---KDDTQP-----ILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLN--YTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRC---PWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQK--EWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAE--------FNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVV-LKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSR------ETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAE--NKLFSHILKLFKVDGL--LSHTIDIENIVD-IRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKI--------PIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVD-----NEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINF 2884
            PH+H D GW+KTVDEY+   K+D Q      IL+S++  L + P+ +FI+ E+ + ++WW    +  + +V+ LI   +LEI+ GGW M DEAT HY+ +I+Q+  G  ++ +       P   W IDPFG+S+    L  + G +     R+ Y  K++    KQ+E  W+         S+   +   F+  + +   P P  C  FD        C   P  +DP  + + NV  R    L +  K+A  Y   N++++ +G DF+Y+    W   ++N  KL+ Y+N+ +     V + +   + Y + L K  +  +     D F YAD    +WTGYFTSRP LK+ +R   N L   ++   L +I  +    G        LL E        + + QHHDAV+GT K  V  D+  +L       Q + + A    L    G+ +  +I              N +     ++     V L+N L Q     V +P  V+  R  ++       + K  I  +F +++               + F+  I PL F R  +                    +        F      +  N   + +KN    L  +  +G +  VE+   KS   L +    Y  + S+      + SGAY+F P+   +     S   + HF  +   + V +  +   S +++L+       L  T+    + D I KE        +KTD V     FF DSN  + + R+   +         P+ GN YP+    YI+    D   ++  L+ +S G   G +I  GS     E+ L R L  DD+RG+ E L +     N +V +G  LL  +     +  ++   +   + +     LI P  Q +         PS+ + Q S LT   LP   HL+  
Sbjct:   36 PHTHDDVGWLKTVDEYYYGEKNDIQHAGVQYILDSVIPALEQNPSRRFIYVEMAFLKRWWKQQGEAMRRRVRALISQGRLEIINGGWCMNDEATTHYNGIIDQMTLGLRFVSDEFGGCARPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKEQRMKDKQMELVWRA------SKSMGPPVADLFTGVLFNGYNPPPGFC--FDQF------CDDEPIQDDP-SLFNYNVDSRTSDFLKEVAKQAKFYRT-NHIIMTMGSDFQYENANLW---FKNLDKLITYVNQLQVNGSKVNLVYSTPTCYLNELNKANL-TWTVKEDDFFPYADGPHQFWTGYFTSRPALKLFERRSNNLL---QVCTQLEVIVGSGAARGPLGRGYSFLLWE-------AMGVAQHHDAVSGTEKQQVAYDYAVRLSLGWDSCQMLVSNA----LSALSGSGKPTEIC----------RYLNISVCPATESASAFTVVLYNPLGQSVTENVRLP--VNGSRYLVQDPSGATMVSKSIIVVVFPVSDATRAVRRTLGTASGELVFQAAIPPLGFARFSVSRAA----------------RRPAEALTGFVARGPRAGGNGAPISIKNEYYTLTFDGISGLLSNVEN--RKSSLSLPVTQNFYWYKSSKGDDDNGQASGAYIFRPNSSEAFPVAKS--AVTHFTVDPLLQEVRQVFSPWCSQVIRLYPGKPYVELEWTLGPIPLADKIGKEVLVRFDTPLKTDGV-----FFTDSNGREILERRRDKRPTWPLNQTEPVAGNYYPVNSRIYIK----DEKMQLTALTDRSQG---GASIRDGS----FELMLHRRLLYDDHRGVDEALNEPGVWGNGLVVRGRHLLVLEAPARSAALHRPLAQ---AEFMAPMPLIGPPVQAW---------PSSTLTQFSGLT-RPLPPSVHLLTL 886          
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000437.1 (pep scaffold:Pmarinus_7.0:GL480287:5325:14229:-1 gene:ENSPMAG00000000390.1 transcript:ENSPMAT00000000437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 5.401e-43
Identity = 126/472 (26.69%), Postives = 220/472 (46.61%), Query Frame = 2
Query: 1598 ERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIF-QLAEFNNNQHFVSFKLNIGPLAF----------ERVRILATGISDTYCSSVHIHLYNIKNSMNFKKN--FQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQ---LKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKT-------NINEIPKLTIHRLKLNCY 2944
             R V ++N+L+Q R  +V +   V T+R  ++ +    + +  QI P++   A+   + + +SF   + PLA            RV +LA           +  L+ +      ++     V    +     + + N+   L      G+++ V    +  +  + +    YG R +R+ SGAYLF+PDG+    E +    +   EG L+ EV +     +H ++L+ + G+   ++++ N+VDI  E N+E+ MV+ TD     D F+ D N FQ  RR+ + K+P+Q NVY MT A+ ++    D  R++ LLS Q+ GV        G     ++VFLDR L QDDNRGL + + DN+     +RLL E   +   +        G  ++  +   + L +P   +  +     S  +  + Q + LT   LPCD +L+N +T         +E   L +HR   +C+
Sbjct:   23 PRPVVVYNTLAQERVCVVCV--HVSTQRARVRHLD--GRAVLAQIGPVWTAAADMVPDTYQLSFLARLPPLALVTFELWEASDPRVTVLA-----------NTTLFGVTPGHGPQRGGLLGVDVRAAPPPSGLSIHNTHATLRFGGPKGFLQGVRLCGATQEQAVQVDLAWYGTRGARDNSGAYLFLPDGDAKPYETEVEPVVRLAEGPLFSEVTSYLPHVTHTVRLYNLPGVEGLSLEVTNVVDIHSEINHELVMVLTTDLQN-QDIFYTDLNGFQMQRRRFWQKLPLQANVYQMTSAAVLQ----DPERRLSLLSAQALGV-------AGMRPGELQVFLDRRLMQDDNRGLGQGIKDNKPTLSRFRLLPERRSRHDSVPGAVPGTGGSLSLLGHVTSDVLNHPALLLLGEPTPQGS--AAPLAQLTPLT-TPLPCDLYLLNLRTLQATEGGGPSEDIALILHRRGYDCW 464          
BLAST of Alpha-mannosidase vs. Ensembl Nematostella
Match: EDO40866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S628])

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 349/984 (35.47%), Postives = 534/984 (54.27%), Query Frame = 2
Query:  272 MLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNL--NYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLA-EFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLY-----NIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNK--EFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNI---NEIPK----LTIHRLKLNC--YAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSG--NQVIGDKVKPEDICMNLMDIDTYAV 3133
            M+DFL +  +MKFI AE+ YF  WW     ++K Q    IK+ Q+E+VTGGWVM DEA  H+ SM++QL +GH W+KN+L  +  P +GWAIDPFG++  MPYLL++ G ++M+IQR HY +KK LA    LEF W+Q WD  +   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   PV IT++NV  RA MLLDQY+KKA LY   N VL+PLGDDFRY  + E + QY NY K+ +Y+N   E + + +FG L DYF ++ +       ++   F SLSGD ++YADR DHYW+GY+TSRP+ K LDR++  H R AE++  L+   H+  K    T +    L + +  +RR + LFQHHDA+ GT+K  VVVD+ N+L  +++  Q V     Q +L  N   +Q  + I      +  ++  N    + I ++  R VY++NSL + R+ +V + +        + +  S   ++  Q N ++    + ++ ++ + F  ++ PL     ++    +SD +     +  Y     +   S +F    Q      L      + N L     +STTG ++ +      S+  +++ F  YG +   + SGAYLF+PDG        +  T+    G++  EV        H+++L++ DG   H++DI+N VD+R  +N E  M ++TD    + EF+ D N F + RR+T DK+PIQ N YPM   +++E    DS  ++ LLS Q NGV        G     +EV +DR L QDDNRGL + + DN+     +RL+ E + Q  +  NK  +    ++ ++ L   L++P      K +  ++  S   G   L +   LPCD  L+  ++ +    E P     + +HR    C   +  I + S   L+     +  +F D+ +    + SLS   +Q + D   P  I ++ M++ +Y V
Sbjct:    1 MVDFLAEHKDMKFIWAEISYFSMWWKDADPHRKKQALSQIKSGQMELVTGGWVMNDEANPHFYSMLDQLIEGHQWIKNHLGPDIKPVSGWAIDPFGHTSTMPYLLRRIGFHSMLIQRTHYQVKKHLARETNLEFMWRQIWDHGSSTDILCHMMPFYSYDVPHTCGPDPKICCQFDFRRLPGGRVTCPWRIPPVPITEQNVAERATMLLDQYKKKAKLYKT-NVVLIPLGDDFRYDLKMEPAAQYDNYQKIFNYINSHPEMHAQAQFGTLKDYFQAIYQKTGTNPGERPPNFVSLSGDFYTYADRDDHYWSGYYTSRPYYKNLDRVMEAHHRGAEMLFYLA---HSHAKRAGVTHYPADKLSQLLTNARRNMGLFQHHDAITGTAKDFVVVDYGNRLHRSLQDMQNVMQECMQFLLSPN--KAQEPKHILKPGEDRP-AQDANPIKEVIILSSSPRSVYVYNSLPEQREQVVSLFVSDPL----VTVRDSSGDVVISQTNLVWDARNKISSVKYELLFVASVPPLGVAVFKVKLGSVSDAHNRPSRVTAYTRDTLDKPTSEHFNIELQAPGSEVL-----TMNNHLISAEFDSTTGMLKSITTKADGSRVNVDLEFMTYGTKSYGDRSGAYLFLPDGPAKPHTVPAHTTVFFTSGKVMQEVRVVLPNVVHVVRLYRTDGPEGHSLDIQNTVDVRSMNNKEFVMRLRTDIQNKNREFYSDLNGFSYQRRRTLDKLPIQANFYPMPTMAFLE----DSNHRLSLLSAQPNGV-------AGLQTGMLEVVMDRRLLQDDNRGLGQGVTDNKETPSHFRLVLERF-QTPTQQNKRPDLAFPSLLTHLLSQHLLHPQFIFLAKPDAEDTATSLSPGFTGLQS--PLPCDVSLLMLRSVLEGEEEKPSGEALMVLHRRGYECGLSSSCIKDASGGKLK-----LGELFKDLPMSQATRTSLSMLYDQGVQDPTTP--ISLDPMELHSYRV 947          
BLAST of Alpha-mannosidase vs. Ensembl Nematostella
Match: EDO37584 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA1])

HSP 1 Score: 251.521 bits (641), Expect = 2.188e-69
Identity = 257/1006 (25.55%), Postives = 443/1006 (44.04%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYF--------KDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNL--NYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRC---PWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPI---------FQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSR-ETSGAYLFIPDGEGSI-IEFDSLNTIVHFEGELYDEVVAE-NKLFSHILKLFKVDGLLSHTIDIENIV-DIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQF-IRRKTFDKI-------PIQGNVYPMTCASYIESKIF--DSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRL-----LFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYG--LPCDYHLINFKTNINEIPKLTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDK 3079
            PH+H D GW+KTVDEYF            Q IL+S++  L ++PN +FI+ E+ +F++WW+  +   ++ VKKL+  K+LE + GGW M DEA  HY+++I+Q+  G  +++     +  P   W IDPFG+S     L  +   +     R+ Y  K      +++E  W+           N  +     Y+      P P  C  FD        C   P  +DP  + DENVK R E  +    ++   Y + NN+++ +G DF Y+    W   Y+N  KL+ ++N+     V   +   + Y ++L    +  +   + D F YAD    YWTGYFTSRP LK   R+  N L+A + +  L+           S   +  LL       RR L++ QHHDAV+GTSK HV  D+  +L       Q + +    +    + GN+     +F   NL       N ++    + +    V  +N +++     + +P+      + + +       IK Q+ PI          Q    +N+++ + FK+ + PL F               +S  ++     + M + K+F V       +   V++N   KL  +  TG +  + DL S+   +++  F  Y A   + + SGAY+F P+   +  +      T   ++G L  EV    +   S +++L+           +  I  D+ +E        IK++ V     F+ D+N  +  +R + F          P+ GN YP      + S+IF  DS R++ LL+ +S G   G ++  GS    +E+ L R L  DD RG+ EPL ++ +  KG  +     +        +  ++E GE      Q+M + I    Q        ++V   L    SL TG    LP + H++  +T+     +  + RL+      + ++   K     +  ++ +F D+ +  V + +L+ NQ++ DK
Sbjct:   46 PHTHDDVGWLKTVDEYFYGANNSIQHAGVQYILDSVIPALNEDPNKRFIYVEIAFFKRWWDQQNVEMQEIVKKLVLQKRLEFINGGWCMNDEAATHYNAIIDQMTVGLKFIEETFGSDARPRIAWHIDPFGHSNEQASLFAQMSFDGFFFGRIDYDDKTLRLKQQRMEMVWRG--SKSGNLGKNSDIFTGVLYN---GYNPPPGFC--FDQF------CSDQPIQDDP-RLYDENVKQRVEEFIKLACEQGSQYKS-NNIMMTMGSDFMYENANLW---YKNLDKLIAHVNQDSR--VRAFYSTPTTYLEALHAANL-TWGLKTDDFFPYADCPHCYWTGYFTSRPALKRYSRLNNNLLQACKQLEVLN-------GPAQSGSPSSDLL-------RRALAVAQHHDAVSGTSKQHVADDYAKRLAIGAADCQALMSNVIGKKSIKSKGNA---PPVFSSCNL------LNVSSCPSTEDSKSFVVNAYNPIARDITSYIRVPVN-----LPMSVYNPQGAAIKSQLLPISQETMTLRRMQKLSASNSKYELIFKVKLPPLGF---------------ASYFVNTSKTSSKM-YGKSFAV-------DPSTVIQNEFIKLEFSRDTGRLTSMTDLVSEVTTQVDQQFLWYNASVDQGQPSGAYIFRPNTSSTTPVNAGGKATFTVYQGPLVQEVRQVFSPYVSQVVRLYYGQKHAEFEYTVGPIPDDLGREVITRFDSDIKSNKV-----FYTDANGREMQLRTRDFRPTWKLNNTEPVAGNYYP------VNSRIFVKDSNRQLTLLTDRSLG---GSSLKDGS----VELMLHRRLLVDDKRGVDEPLNESGISGKGLIVRGKVNVVLAPPATSAATHRELGE------QMMLEPIVSFAQN------PSTVEKWLAKYNSLYTGVARQLPSNVHMLTLETS----NQYALIRLEHQ----FEADEDSKLSMPVNVSLQGLFTDLEVSKVEELNLAANQLLKDK 941          
BLAST of Alpha-mannosidase vs. Ensembl Nematostella
Match: EDO33329 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSJ0])

HSP 1 Score: 50.447 bits (119), Expect = 4.836e-6
Identity = 33/144 (22.92%), Postives = 56/144 (38.89%), Query Frame = 2
Query:  194 HSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHY 625
            + H+D  W+    E  +   +    + +  + K P+ KF  ++    E W         +++KK + N Q   V   WV  D       S I Q   G  + K          W  D FGYS  +P ++   GI   + Q++ +
Sbjct:  261 NCHIDCAWLWPAAETVRKCGRSFATA-VQLMKKYPDFKFACSQAQQLE-WVKIHYPGLYEEIKKFVANGQFIPVGATWVEMDGNIPSGESFIRQFVVGQQFFKEEFGMMCKEFWLPDTFGYSAQLPQIITGCGIKFFLTQKLSW 402          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: man2a2 (mannosidase alpha class 2A member 2 [Source:NCBI gene;Acc:101158104])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 392/981 (39.96%), Postives = 562/981 (57.29%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKK-------DKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSL-IYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQI--IFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF-VSFKLNIGPLAFERVRILATGISD-TYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEF-TVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEIPKLT--------IHRLKLNC 2941
            M  +Y  L F + DGGVWKQGF + Y   +     L+VFV+PHSH DPGWIKT D+YF D TQ ILN+M+  L ++P  KFI +E+ YF KWW T    +++ ++KLI   QLEIVTGGWVMTDEA AHY +MI+QL +GH WL+ N+  TP +GWA+DPFG+S  MPYLLKKS + +M+IQR+HY IKK  +S++ LEF W+Q WD+ +   I CHMMPF+SYDVPHTCGPDP ICCQFDF R+   R  CPW   P  I + NV  RA++LLDQYRKK+ LY     +LVPLGDDFRY    EW  QY NY KL DYMN   E +V+ +FG L+DYF +L K        +   FP LSGD F+YADR+DHYWTGY+TSRPF K LDR++ +HLR AEI+ SL++    ++   G   V + SLL +    +RR + LFQHHDA+ GT+K +VV+D+ N+LL ++   + V   AA  ++  N    +F Q     + D+ ++  +   +   I +   G RY+ +FN + Q R  LV + +      + ++++    Q +  Q++  +  A   + + F  +F   + PL      +  +  S  T  S   + L +   +        V S+ +    + +    L  L  + +TG +E ++      + K+ I F  YG   S++ SGAYLF+PDG+           +   EG L+ EVVA  + F   +++  V G+   ++DI  +VDIR +SN E+SM + TD +   D F+ D N FQ   R+ + K+P+QGN YP++  +YI+    DS  ++ L + Q+ GV    T F+   +   EV +DR L QDDNRGL + L DN+     +RLL E       G +     F ++ S+     L + V  + V        P  L     L++ +  PCD+HL+N ++  N+   LT        +HRL L+C
Sbjct:  131 MLDVYSLLKFDNPDGGVWKQGFDITYEANEWDNEPLQVFVIPHSHNDPGWIKTFDKYFTDQTQHILNNMVVKLAEDPRRKFIWSEISYFSKWWETAEPQKQEAMRKLILEGQLEIVTGGWVMTDEANAHYFAMIDQLIEGHQWLERNIGVTPRSGWAVDPFGHSATMPYLLKKSNLTSMLIQRIHYSIKKHFSSTRNLEFMWRQAWDTGSSTDIFCHMMPFYSYDVPHTCGPDPKICCQFDFKRLPGGRINCPWKVPPKPIVEANVAERAQLLLDQYRKKSKLY-RSKVLLVPLGDDFRYDKSLEWDQQYINYQKLFDYMNSHPELHVQAQFGTLTDYFSALYKTTGAAAGSRPADFPVLSGDFFAYADREDHYWTGYYTSRPFYKSLDRVIESHLRGAEILYSLAVATARHEGMEGRYPVTDYSLLVD----ARRAVGLFQHHDAITGTAKENVVIDYGNKLLRSLIGLKRVIINAAHFLVMKNRDFYRFYQTEAFLETDDRRATQDALPQRTLIELDPAGPRYLVVFNPIEQERLCLVKVLVNT----VRVRVLTEDGQTLPVQLSAQWGSATQMSAEVFQATFMARLPPLGLAVFHLYDSADSPMTLRSDTLLRLSSRSVTARASDPLPVHSQLADPQSFYISSQFL-TLGFSGSTGLLESIKRKDDSKEVKVQIQFMVYGTSPSKDKSGAYLFLPDGKPKPYNQKEPPVVRVVEGPLFSEVVAHYQHFEQTIRIHNVPGVDGLSVDISTMVDIRDQSNKELSMRLSTD-IKSDDIFYTDLNGFQIQPRRFYQKLPLQGNFYPISSQAYIQ----DSQHRLTLHTAQALGV----TSFESGQL---EVIMDRRLMQDDNRGLGQGLKDNKRTENRFRLLLERRSSGNKGTDSSTNSFPSIVSHMTSAILNHEVLPLPVVPKRRGIPP--LKTFAPLMSRF--PCDFHLLNLRSIQNKQDGLTPSPHTALLLHRLALDC 1085          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: ENSORLT00000044084.1 (alpha-mannosidase 2 [Source:NCBI gene;Acc:101174073])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 374/1023 (36.56%), Postives = 579/1023 (56.60%), Query Frame = 2
Query:   77 LYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFR--CPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKM---FPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQ--IIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHF-VSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSS-ENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHF-EGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGY-GLPCDYHLINFKTNINE----IP----KLTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKP 3088
            +Y+ L F + DGG WKQGF++ Y   +  +  L++F+VPHSH DPGW+KT D Y++D T+ ILN+ML  L ++   K I AE+ YF KWWN I + ++  VK+L++  QLE+VTGGWVM DEA +HY ++++QL +GH WL+ +L   P++GWAIDPFG+S  M YLLK +G+ NMVIQR+HY +KK  A  K LEF W+Q WDS +   I CHMMPF+SYDVPHTCGP+P++CCQFDF R+   R  CPW   P  IT++NVK RA +LLDQYR+K+ L+     +LVPLGDDFRY    EW  Q+ NY KL DY ++  E +++ +FG LSDYF +L +         P+LSGD F+YADR DHYW+GY+TSRPF K LDR L + LRA EI+ SL+L    ++   L   F      +++   RR L LFQHHD + GT +  VVVD+  +L +AI   + V   +A  +L  +      DQ       D++ S  +   +   + + ++  R + ++N   Q R  ++ + +     R+   +     Q +  QI+ ++   +  ++Q F +SF   + PL+     +       T  S+  IH +  + S+   ++FQ+S  E +    ++ L N   ++  +  TG ++ +  L S    ++ + F  YG   +R+ SGAYLF+P G+G    + S   +V    G ++ ++ +  +  +H ++LF ++G    +I+I N+VDIR E+N E+ M +++D VA S+ F+ D N FQ  +R+T  K+P+Q N YPM+ +S+++    DS  ++ LLS QS   +   ++  G     +EV LDR L QDDNRGL + + DN++    Y LL ED + ++          ++ ++     L +P   MF +++        L   +  L  +  LPCD HL+N +T   E     P     L +HR    C +       C +   +   +  +F  +  + + +   SG  ++ D  +P
Sbjct:  119 VYDLLPFDNPDGGAWKQGFQITYQGNEWAEQPLELFLVPHSHNDPGWLKTFDGYYQDQTRHILNNMLLKLGEDSRRKMIWAEISYFSKWWNEIDEQKRMMVKRLVEAGQLEMVTGGWVMADEANSHYFALLDQLMEGHQWLQRHLGLKPSSGWAIDPFGHSPSMTYLLKGAGLRNMVIQRIHYAVKKHFAQKKTLEFLWRQSWDSSHSSDITCHMMPFYSYDVPHTCGPNPAVCCQFDFYRLPGGRTSCPWRIPPQPITEKNVKERAHVLLDQYRQKSRLF-RIPVLLVPLGDDFRYVESGEWDAQFNNYQKLFDYFDQHPELHIKARFGTLSDYFSALHRRLSATETSLPTLSGDFFTYADRDDHYWSGYYTSRPFYKRLDRALESTLRATEILFSLTLAEMRRFHGDLVVGFPAREHFQRLVEGRRNLGLFQHHDGITGTGRDPVVVDYGTRLFHAILHLRQVQQSSAHWLLLLDKNQYHHDQSKPFLQTDDVISAQDALPQKTPL-VLSDEPRVLIVYNPTEQRRSSVISVVVSSPDARV---VDSETAQPMPVQISAVWVEPQQVSSQAFQLSFVAELPPLSLTVYHVTKAPAGSTPRSTYVIHRHGNRPSIA-SQHFQLSRLEAAEAQTHLSLSNKHLQIWSSPETGLLQKLR-LSSGLVRRVQVKFLWYGTTTNRDKSGAYLFLP-GQGGAQPYSSEPPLVRVSRGPIFSDITSCFQHVTHTVRLFHLEGHSGKSIEISNMVDIRAETNRELVMRLESD-VASSNRFYTDLNGFQMQQRRTLKKLPLQANFYPMSSSSFLQ----DSLSRLTLLSAQS---QAAASLQSGE----LEVILDRRLQQDDNRGLGQGVTDNKLTGSLYHLLLEDRRAVQEVGGATIDHLSLLAHLESLSLCHPPIIMFAQSDI------QLPKLRPFLPLHSSLPCDVHLLNLRTLEAEEETGAPSQEVALLLHRKGFECSSAPEPPPQCTWSAHEEVNLDDLFSPLQFRSIRR---SGLTLLRDHDEP 1112          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: man2b1 (mannosidase alpha class 2B member 1 [Source:NCBI gene;Acc:101168422])

HSP 1 Score: 246.899 bits (629), Expect = 1.651e-67
Identity = 233/864 (26.97%), Postives = 389/864 (45.02%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYFKDD--------TQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSIC----CQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQ--KEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHFVS----FKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGA-----RRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLF-----SHILKLFKVDGLLSHTIDIENIV-------DIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFI-RRKTFDKI-------PIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEV 2647
            PH+H D GW+KTVD+YF  D         Q IL+S++D L+K P+ +FI+ E  +F +WW   S + +  VK+L+   +LE V GGW M+DEA  HYS++I+Q+  G  +L         P   W IDPFG+++    L  + G +     R+ Y  +    S K+ E  W+         S+   M   F+  +P+   P    C    C    IR         +DP E+ D NV    +  L    K+A +Y   N++++ +G DF+Y+    W   Y+N  KL+ ++N Q  K   V + +   S Y   L +   + +P    D F YAD   ++WTGYFTSRP LK  +RI  ++L+    +  L      K  +G     +Q+L        R+ +++ QHHDAV+GT+K HV  D+  +L +  +  Q + + +   +  ++      D +   V  L   S++F+              V ++N L++P    V +P+      I       GN +    ++      E   N+   +    F++   PL +            TY  S      +++   +   + +  +  S+ NK++       +++ +  TG I  + +L +K    L   F  Y A       S++ SGAY+F P+   S + F  ++ +   E  +   VV E + +     S +++L+      S  +++E  V        + KE    +   IKT     S+ F+ DSN  + + RRK F          PI GN YP+   ++I+    D   ++ +++ +S G   G +I  GS    +E+ L R L  DD RG+ EPL  NEV
Sbjct:   61 PHTHDDVGWLKTVDQYFYGDRNDIQHAGVQYILDSVVDQLLKNPDRRFIYVETAFFYRWWKQQSSSMQQTVKQLVNEGRLEFVNGGWCMSDEAATHYSAVIDQMTLGLRFLNETFGACGRPRVAWHIDPFGHAREHASLFSQMGYDGFFFGRLDYQDRDSRRSKKEQELLWRA------SDSLPAPMADLFTGILPNGYNPPTGFCWDQLCNDPPIR---------DDP-ELEDYNVDDVVQRFLQIANKQAEVYKT-NHIIMTMGSDFQYENANLW---YKNLDKLLLHVNSQQAKGSKVNVLYSTPSCYLQELHRAN-RTWPLKMDDFFPYADDAHNFWTGYFTSRPALKRYERISNSNLQTCNQLEVLGGAASRKGPFGEGD--SQTL--------RKAMAVAQHHDAVSGTAKQHVTNDYARKLADGWQRCQVLVSNSLASLSGSSAPRIYCDLLNVSVCPLTESSKKFS--------------VTVYNPLARPVVWPVRLPVYGSAYLIKDP---KGNSVDSQVLSVSKATREVRRNRGHAANELVFQVQAPPLGYT-----------TYSVS------SLQGRPSSAASPKRGAPTSIQNKFL-------QVNFDPDTGLISGLSNLETKQSINLTQNFYWYNASDGKNSESKQPSGAYIFRPN---STVPF-VISRVAQTE-TIQTSVVQEVRQWFSPWVSQVVRLYAD----SRALELEWTVGPLPVSDGLGKEVITRLDSSIKT-----SEMFYTDSNGREILQRRKDFRPTWQLKQSEPIAGNYYPINTRAFIK----DDVDQLTVVTDRSQG---GGSIQNGS----LEIMLHRRLLYDDYRGVGEPL--NEV 825          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: man2b2 (mannosidase alpha class 2B member 2 [Source:NCBI gene;Acc:101167078])

HSP 1 Score: 204.142 bits (518), Expect = 2.902e-53
Identity = 213/851 (25.03%), Postives = 361/851 (42.42%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKN-QKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDP---SICCQFDFIRIIYFRCP-----WGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMN-KQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNF--IHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIA--FKKY---GARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEV-----VAENK-----LFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRR--KTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRIL--NQDDNRGLFEPLVDNEVV 2650
            PHSH+D GW+ T+ E        + +S+ + L K    +FI  E  +F  WW+T++ + QK QV++L+K+ +LE + GG VM DEA       I Q+ +GH +L       P   W +DPFG S   P L   +G N  +I R+ Y +K  +  +K+L+F W+       +  I  H M  FSY     C P     S    F +  +  F  P     + N  + +T E +   A+ +++  +++A  +   N+VL P G D ++      S+Q+RN   LM Y+N K KE+ V +++  LS YF ++ +  +      S D   Y+      WTG++ SR  LK L R   + L AAEI+ +   ++     +    V     L +K+   R  +S  QHHD + GT    V   +                   Q ++Q  +G  +    +F    L  Y +     NF    +    E++V ++N L+     +V+I + +     G  +     Q +  QI    Q +  +N  + +   + +G L   +  I  +G S         H Y  K  +  ++  +  +    L   V+  N   KL  +  T  +  +  LYS  K ++ +   F +Y   G   +   S  Y+F  +   ++  + ++   +   G++  E+       EN        + ++  F   GL  H +     V    + N E+ +   T  +  +   + D N FQ ++R  K F    +  N +PM   +YI+    D    + LLS +++GV              +EV L R L  NQ  N G    L D+ VV
Sbjct:  102 PHSHMDVGWVYTIQESMHAYAANVYSSVTEELSKVKERRFIAVEQEFFRLWWDTVASDLQKKQVRQLVKDGRLEFIIGGQVMHDEAVTDLDDQILQMTEGHGFLYQTFGVRPQFSWHVDPFGASATTPVLFALAGFNAHLISRIDYDLKDAMQKTKKLQFVWRGSPSLAAQQEIFTHTMDQFSY-----CTPSHVPFSNSSGFYWNGVALFPDPPKDGVYPNMSLPVTKETIDAYAKTMVENIKQRAAWFRT-NHVLWPWGCDKQFYNS---SVQFRNMDPLMKYINQKSKEFGVTVQYATLSQYFQAVHQSNLTWDVRGSQDFLPYSTEPYQAWTGFYASRNVLKGLARRASSQLHAAEILFTRYRVH-----FPDGPVAKDWAL-DKLRALRWAVSEVQHHDGITGTESPKVADMY------------------VQHLMQGMMGVQELQAALF---LLPHYLDNPAVENFHGAGVDQALEQHVIIYNPLAWNITTVVNITVTL----AGAAVYDDEGQPVSAQI----QHSAQSNASYDLFVVVQLGGLQHRKYLIRFSGKSG--------HTYEAKAVVFERRRVKDWTRTGRLRLPVL--NRCYKLMFDQETNLLHSITHLYSPKKQRVMMTQDFWEYHANGDVNAGPISDNYIFSANAS-AVRAYQAVEMQI-IPGQIVTEIRQYFYRGENDSDYAYSITTLVPEFSGAGLPCHRLQQTYSVGPL-QLNTEVVLRTSTS-LKNNQSLYTDDNGFQMMKRTYKKFQNNTLARNYFPMVRTAYIK----DDRSGLVLLSDRAHGV-------SSQANGELEVMLHRRLWNNQPWNLGYNLTLNDSSVV 883          
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Match: man2b2 (mannosidase alpha class 2B member 2 [Source:NCBI gene;Acc:101167078])

HSP 1 Score: 73.9442 bits (180), Expect = 4.816e-14
Identity = 38/108 (35.19%), Postives = 58/108 (53.70%), Query Frame = 2
Query:  191 PHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKN-QKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNL 511
            PHSH+D GW+ T+ E        + +S+ + L K    +FI  E  +F  WW+T++ + QK QV++L+K+ +LE + GG VM DEA       I Q+      L   L
Sbjct:   32 PHSHMDVGWVYTIQESMHAYAANVYSSVTEELSKVKERRFIAVEQEFFRLWWDTVASDLQKKQVRQLVKDGRLEFIIGGQVMHDEAVTDLDDQILQMTGDPVMLHRRL 139          
BLAST of Alpha-mannosidase vs. Planmine SMEST
Match: SMESG000018139.1 (SMESG000018139.1)

HSP 1 Score: 2101.25 bits (5443), Expect = 0.000e+0
Identity = 1025/1026 (99.90%), Postives = 1025/1026 (99.90%), Query Frame = 2
Query:   68 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDXXXXXXXXXXXPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEIPKLTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHFDN 3145
            MTKLYESLDFTDNDGGVWKQGFKVEYAMEDVKKVKLKVFVVPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDN EFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEIPKLTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHFDN
Sbjct:  120 MTKLYESLDFTDNDGGVWKQGFKVEYAMEDVKKVKLKVFVVPHSHLDPGWIKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYTPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDNNEFGEFTVSSYQLMNDLIYPVHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEIPKLTIHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQVIGDKVKPEDICMNLMDIDTYAVHFDN 1145          
BLAST of Alpha-mannosidase vs. Planmine SMEST
Match: SMESG000045085.1 (SMESG000045085.1)

HSP 1 Score: 205.297 bits (521), Expect = 6.266e-54
Identity = 223/879 (25.37%), Postives = 391/879 (44.48%), Query Frame = 2
Query:  194 HSHLDPGWIKTVDEYF---KDDTQP-----ILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSIC----CQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL----KKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEF-------NNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSR-ETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAENKLFSH----ILKLFKVDGLLSHTIDIENIVDIRKESNYEISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKI--------PIQGNVYPMTCASYIESKIFDSTRK--VFLLSKQSNGVRVGKTIFKGSTMN-FIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGDN 2707
            H+H D GW+KTVD+Y+   +D+ Q      ILN+++  L + PN KF + E+ YF +WW       +++VK L+   +L+ + GGW M DEAT HY S+I+Q++ G  +L         P   W IDPFG+S     +    G + +   R+ Y  K++  ++K +EF  K    S     I+ ++     YD    C P P  C    C  D         P  +DP  + D NV+ R +   D   K++  Y   N++LVP+G DF+++        + N  KL+ ++N+ ++ ++ + +   + Y  ++    KK KIK     + D F YA   + YWTGYFTSR  LK   +   N  +  + +  LS               N++ L++KI      + + QHHDAV+GT K HV  D+  +L + +   + V   +  +++     N  +D ++ ++ N+ S+    +  ++  + T     V ++N L   R     IP+ V       KI  S   L+  Q+ PI    +        +   + ++F+  +  L +  + I+ +  S+++  S  I   N K+                    +V+ N  K L +    G++  + +L S     +    + Y + +   + SGAY+F P    S +       +   +G+L  EV   +++FS     + +L+    +L     +  I  I      EI +  +TD +   + FF DSN  Q I R+   +         P+ GN YP+    ++ +++ +  RK  + + + ++ GV        GS  N  IE+ + R    DDN G+ EPL +      G  +  + W +    DN
Sbjct:   45 HTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQDSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK---GSFLPTKIHNYLFTNVLYD--SYCTP-PGFCFDDKCSDD---------PIMDDPT-LHDYNVQKRVDDFSDYVIKQSKAYQT-NHLLVPMGCDFQFQNANH---NFVNLDKLIFHVNRLRK-DINVFYSTPACYTLAINKIGKKLKIK-----NDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQ-------------NRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVN--YDFVLCNLLNI-SFCAISDNISYTKLLT-----VLIYNPLGVTRMEWHRIPVNV-LHGDEYKISHSNGSLVPSQLVPITNCTKHLPERPKESLANYELTFQSVLPALGYASLTIIRSKKSNSFTKSSTIKNINSKDK-------------------IVIGN--KYLKLTYDNGFLVSLSNLQSNVSVNITQDMRYYFSYQGNGQKSGAYIFRPTTNES-MPLTKAPKLTIIKGDLVTEV---HQVFSEWGMIVTRLYNDSNILETEWTVGPI-PINDSKGKEIVLQYQTD-IDSDNCFFTDSNGRQIITRQINKRTDYNFTQTEPVAGNYYPVNSHVFL-AELNNKERKKSLVIYTDRAGGV--------GSYKNGMIEIMVHRRTLFDDNFGVGEPLNETGADGNGLIVRGKQWIKFDYIDN 839          
BLAST of Alpha-mannosidase vs. Planmine SMEST
Match: SMESG000045072.1 (SMESG000045072.1)

HSP 1 Score: 180.644 bits (457), Expect = 3.387e-46
Identity = 152/534 (28.46%), Postives = 254/534 (47.57%), Query Frame = 2
Query:  194 HSHLDPGWIKTVDEYF---KDDTQP-----ILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSIC----CQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSL----KKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPI 1741
            H+H D GW+KTVD+Y+   +D+ Q      ILN+++  L + PN KF + E+ YF +WW       +++VK L+   +L+ + GGW M DEAT HY S+I+Q++ G  +L         P   W IDPFG+S     +    G + +   R+ Y  K++  ++K +EF  K    S     I+ ++     YD    C P P  C    C  D         P  +DP  + D NV+ R +   D   K++  Y   N++LVP+G DF+++        + N  KL+ ++N+ ++ ++ + +   + Y  ++    KK KIK     + D F YA   + YWTGYFTSR  LK   +   N  +  + +  LS               N++ L++KI      + + QHHDAV+GT K HV  D+  +L + +   + V   +  +++     N  +D ++ ++ N+ S+    +  ++  + T     V ++N L   R     IP+ V       KI  S   L+  Q+ PI
Sbjct:   45 HTHDDVGWLKTVDQYYYGYRDNIQGAGVQYILNTVISALWENPNRKFSYVEIAYFYRWWQQQGSTVRNRVKVLVNEGRLQFLLGGWCMNDEATTHYVSIIDQMSLGLDFLNKTFGECGRPLVSWQIDPFGHSIEQANIFASMGFDGLFFWRLDYRDKEQRIATKNMEFIQK---GSFLPTKIHNYLFTNVLYD--SYCTP-PGFCFDDKCSDD---------PIMDDPT-LHDYNVQKRVDDFADYVIKQSKAYQT-NHLLVPMGCDFQFQNANH---NFVNLDKLIFHVNRLRK-DINVFYSTPACYTLAINKIGKKLKIK-----NDDFFPYASGPNSYWTGYFTSRSALKGFVQYSNNVFQVCKQLHVLSQQ-------------NRTDLNKKIISMAMKMGVAQHHDAVSGTEKQHVAFDYAQRLSDGLSDCESVINSSLSKLISKETVN--YDFVLCNLLNI-SFCAISDNISYTKLLT-----VLIYNPLGVTRMEWHRIPVNV-LHGDEYKISHSNGSLVPSQLVPI 530          
BLAST of Alpha-mannosidase vs. Planmine SMEST
Match: SMESG000032135.1 (SMESG000032135.1)

HSP 1 Score: 156.377 bits (394), Expect = 1.431e-38
Identity = 191/862 (22.16%), Postives = 369/862 (42.81%), Query Frame = 2
Query:  197 SHLDPGWIKTVDEYFKD--------DTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQKDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNYT--PTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEFRWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRCPWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKTEKEWSIQYRNYIKLMDYMN-KQKEWNVEIKFGILSDYFDSLKKDKIKMFPSLSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIYHNKYKYGL--STVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFKNQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVD----NLKSYSERFNKNNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQLIKCQINPIFQLAEFN-NNQHFVSFKLNIGPLAFERVRILATGISDTYCSSVHIHLYNIKNSMNFKKNF-----QVSSENSLLNKYVVLKNSLKKLHINSTTGYIELVEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTIVHFEGELYDEVVAE-NKLFSHILKLFKVDGLLSHTIDIENIV-DIRKESNYEISMVIKTDF-VAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIESKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRGLFEPLVDNEVVSKGYRLLFEDWKQLKSGD 2704
            SHL+  W+K + E FK         + + + NS+   L      +FI  E+ +F++W+  +   QK  V+      Q + V+GG V+ DEAT HYSS+INQ++ G  ++K N      P   W I+P+G+S+ +  +LKK     + +  V          SK   F     W +++    N +     S        P                 C  G+        N+K  +E  ++   K+  L +N  ++L+P+G DF ++   E    ++N+ K++D +N KQK + V   +   + Y +++  + +K       D F +      +W G+++SRP LK++ R+  ++++  +++ +LS    N+ K  L    V+  +L+ +            QH+D + G     +      +L +AIKM   +     +  ++    N +   + FD      +  S ++        +IQ N    + +FN L  P  + +++P+ +D  +   ++    N L+   I PI ++   N N Q     K NI    + + ++  TG             Y I +    +KNF      + S++ +L   + + NS+  + +N  T  + + +      K  L +  K Y        + + +F+ + + +     S  T    +G L  E+    +      ++LF+        ++IE I+  I + SN+    V+  +  ++ +++FF DSN  Q I+R     + I+ N YP+T    +     +++R + +L      V VG     G T N +E+ ++RI+   D     + L +     K   ++  +W ++ S D
Sbjct:    2 SHLENSWLKELGELFKCTEIHMNKVNIKTLFNSVYLALKINSTRRFIITEISFFQQWYEDLDTTQKATVRIFFDRGQFQFVSGGIVINDEATTHYSSIINQISLGLKFIKVNFGVCARPLVSWQINPYGHSREVANILKKMDFKAIFLGHV---------PSKLSNFDLDFLWQTKDTNDTNFNNTILASIITNGLVAPK--------------MFCFHGH-----CQNNLKSASENFINYVMKRISLQNNKKHILIPIGCDFHFQQALE---TFQNFDKIIDTVNSKQKVFRVF--YSTPACYLEAIS-NSVKTLQIYKSDFFPFDKSMKEFWIGFYSSRPNLKLIIRLAESYIQTCKMITALSDKEFNRRKTKLINDLVYLSNLISKT-----------QHYDYITGNHPGQIAQLKIKELSSAIKMCHDLSAAGVESTMKLKSSNRK-SMLFFDCPYHDFSFCSLTD--------NIQLNKIVNLIVFNPLPYPHTVWIYLPVNLDIHQ-TYEVKDVWNTLLPIDIVPINKMILNNINRQPKSKAKYNI----YFKAQLPETG-------------YTIFSIRRKRKNFWDFNKVLVSKSLILKNNIYISNSIINVSLNLKTNRLIIQKQ---SRKISLFLGIKCYCTNLDVVNASSGVFVSELKDNSQAIHSKPTSYILDGSLVKEIRRRYSNGIGLTIRLFEDQD----NVEIEWIIGGIDENSNFNREYVLTYNSDLSINNQFFTDSNGRQLIKRFLKKGLSIESNFYPITSHVLV-----NNSRNLAMLIHTDRSVAVG-----GKTPNSVELLINRIILSSDKGSFNKQLKEVGANRKILSVIGRNWIEIGSTD 774          
The following BLAST results are available for this feature:
BLAST of Alpha-mannosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAN2A10.000e+038.36mannosidase alpha class 2A member 1 [Source:HGNC S... [more]
MAN2A20.000e+038.13mannosidase alpha class 2A member 2 [Source:HGNC S... [more]
MAN2A20.000e+038.13mannosidase alpha class 2A member 2 [Source:HGNC S... [more]
MAN2A20.000e+041.83mannosidase alpha class 2A member 2 [Source:HGNC S... [more]
MAN2A22.084e-17447.81mannosidase alpha class 2A member 2 [Source:HGNC S... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aman-20.000e+038.57Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
aman-32.897e-13029.74Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:O0... [more]
aman-15.593e-6026.67Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
aman-15.593e-6026.67Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
aman-15.593e-6026.67Alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alpha-Man-IIa0.000e+036.18gene:FBgn0011740 transcript:FBtr0334302[more]
alpha-Man-IIa0.000e+036.18gene:FBgn0011740 transcript:FBtr0082031[more]
alpha-Man-IIb2.860e-13129.77gene:FBgn0026616 transcript:FBtr0334593[more]
alpha-Man-IIb2.860e-13129.77gene:FBgn0026616 transcript:FBtr0345238[more]
alpha-Man-IIb2.860e-13129.77gene:FBgn0026616 transcript:FBtr0083179[more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man2a10.000e+037.88mannosidase, alpha, class 2A, member 1 [Source:ZFI... [more]
man2a20.000e+039.78mannosidase, alpha, class 2A, member 2 [Source:ZFI... [more]
man2a20.000e+039.78mannosidase, alpha, class 2A, member 2 [Source:ZFI... [more]
man2b11.706e-6925.61mannosidase, alpha, class 2B, member 1 [Source:ZFI... [more]
man2a11.084e-6652.15mannosidase, alpha, class 2A, member 1 [Source:ZFI... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man2a10.000e+039.27mannosidase, alpha, class 2A, member 1 [Source:NCB... [more]
man2a20.000e+039.45mannosidase, alpha, class 2A, member 2 [Source:NCB... [more]
man2a20.000e+039.57mannosidase, alpha, class 2A, member 2 [Source:NCB... [more]
man2a20.000e+038.49mannosidase, alpha, class 2A, member 2 [Source:NCB... [more]
man2a10.000e+039.25mannosidase, alpha, class 2A, member 1 [Source:NCB... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Man2a20.000e+037.99mannosidase 2, alpha 2 [Source:MGI Symbol;Acc:MGI:... [more]
Man2a10.000e+037.36mannosidase 2, alpha 1 [Source:MGI Symbol;Acc:MGI:... [more]
Man2a24.710e-15353.46mannosidase 2, alpha 2 [Source:MGI Symbol;Acc:MGI:... [more]
Man2b12.708e-5923.87mannosidase 2, alpha B1 [Source:MGI Symbol;Acc:MGI... [more]
Man2b21.609e-4428.54mannosidase 2, alpha B2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Alpha-mannosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16706|MA2A1_HUMAN0.000e+038.36Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN... [more]
sp|P28494|MA2A1_RAT0.000e+037.74Alpha-mannosidase 2 OS=Rattus norvegicus OX=10116 ... [more]
sp|Q8BRK9|MA2A2_MOUSE0.000e+037.99Alpha-mannosidase 2x OS=Mus musculus OX=10090 GN=M... [more]
sp|P27046|MA2A1_MOUSE0.000e+037.36Alpha-mannosidase 2 OS=Mus musculus OX=10090 GN=Ma... [more]
sp|P49641|MA2A2_HUMAN0.000e+038.13Alpha-mannosidase 2x OS=Homo sapiens OX=9606 GN=MA... [more]
back to top
BLAST of Alpha-mannosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UWP90.000e+040.69Alpha-mannosidase OS=Capitella teleta OX=283909 GN... [more]
A0A3Q2UIM70.000e+039.13Alpha-mannosidase OS=Gallus gallus OX=9031 GN=MAN2... [more]
A0A2I0UFF90.000e+039.28Alpha-mannosidase OS=Limosa lapponica baueri OX=17... [more]
A0A0R4IVS50.000e+037.88Alpha-mannosidase OS=Danio rerio OX=7955 GN=man2a1... [more]
A0A2Y9JRQ00.000e+039.35Alpha-mannosidase OS=Enhydra lutris kenyoni OX=391... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man2a10.000e+037.69mannosidase alpha class 2A member 1 [Source:NCBI g... [more]
man2a20.000e+037.42mannosidase alpha class 2A member 2 [Source:NCBI g... [more]
man2a20.000e+037.02mannosidase alpha class 2A member 2 [Source:NCBI g... [more]
man2a13.807e-16553.22mannosidase alpha class 2A member 1 [Source:NCBI g... [more]
man2b11.536e-6123.97mannosidase, alpha, class 2B, member 1 [Source:ZFI... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006368.11.173e-9250.93pep scaffold:Pmarinus_7.0:GL478975:152485:159376:1... [more]
ENSPMAT00000006359.18.641e-8429.42pep scaffold:Pmarinus_7.0:GL478975:144942:162143:1... [more]
ENSPMAT00000003432.12.687e-6047.11pep scaffold:Pmarinus_7.0:GL488094:1155:3927:-1 ge... [more]
man2b11.085e-5825.37mannosidase, alpha, class 2B, member 1 [Source:ZFI... [more]
ENSPMAT00000000437.15.401e-4326.69pep scaffold:Pmarinus_7.0:GL480287:5325:14229:-1 g... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-mannosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO408660.000e+035.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375842.188e-6925.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333294.836e-622.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-mannosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
man2a20.000e+039.96mannosidase alpha class 2A member 2 [Source:NCBI g... [more]
ENSORLT00000044084.10.000e+036.56alpha-mannosidase 2 [Source:NCBI gene;Acc:10117407... [more]
man2b11.651e-6726.97mannosidase alpha class 2B member 1 [Source:NCBI g... [more]
man2b22.902e-5325.03mannosidase alpha class 2B member 2 [Source:NCBI g... [more]
man2b24.816e-1435.19mannosidase alpha class 2B member 2 [Source:NCBI g... [more]
back to top
BLAST of Alpha-mannosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000018139.10.000e+099.90SMESG000018139.1[more]
SMESG000045085.16.266e-5425.37SMESG000045085.1[more]
SMESG000045072.13.387e-4628.46SMESG000045072.1[more]
SMESG000032135.11.431e-3822.16SMESG000032135.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017604 ID=SMED30017604|Name=Alpha-mannosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=3227bp
ATACTTCAAAACCAGATATTGATGTTAGCTAGACAAGTTATCATAGATCA
TTAATTTTAATTACTAGATGACAAAACTCTACGAATCTTTGGATTTCACT
GATAATGATGGTGGTGTTTGGAAACAAGGATTTAAAGTTGAATATGCAAT
GGAAGATGTAAAGAAAGTAAAACTTAAAGTGTTCGTGGTTCCTCATAGTC
ATCTGGATCCAGGTTGGATAAAAACTGTTGATGAATATTTTAAAGACGAT
ACACAACCCATTCTCAATAGCATGCTAGATTTTCTTATCAAAGAGCCGAA
TATGAAATTTATTCATGCCGAAGTTGTATATTTTGAGAAATGGTGGAATA
CAATAAGCAAAAATCAAAAGGATCAAGTTAAAAAACTTATCAAAAACAAA
CAATTAGAAATCGTAACCGGAGGTTGGGTTATGACTGACGAAGCCACTGC
TCACTATTCTTCAATGATAAATCAACTTGCTGATGGTCATTCGTGGTTGA
AAAACAATCTTAATTACACACCAACAACTGGCTGGGCAATAGATCCATTT
GGTTACAGCCAATTTATGCCATATTTACTAAAAAAGAGCGGAATTAATAA
TATGGTTATTCAGAGAGTTCATTATATTATTAAAAAGCGATTAGCTTCAT
CGAAGCAATTGGAATTTCGATGGAAACAATTTTGGGATTCTGAAAACAAA
TATTCAATCAATTGCCACATGATGCCATTTTTCTCATATGATGTACCTCA
TACCTGTGGTCCAGATCCTTCTATATGTTGTCAATTTGATTTTATCAGGA
TCATATATTTTCGTTGCCCGTGGGGAAACGACCCTGTTGAAATTACAGAT
GAAAATGTAAAAATGAGAGCTGAAATGCTTTTGGATCAATATCGTAAAAA
AGCTCTTTTATACGACAATGGAAACAATGTTTTAGTTCCACTTGGAGATG
ATTTCAGATATAAAACTGAAAAAGAATGGTCAATTCAATATCGAAATTAT
ATAAAATTAATGGATTATATGAATAAGCAAAAAGAATGGAATGTTGAAAT
AAAATTTGGAATTCTCTCTGATTACTTTGATTCTTTGAAAAAGGATAAAA
TCAAAATGTTCCCATCATTATCAGGAGACATGTTTTCTTATGCGGATCGC
CAGGATCACTATTGGACTGGTTATTTTACTTCTAGACCGTTTTTAAAAAT
TTTAGACAGAATTTTAATGAACCATTTACGAGCGGCAGAAATTGTATTAT
CCTTATCTTTAATTTATCATAATAAATATAAATATGGGTTGTCAACTGTG
TTTAATCAAAGCTTGTTACACGAAAAGATAGATGGAAGTCGTAGAACTCT
GTCATTATTTCAGCACCACGACGCTGTAGCTGGAACCTCTAAAGCTCACG
TTGTAGTAGATTTTAAGAATCAATTATTAAACGCAATTAAGATGAGCCAA
TTTGTTTTTACTTATGCTGCTCAAAGAATCTTACAGAATAATATTGGAAA
TAGCCAATTTGATCAAATTATTTTCGATGTGGATAATTTGAAATCTTATT
CCGAAAGATTTAATAAAAATAATTTTATTCATATTCAAACAAATGGAGAA
AGATATGTTTATCTTTTTAATTCTCTTTCTCAACCACGTCAACTTTTAGT
TCATATTCCTATTGAAGTCGATACAGAAAGAATCGGCATTAAAATTATGG
GATCTGGAAACCAGCTAATAAAGTGCCAGATAAATCCTATTTTCCAGTTA
GCAGAATTCAATAATAATCAACACTTTGTTTCTTTTAAATTAAACATTGG
ACCTCTTGCTTTTGAAAGAGTAAGAATACTTGCTACTGGAATATCCGATA
CTTATTGCTCGTCAGTTCATATCCATCTGTATAATATTAAAAATTCGATG
AACTTCAAAAAGAATTTTCAAGTTTCCTCCGAAAATAGCTTATTAAATAA
ATATGTAGTATTGAAGAACTCTTTAAAGAAACTACACATCAATTCTACAA
CCGGATATATTGAATTGGTAGAAGACTTGTACTCTAAATCGAAATATAAA
TTAAACATTGCATTTAAAAAATACGGTGCTAGGCGTTCTCGAGAAACTTC
CGGCGCTTATTTATTTATTCCAGATGGTGAAGGAAGTATAATTGAATTTG
ACTCTCTAAATACTATTGTTCATTTTGAAGGAGAGTTATATGATGAAGTT
GTTGCTGAAAATAAATTGTTTTCTCATATTTTAAAATTGTTCAAAGTCGA
CGGACTATTGTCACATACAATCGATATTGAAAACATAGTTGATATTAGGA
AAGAATCTAACTATGAGATATCTATGGTTATAAAAACAGATTTTGTGGCA
CCTTCTGATGAATTTTTTGTTGATTCGAATTGTTTTCAATTTATTCGACG
GAAAACCTTTGATAAAATACCAATTCAGGGTAATGTTTACCCAATGACTT
GTGCGTCGTATATAGAATCGAAAATATTTGATTCTACTCGTAAAGTGTTC
TTGCTTTCTAAGCAGTCAAACGGTGTACGTGTTGGCAAAACGATTTTTAA
AGGCTCTACAATGAATTTTATTGAAGTATTCTTGGACCGAATTCTAAATC
AAGATGATAATAGAGGTTTATTTGAACCTCTTGTTGATAATGAGGTCGTT
TCTAAAGGCTATCGATTACTCTTTGAAGATTGGAAACAATTAAAAAGTGG
TGATAACAAAGAATTTGGTGAATTTACAGTTTCTAGTTATCAGCTAATGA
ATGATTTGATTTACCCGGTTCATCAAATGTTTGTAAAAACCAATTTTACA
AATTCGGTCCCATCTAATCTGGTTGGTCAAAAAAGTCTTTTAACTGGTTA
TGGATTACCATGCGACTACCATTTAATTAACTTCAAAACAAATATCAATG
AGATTCCAAAATTGACGATCCATCGTTTGAAATTAAATTGCTATGCTGGT
TACATTTCTGAAGGATCTTGTAAATTTCTCCGAAAAAAATCACCCTTAAT
GAAATCCATGTTTGATGATGTCTCAATTAAATATGTAAATAAATTTTCTT
TATCTGGAAATCAAGTTATTGGAGATAAAGTGAAGCCAGAAGATATTTGT
ATGAATCTAATGGATATAGATACATACGCAGTGCATTTCGATAATTAATT
TGTTCAAATCGTTATGTATTATTTTTATGAAAATTATTTCTTTTATATAG
TTATGTTTATTTATTTTATGAATTACA
back to top

protein sequence of SMED30017604-orf-1

>SMED30017604-orf-1 ID=SMED30017604-orf-1|Name=SMED30017604-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1027bp
MTKLYESLDFTDNDGGVWKQGFKVEYAMEDVKKVKLKVFVVPHSHLDPGW
IKTVDEYFKDDTQPILNSMLDFLIKEPNMKFIHAEVVYFEKWWNTISKNQ
KDQVKKLIKNKQLEIVTGGWVMTDEATAHYSSMINQLADGHSWLKNNLNY
TPTTGWAIDPFGYSQFMPYLLKKSGINNMVIQRVHYIIKKRLASSKQLEF
RWKQFWDSENKYSINCHMMPFFSYDVPHTCGPDPSICCQFDFIRIIYFRC
PWGNDPVEITDENVKMRAEMLLDQYRKKALLYDNGNNVLVPLGDDFRYKT
EKEWSIQYRNYIKLMDYMNKQKEWNVEIKFGILSDYFDSLKKDKIKMFPS
LSGDMFSYADRQDHYWTGYFTSRPFLKILDRILMNHLRAAEIVLSLSLIY
HNKYKYGLSTVFNQSLLHEKIDGSRRTLSLFQHHDAVAGTSKAHVVVDFK
NQLLNAIKMSQFVFTYAAQRILQNNIGNSQFDQIIFDVDNLKSYSERFNK
NNFIHIQTNGERYVYLFNSLSQPRQLLVHIPIEVDTERIGIKIMGSGNQL
IKCQINPIFQLAEFNNNQHFVSFKLNIGPLAFERVRILATGISDTYCSSV
HIHLYNIKNSMNFKKNFQVSSENSLLNKYVVLKNSLKKLHINSTTGYIEL
VEDLYSKSKYKLNIAFKKYGARRSRETSGAYLFIPDGEGSIIEFDSLNTI
VHFEGELYDEVVAENKLFSHILKLFKVDGLLSHTIDIENIVDIRKESNYE
ISMVIKTDFVAPSDEFFVDSNCFQFIRRKTFDKIPIQGNVYPMTCASYIE
SKIFDSTRKVFLLSKQSNGVRVGKTIFKGSTMNFIEVFLDRILNQDDNRG
LFEPLVDNEVVSKGYRLLFEDWKQLKSGDNKEFGEFTVSSYQLMNDLIYP
VHQMFVKTNFTNSVPSNLVGQKSLLTGYGLPCDYHLINFKTNINEIPKLT
IHRLKLNCYAGYISEGSCKFLRKKSPLMKSMFDDVSIKYVNKFSLSGNQV
IGDKVKPEDICMNLMDIDTYAVHFDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR037094Glyco_hydro_38_cen_sf
IPR015341Glyco_hydro_38_cen
IPR013780Glyco_hydro_b
IPR027291Glyco_hydro_38_N_sf
IPR000602Glyco_hydro_38_N
IPR011682Glyco_hydro_38_C
IPR011013Gal_mutarotase_sf_dom
IPR011330Glyco_hydro/deAcase_b/a-brl
IPR028995Glyco_hydro_57/38_cen_sf
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0008270zinc ion binding
GO:0004559alpha-mannosidase activity
GO:0015923mannosidase activity
GO:0030246carbohydrate binding
GO:0003824catalytic activity
GO:0004572mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0016799hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0001701in utero embryonic development
GO:0001889liver development
GO:0006486protein glycosylation
GO:0006491N-glycan processing
GO:0006517protein deglycosylation
GO:0007005mitochondrion organization
GO:0007033vacuole organization
GO:0007585respiratory gaseous exchange
GO:0008152metabolic process
GO:0048286lung alveolus development
GO:0050769positive regulation of neurogenesis
GO:0060042retina morphogenesis in camera-type eye
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005615extracellular space
GO:0005794Golgi apparatus
GO:0005801cis-Golgi network
GO:0016020membrane
GO:0016021integral component of membrane
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015341Glycoside hydrolase family 38, central domainSMARTSM00872Alpha_mann_mid_2coord: 364..453
e-value: 6.4E-27
score: 105.4
IPR015341Glycoside hydrolase family 38, central domainPFAMPF09261Alpha-mann_midcoord: 364..469
e-value: 6.0E-20
score: 71.2
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 486..908
e-value: 4.2E-57
score: 195.9
NoneNo IPR availableGENE3DG3DSA:2.70.98.30coord: 603..901
e-value: 4.2E-57
score: 195.9
NoneNo IPR availablePANTHERPTHR11607ALPHA-MANNOSIDASEcoord: 9..1023
NoneNo IPR availablePANTHERPTHR11607:SF57ALPHA-MANNOSIDASE 2Xcoord: 9..1023
NoneNo IPR availableCDDcd10809GH38N_AMII_GMII_SfManIII_likecoord: 42..370
e-value: 0.0
score: 574.983
IPR037094Glycoside hydrolase family 38, central domain superfamilyGENE3DG3DSA:1.20.1270.50coord: 363..484
e-value: 1.4E-30
score: 107.5
IPR011682Glycosyl hydrolase family 38, C-terminalPFAMPF07748Glyco_hydro_38Ccoord: 632..849
e-value: 2.2E-15
score: 57.3
IPR000602Glycoside hydrolase family 38, N-terminal domainPFAMPF01074Glyco_hydro_38Ncoord: 37..359
e-value: 2.9E-94
score: 315.7
IPR027291Glycoside hydrolase 38, N-terminal domain superfamilyGENE3DG3DSA:3.20.110.10coord: 1..362
e-value: 3.0E-153
score: 512.3
IPR028995Glycoside hydrolase families 57/38, central domain superfamilySUPERFAMILYSSF88688Families 57/38 glycoside transferase middle domaincoord: 364..476
IPR011330Glycoside hydrolase/deacetylase, beta/alpha-barrelSUPERFAMILYSSF88713Glycoside hydrolase/deacetylasecoord: 2..361
IPR011013Galactose mutarotase-like domain superfamilySUPERFAMILYSSF74650Galactose mutarotase-likecoord: 500..1024