Calcium-activated potassium channel slo-1, putative

Overview
NameCalcium-activated potassium channel slo-1, putative
Smed IDSMED30017593
Length (bp)3520
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-activated potassium channel slo-1, putative (SMED30017593) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-activated potassium channel slo-1, putative (SMED30017593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-activated potassium channel slo-1, putative (SMED30017593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-activated potassium channel slo-1, putative (SMED30017593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017593SMESG000076792.1 dd_Smed_v4_20110_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30017593SMESG000076792.1 dd_Smed_v6_19287_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 968.378 bits (2502), Expect = 0.000e+0
Identity = 524/1009 (51.93%), Postives = 700/1009 (69.38%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHS-SSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG-QSAKRRSQAL----------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR + S   I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +    + Y+     ++    N + + E     +P T+   +++R GG +++   S  L          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   91 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLKVAARSRYSKDPFEFKKETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1083          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 967.992 bits (2501), Expect = 0.000e+0
Identity = 524/1008 (51.98%), Postives = 699/1008 (69.35%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG-QSAKRRSQAL----------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +    + Y+     ++    N + + E     +P T+   +++R GG +++   S  L          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   91 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLKVAARSRYSKDPFEFKKETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1079          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 524/1008 (51.98%), Postives = 699/1008 (69.35%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG-QSAKRRSQAL----------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +    + Y+     ++    N + + E     +P T+   +++R GG +++   S  L          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  156 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLKVAARSRYSKDPFEFKKETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1144          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 524/1008 (51.98%), Postives = 699/1008 (69.35%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG-QSAKRRSQAL----------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +    + Y+     ++    N + + E     +P T+   +++R GG +++   S  L          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  156 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLKVAARSRYSKDPFEFKKETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1144          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:HGNC Symbol;Acc:HGNC:6284])

HSP 1 Score: 965.296 bits (2494), Expect = 0.000e+0
Identity = 525/1011 (51.93%), Postives = 701/1011 (69.34%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQ---DTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG-QSAKRRSQAL----------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+   +F+    + Y+     ++    N + + E     +P T+   +++R GG +++   S  L          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  132 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLIYFKVAARSRYSKDPFEFKKETPNSRLVTEPVEDEQPSTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1123          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 556/1127 (49.33%), Postives = 753/1127 (66.81%), Query Frame = 2
Query:  107 NCFL-RIHLKLMESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSV---KPCNCQSSQHFQDTLYNIVSCS------WQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRF-----DSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNL-------QSKDLSEIFKNLS--TSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            NC L R+ +++ E ++ C E R Y   +LS SI  F    +L   + V T    +R+  E+          P+     V ++         E   F K+  +                       +L W+ EAKDWAGE+ISGQ+ TGR L+ +V  LS+GSLIIYF + S  Q    E CI W +S +QQ DL FNI FL++F +R+IAA+DK WF +E+YS +D  T+PP+F+   L R W+G RF RALRL++  D+L +LNILK+SS IRL  LVT+F ++ LT AG +HL+E +GD  +   N    TY D  YF++ TMSTVGYGDI C T  G+L MIFFIL GLA+FA+ +PEI ++IGNR +YGG +K E GK+HI++CGHIT+ SVS+FL DFLH+DR+DVDV++V L  + P+++L+ + KR+  +V+FF G+VM++ DL+RV++  ADACL+L +KYS +PDAEDAANIMRVISIKNY   I+VIVQLMQYHNKAYL+NIPSWDW+RGDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK   H P W+N Y+ GA +EMYTE LSPSF  ++F EA  + F +L LLL+A+E+K  +  N   +IAINP P I I+P TQGFFIA+SAD+ KRAF++C  CH   K V   K C C++   F+    +  +         Q F     +    +   + +  + N+++   G   +R S ++      + F++  +++F     DSTGMFHWC +R  E  +L  +   + TV + H+VVC+FAD +SPLIGLR+F+MPLRSSN+HY+EL+ ++ VG  +YLR+EWK+L N PKI +LNGSPL+R+ LR +NINLC+M VI+S    N   D  LADKEAIL SLNIKAM+F DD L       Q+ D S +   +S     +   + +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFA+SVLDSLMST YFN++ALTLIRT+VTGGAT ELE +L+EG+G++G Y TPET++NRDRCR+  + L+++PY  +  N  TYG++F    + YG LC GLYRL   +  D       +  R+V+TNP  E  + N D+V+V
Sbjct:   22 NCNLSRVFMEMTEEDRKCLEERKYWCFLLS-SITTFCASMILVVIWRVVTHLCCQRREKEFV--------EPIPAPEAVQINMNGSKHAPSETDPFLKQQEE----------------------KHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDAS-FQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELK--DEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQRPSSG--GRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPN-TEDTTLADKEAILASLNIKAMQF-DDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHN-TTYGAMFTIALRRYGQLCIGLYRLHDQDNPD-------SMKRYVITNPPAELRIKNTDYVYV 1101          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 561/1142 (49.12%), Postives = 761/1142 (66.64%), Query Frame = 2
Query:  107 NCFL-RIHLKLMESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSV---KPCNCQSSQHF-QDTLYNIVSCSWQMFN-----NNGKSLIERNSFSKPET---------------VIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRF-----DSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNL-------QSKDLSEIFKNLS--TSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            NC L R+ +++ E ++ C E R Y   +LS SI  F    +L   + V T    +R+  E+          P+     V ++         E   F K+  +                       +L W+ EAKDWAGE+ISGQ+ TGR L+ +V  LS+GSLIIYF + S  Q    E CI W +S +QQ DL FNI FL++F +R+IAA+DK WF +E+YS +D  T+PP+F+   L R W+G RF RALRL++  D+L +LNILK+SS IRL  LVT+F ++ LT AG +HL+E +GD  +   N    TY D  YF++ TMSTVGYGDI C T  G+L MIFFIL GLA+FA+ +PEI ++IGNR +YGG +K E GK+HI++CGHIT+ SVS+FL DFLH+DR+DVDV++V L  + P+++L+ + KR+  +V+FF G+VM++ DL+RV++  ADACL+L +KYS +PDAEDAANIMRVISIKNY   I+VIVQLMQYHNKAYL+NIPSWDW+RGDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK   H P W+N Y+ GA +EMYTE LSPSF  ++F EA  + F +L LLL+A+E+K  +  N   +IAINP P I I+P TQGFFIA+SAD+ KRAF++C  CH   K V   K C C++   F ++T ++  +  +  F+     N+ ++      F +P+                +I  +R   GG   +R S ++      + F++  +++F     DSTGMFHWC +R  E  +L  +   + TV + H+VVC+FAD +SPLIGLR+F+MPLRSSN+HY+EL+ ++ VG  +YLR+EWK+L N PKI +LNGSPL+R+ LR +NINLC+M VI+S    N   D  LADKEAIL SLNIKAM+F DD L       Q+ D S +   +S     +   + +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFA+SVLDSLMST YFN++ALTLIRT+VTGGAT ELE +L+EG+G++G Y TPET++NRDRCR+  + L+++PY  +  N  TYG++F    + YG LC GLYRL   +  D       +  R+V+TNP  E  + N D+V+V
Sbjct:   22 NCNLSRVFMEMTEEDRKCLEERKYWCFLLS-SITTFCASMILVVIWRVVTHLCCQRREKEFV--------EPIPAPEAVQINMNGSKHAPSETDPFLKQQEE----------------------KHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDAS-FQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELK--DEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARDYSDFDALFYQNDARATDVLQQF-QPQAPAGPMGHLGQQVQLRMINQQRPSSGG---RRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPN-TEDTTLADKEAILASLNIKAMQF-DDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHN-TTYGAMFTIALRRYGQLCIGLYRLHDQDNPD-------SMKRYVITNPPAELRIKNTDYVYV 1114          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 560/1148 (48.78%), Postives = 755/1148 (65.77%), Query Frame = 2
Query:  107 NCFL-RIHLKLMESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSV---KPCNCQSSQHFQDTLYNIVSCS------WQMFNNNGKS-------------LIERNSFSKPETVIRNRRKRFG--------GQSAKRRSQALNDTIHHIKFNEQSQRRF-----DSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNL-------QSKDLSEIFKNLS--TSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            NC L R+ +++ E ++ C E R Y   +LS SI  F    +L   + V T    +R+  E+          P+     V ++         E   F K+  +                       +L W+ EAKDWAGE+ISGQ+ TGR L+ +V  LS+GSLIIYF + S  Q    E CI W +S +QQ DL FNI FL++F +R+IAA+DK WF +E+YS +D  T+PP+F+   L R W+G RF RALRL++  D+L +LNILK+SS IRL  LVT+F ++ LT AG +HL+E +GD  +   N    TY D  YF++ TMSTVGYGDI C T  G+L MIFFIL GLA+FA+ +PEI ++IGNR +YGG +K E GK+HI++CGHIT+ SVS+FL DFLH+DR+DVDV++V L  + P+++L+ + KR+  +V+FF G+VM++ DL+RV++  ADACL+L +KYS +PDAEDAANIMRVISIKNY   I+VIVQLMQYHNKAYL+NIPSWDW+RGDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK   H P W+N Y+ GA +EMYTE LSPSF  ++F EA  + F +L LLL+A+E+K  +  N   +IAINP P I I+P TQGFFIA+SAD+ KRAF++C  CH   K V   K C C++   F+    +  +         Q F     +             +I + S S  +T +  +  RF             +R S ++      + F++  +++F     DSTGMFHWC +R  E  +L  +   + TV + H+VVC+FAD +SPLIGLR+F+MPLRSSN+HY+EL+ ++ VG  +YLR+EWK+L N PKI +LNGSPL+R+ LR +NINLC+M VI+S    N   D  LADKEAIL SLNIKAM+F DD L       Q+ D S +   +S     +   + +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFA+SVLDSLMST YFN++ALTLIRT+VTGGAT ELE +L+EG+G++G Y TPET++NRDRCR+  + L+++PY  +  N  TYG++F    + YG LC GLYRL   +  D       +  R+V+TNP  E  + N D+V+V
Sbjct:   22 NCNLSRVFMEMTEEDRKCLEERKYWCFLLS-SITTFCASMILVVIWRVVTHLCCQRREKEFV--------EPIPAPEAVQINMNGSKHAPSETDPFLKQQEE----------------------KHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDAS-FQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELK--DEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARARATDVLQQFQPQAPAGPMGHLGQQVQLRMINQQS-STSDTHLNTKSLRFAYEIKKLMPSSGGRRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPN-TEDTTLADKEAILASLNIKAMQF-DDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHN-TTYGAMFTIALRRYGQLCIGLYRLHDQDNPD-------SMKRYVITNPPAELRIKNTDYVYV 1123          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 958.362 bits (2476), Expect = 0.000e+0
Identity = 561/1142 (49.12%), Postives = 762/1142 (66.73%), Query Frame = 2
Query:  107 NCFL-RIHLKLMESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSV---KPCNCQSSQHF-QDTLYNIVSCSWQMFN-----NNGKSLIERNSFSKPET---------------VIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRF-----DSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNL-------QSKDLSEIFKNLS--TSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            NC L R+ +++ E ++ C E R Y   +LS SI  F    +L   + V T    +R+  E+          P+     V ++         E   F K+  +                       +L W+ EAKDWAGE+ISGQ+ TGR L+ +V  LS+GSLIIYF + S  Q    E CI W +S +QQ DL FNI FL++F +R+IAA+DK WF +E+YS +D  T+PP+F+   L R W+G RF RALRL++  D+L +LNILK+SS IRL  LVT+F ++ LT AG +HL+E +GD  +   N    TY D  YF++ TMSTVGYGDI C T  G+L MIFFIL GLA+FA+ +PEI ++IGNR +YGG +K E GK+HI++CGHIT+ SVS+FL DFLH+DR+DVDV++V L  + P+++L+ + KR+  +V+FF G+VM++ DL+RV++  ADACL+L +KYS +PDAEDAANIMRVISIKNY   I+VIVQLMQYHNKAYL+NIPSWDW+RGDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK     P+W+N Y+ GA +EMYT+ LS SF G+TF EAV + F +L LLL+A+E+K  +  N   +IAINP P I I+P TQGFFIA+SAD+ KRAF++C  CH   K V   K C C++   F ++T ++  +  +  F+     N+ ++      F +P+                +I  +R   GG   +R S ++      + F++  +++F     DSTGMFHWC +R  E  +L  +   + TV + H+VVC+FAD +SPLIGLR+F+MPLRSSN+HY+EL+ ++ VG  +YLR+EWK+L N PKI +LNGSPL+R+ LR +NINLC+M VI+S    N   D  LADKEAIL SLNIKAM+F DD L       Q+ D S +   +S     +   + +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFA+SVLDSLMST YFN++ALTLIRT+VTGGAT ELE +L+EG+G++G Y TPET++NRDRCR+  + L+++PY  +  N  TYG++F    + YG LC GLYRL   +  D       +  R+V+TNP  E  + N D+V+V
Sbjct:   22 NCNLSRVFMEMTEEDRKCLEERKYWCFLLS-SITTFCASMILVVIWRVVTHLCCQRREKEFV--------EPIPAPEAVQINMNGSKHAPSETDPFLKQQEE----------------------KHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDAS-FQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSQTTPDWLNLYLCGAGMEMYTDTLSHSFVGMTFPEAVDLLFNRLGLLLLAIELK--DEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAARDYSDFDALFYQNDARATDVLQQF-QPQAPAGPMGHLGQQVQLRMINQQRPSSGG---RRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPN-TEDTTLADKEAILASLNIKAMQF-DDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHN-TTYGAMFTIALRRYGQLCIGLYRLHDQDNPD-------SMKRYVITNPPAELRIKNTDYVYV 1114          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Match: slo-1 (Calcium-activated potassium channel slo-1 [Source:UniProtKB/Swiss-Prot;Acc:Q95V25])

HSP 1 Score: 958.362 bits (2476), Expect = 0.000e+0
Identity = 559/1149 (48.65%), Postives = 757/1149 (65.88%), Query Frame = 2
Query:  107 NCFL-RIHLKLMESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSV---KPCNCQSSQHFQDTLYNIVSCSWQ-------------MFNNNGKSLIERNSFSKPET---------------VIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRF-----DSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNL-------QSKDLSEIFKNLS--TSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            NC L R+ +++ E ++ C E R Y   +LS SI  F    +L   + V T    +R+  E+          P+     V ++         E   F K+  +                       +L W+ EAKDWAGE+ISGQ+ TGR L+ +V  LS+GSLIIYF + S  Q    E CI W +S +QQ DL FNI FL++F +R+IAA+DK WF +E+YS +D  T+PP+F+   L R W+G RF RALRL++  D+L +LNILK+SS IRL  LVT+F ++ LT AG +HL+E +GD  +   N    TY D  YF++ TMSTVGYGDI C T  G+L MIFFIL GLA+FA+ +PEI ++IGNR +YGG +K E GK+HI++CGHIT+ SVS+FL DFLH+DR+DVDV++V L  + P+++L+ + KR+  +V+FF G+VM++ DL+RV++  ADACL+L +KYS +PDAEDAANIMRVISIKNY   I+VIVQLMQYHNKAYL+NIPSWDW+RGDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK   H P W+N Y+ GA +EMYTE LSPSF  ++F EA  + F +L LLL+A+E+K  +  N   +IAINP P I I+P TQGFFIA+SAD+ KRAF++C  CH   K V   K C C++   F+    +  +   +              + N+ ++      F +P+                +I  +R   GG   +R S ++      + F++  +++F     DSTGMFHWC +R  E  +L  +   + TV + H+VVC+FAD +SPLIGLR+F+MPLRSSN+HY+EL+ ++ VG  +YLR+EWK+L N PKI +LNGSPL+R+ LR +NINLC+M VI+S    N   D  LADKEAIL SLNIKAM+F DD L       Q+ D S +   +S     +   + +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFA+SVLDSLMST YFN++ALTLIRT+VTGGAT ELE +L+EG+G++G Y TPET++NRDRCR+  + L+++PY  +  N  TYG++F    + YG LC GLYRL   +  D       +  R+V+TNP  E  + N D+V+V
Sbjct:   22 NCNLSRVFMEMTEEDRKCLEERKYWCFLLS-SITTFCASMILVVIWRVVTHLCCQRREKEFV--------EPIPAPEAVQINMNGSKHAPSETDPFLKQQEE----------------------KHLGWMTEAKDWAGELISGQSLTGRFLVLLVFILSIGSLIIYFYDAS-FQNFQVETCIPWQDSPSQQIDLGFNIFFLVYFFIRFIAASDKVWFLLEMYSWIDFFTIPPSFVAIYLQRNWLGFRFLRALRLMTVPDILQYLNILKTSSSIRLTQLVTIFVAVCLTGAGLVHLLENSGDFFKGFINPHRITYADSVYFVLVTMSTVGYGDIYCTTLCGRLFMIFFILFGLAMFASYVPEIADLIGNRQKYGGEYKGEHGKKHIVVCGHITYDSVSHFLQDFLHEDRDDVDVEVVFLHRVVPDLELEGLFKRHFTKVEFFTGTVMDSLDLSRVKIGDADACLVLANKYSTNPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWKRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPLWLNDYLRGAGMEMYTESLSPSFANMSFPEAANLLFNRLGLLLLAIELK--DEENKECNIAINPGPHIVIQPQTQGFFIAQSADEVKRAFFWCKQCHDDIKDVSLIKKCKCKNLALFRRNTKHSTAAREKNAKISDYSDFDALFYQNDARATDVLQQF-QPQAPAGPMGHLGQQVQLRMINQQRPSSGG---RRNSMSIPPDGRGVDFSKDFEQQFQDMKYDSTGMFHWCPSRNLEDCVL-ERHQAAMTVLNGHVVVCLFADQDSPLIGLRNFIMPLRSSNFHYHELKHVVIVGDLEYLRKEWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIISARVPN-TEDTTLADKEAILASLNIKAMQF-DDTLGFFPMRHQTGDRSPLGSPISMQKKGAKFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGYSTPETLSNRDRCRIAQISLQDNPYDGVVHN-TTYGAMFTIALRRYGQLCIGLYRLHDQDNPD-------SMKRYVITNPPAELRIKNTDYVYV 1121          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0334294)

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 524/1019 (51.42%), Postives = 699/1019 (68.60%), Query Frame = 2
Query:  488 WIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKS---VKPCNCQS------------------SQHFQDTL------------YNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTN-HSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSAS------HQNSI----IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            ++ EAKDWAGE+ISGQ  TGR+L+ +V  LS+ SLIIYF++ S  +    E C KWS + TQQ DLAFNI F+++F +R+IAA+DK WF +E+YS VD  T+PP+F++  L+R W+GLRF RALRL++  D+L +LN+LK+SS IRL  LV++F S+ LT+AG IHL+E +GD  +  N    +Y+   YF+I TMSTVGYGD+ C+T  G+  ++FF+L GLA+FA+SIPEIIE++G+ N+YGG  K+E GK+HI++CGHIT++SVS+FL DFLH+DREDVDV++V L    P+++L+ + KR+   V+FFQG++MN  DL RV++  ADACL+L +KY  DPDAEDAANIMRVISIKNY   I+VI+QLMQYHNKAYL+NIPSWDW++GDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK       W N Y++G   EMYTE LSPSF G+TF +A  +CF+KL LLL+A+E+K        S I+INP+    I+  TQGFFIA+SAD+ KRA++YC ACH   K    +K C C++                    H  +T              N V  +  +       +I  + +++P +       +         +   +D      F E+++ ++DSTGMFHW   +  E  IL +++  + TV + H+VVC+FAD +SPLIGLR+ VMPLR+SN+HY+EL+ ++ VG  DY+RREWK L N PKI VLNGSPL+R+ LR +N+NLC+M  ILS    SN   D  LADKEAIL SLNIKAM F D           F NLS +A        + S+    +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMST YFN+NALTLIR+++TGGAT ELE +L+EG+G++G Y T E+++NRDRCRV  + L + P ++ FG    YG LF+   K YG+LC GLYR       D S S   +  R+V+TNP  +  L+  D VFV
Sbjct:   90 FMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEEV---ERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIK-GAEEGADSKISINPR-GAKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDF-EKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND--DPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGKYGDLFVAALKSYGMLCIGLYRF-----RDTSSSCDASSKRYVITNPPDDFSLLPTDQVFV 1093          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100632)

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 526/1031 (51.02%), Postives = 700/1031 (67.90%), Query Frame = 2
Query:  488 WIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKS---VKPCNC-----QSSQHFQDTLYN----------IVSCSWQMFNNN----------GK-----------------SLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTN-HSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSAS------HQNSI----IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            ++ EAKDWAGE+ISGQ  TGR+L+ +V  LS+ SLIIYF++ S  +    E C KWS + TQQ DLAFNI F+++F +R+IAA+DK WF +E+YS VD  T+PP+F++  L+R W+GLRF RALRL++  D+L +LN+LK+SS IRL  LV++F S+ LT+AG IHL+E +GD  +  N    +Y+   YF+I TMSTVGYGD+ C+T  G+  ++FF+L GLA+FA+SIPEIIE++G+ N+YGG  K+E GK+HI++CGHIT++SVS+FL DFLH+DREDVDV++V L    P+++L+ + KR+   V+FFQG++MN  DL RV++  ADACL+L +KY  DPDAEDAANIMRVISIKNY   I+VI+QLMQYHNKAYL+NIPSWDW++GDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK    +  W N Y+ G  +EMYTE LSP+F G+ F +A  +CF+KL LLL+A+E+K        S I+INP+    I+  TQGFFIA+SAD+ KRA++YC ACH   K    +K C C     Q    F D + N            +      NN           GK                  +I  + +++P +       +         +   +D      F E+++ ++DSTGMFHW   +  E  IL +++  + TV + H+VVC+FAD +SPLIGLR+ VMPLR+SN+HY+EL+ ++ VG  DY+RREWK L N PKI VLNGSPL+R+ LR +N+NLC+M  ILS    SN   D  LADKEAIL SLNIKAM F D           F NLS +A        + S+    +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMST YFN+NALTLIR+++TGGAT ELE +L+EG+G++G Y T E+++NRDRCRV  + L + P ++ FG    YG LF+   K YG+LC GLYR       D S S   +  R+V+TNP  +  L+  D VFV
Sbjct:  107 FMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEEV---ERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDMQSWTNDYLRGTGMEMYTETLSPTFIGIPFAQATELCFSKLKLLLLAIEIK-GAEEGADSKISINPR-GAKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLVLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDF-EKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND--DPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGKYGDLFVAALKSYGMLCIGLYRF-----RDTSSSCDASSKRYVITNPPDDFSLLPTDQVFV 1122          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100636)

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 528/1031 (51.21%), Postives = 700/1031 (67.90%), Query Frame = 2
Query:  488 WIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKS---VKPCNC-----QSSQHFQDTLYN----------IVSCSWQMFNNN----------GK-----------------SLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTN-HSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSAS------HQNSI----IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            ++ EAKDWAGE+ISGQ  TGR+L+ +V  LS+ SLIIYF++ S  +    E C KWS + TQQ DLAFNI F+++F +R+IAA+DK WF +E+YS VD  T+PP+F++  L+R W+GLRF RALRL++  D+L +LN+LK+SS IRL  LV++F S+ LT+AG IHL+E +GD  +  N    +Y+   YF+I TMSTVGYGD+ C+T  G+  ++FF+L GLA+FA+SIPEIIE++G+ N+YGG  K+E GK+HI++CGHIT++SVS+FL DFLH+DREDVDV++V L    P+++L+ + KR+   V+FFQG++MN  DL RV++  ADACL+L +KY  DPDAEDAANIMRVISIKNY   I+VI+QLMQYHNKAYL+NIPSWDW++GDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK       W N Y++G   EMYTE LSPSF G+TF +A  +CF+KL LLL+A+E+K        S I+INP+    I+  TQGFFIA+SAD+ KRA++YC ACH   K    +K C C     Q    F D + N            +      NN           GK                  +I  + +++P +       +         +   +D      F E+++ ++DSTGMFHW   +  E  IL +++  + TV + H+VVC+FAD +SPLIGLR+ VMPLR+SN+HY+EL+ ++ VG  DY+RREWK L N PKI VLNGSPL+R+ LR +N+NLC+M  ILS    SN   D  LADKEAIL SLNIKAM F D           F NLS +A        + S+    +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMST YFN+NALTLIR+++TGGAT ELE +L+EG+G++G Y T E+++NRDRCRV  + L + P ++ FG    YG LF+   K YG+LC GLYR       D S S   +  R+V+TNP  +  L+  D VFV
Sbjct:  107 FMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEEV---ERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIK-GAEEGADSKISINPR-GAKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLVLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDF-EKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND--DPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGKYGDLFVAALKSYGMLCIGLYRF-----RDTSSSCDASSKRYVITNPPDDFSLLPTDQVFV 1122          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0100637)

HSP 1 Score: 966.066 bits (2496), Expect = 0.000e+0
Identity = 527/1031 (51.12%), Postives = 697/1031 (67.60%), Query Frame = 2
Query:  488 WIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKS---VKPCNC-----QSSQHFQDTLYN----------IVSCSWQMFNNN----------GK-----------------SLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTN-HSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSAS------HQNSI----IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            ++ EAKDWAGE+ISGQ  TGR+L+ +V  LS+ SLIIYF++ S  +    E C KWS + TQQ DLAFNI F+++F +R+IAA+DK WF +E+YS VD  T+PP+F++  L+R W+GLRF RALRL++  D+L +LN+LK+SS IRL  LV++F S+ LT+AG IHL+E +GD  +  N    +Y+   YF+I TMSTVGYGD+ C+T  G+  ++FF+L GLAIFA+ IPEII++IG R +YGG  K E G++HI++CGHIT++SVS+FL DFLH+DREDVDV++V L    P+++L+ + KR+   V+FFQG++MN  DL RV++  ADACL+L +KY  DPDAEDAANIMRVISIKNY   I+VI+QLMQYHNKAYL+NIPSWDW++GDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK       W N Y++G   EMYTE LSPSF G+TF +A  +CF+KL LLL+A+E+K        S I+INP+    I+  TQGFFIA+SAD+ KRA++YC ACH   K    +K C C     Q    F D + N            +      NN           GK                  +I  + +++P +       +         +   +D      F E+++ ++DSTGMFHW   +  E  IL +++  + TV + H+VVC+FAD +SPLIGLR+ VMPLR+SN+HY+EL+ ++ VG  DY+RREWK L N PKI VLNGSPL+R+ LR +N+NLC+M  ILS    SN   D  LADKEAIL SLNIKAM F D           F NLS +A        + S+    +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMST YFN+NALTLIR+++TGGAT ELE +L+EG+G++G Y T E+++NRDRCRV  + L + P ++ FG    YG LF+   K YG+LC GLYR       D S S   +  R+V+TNP  +  L+  D VFV
Sbjct:  107 FMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEEV---ERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAIFASCIPEIIDLIGTRAKYGGTLKNEKGRRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIK-GAEEGADSKISINPR-GAKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLTVQPRSKFDDLVLNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDF-EKTEMKYDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND--DPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGKYGDLFVAALKSYGMLCIGLYRF-----RDTSSSCDASSKRYVITNPPDDFSLLPTDQVFV 1122          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Match: slo (gene:FBgn0003429 transcript:FBtr0334296)

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 524/1036 (50.58%), Postives = 698/1036 (67.37%), Query Frame = 2
Query:  488 WIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKS---VKPCNCQSSQHFQDTLYNIVSCSWQMFNNN------------------------------GK-----------------SLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTN-HSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSAS------HQNSI----IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            ++ EAKDWAGE+ISGQ  TGR+L+ +V  LS+ SLIIYF++ S  +    E C KWS + TQQ DLAFNI F+++F +R+IAA+DK WF +E+YS VD  T+PP+F++  L+R W+GLRF RALRL++  D+L +LN+LK+SS IRL  LV++F S+ LT+AG IHL+E +GD  +  N    +Y+   YF+I TMSTVGYGD+ C+T  G+  ++FF+L GLA+FA+SIPEIIE++G+ N+YGG  K+E GK+HI++CGHIT++SVS+FL DFLH+DREDVDV++V L    P+++L+ + KR+   V+FFQG++MN  DL RV++  ADACL+L +KY  DPDAEDAANIMRVISIKNY   I+VI+QLMQYHNKAYL+NIPSWDW++GDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK       W N Y++G   EMYTE LSPSF G+TF +A  +CF+KL LLL+A+E+K        S I+INP+    I+  TQGFFIA+SAD+ KRA++YC ACH   K    +K C C++   F+  +  +      + N N                              GK                  +I  + +++P +       +         +   +D      F +   + +DSTGMFHW   +  E  IL +++  + TV + H+VVC+FAD +SPLIGLR+ VMPLR+SN+HY+EL+ ++ VG  DY+RREWK L N PKI VLNGSPL+R+ LR +N+NLC+M  ILS    SN   D  LADKEAIL SLNIKAM F D           F NLS +A        + S+    +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMST YFN+NALTLIR+++TGGAT ELE +L+EG+G++G Y T E+++NRDRCRV  + L + P ++ FG    YG LF+   K YG+LC GLYR       D S S   +  R+V+TNP  +  L+  D VFV
Sbjct:   90 FMTEAKDWAGELISGQTTTGRILVVLVFILSIASLIIYFVDASSEEV---ERCQKWSNNITQQIDLAFNIFFMVYFFIRFIAASDKLWFMLEMYSFVDYFTIPPSFVSIYLDRTWIGLRFLRALRLMTVPDILQYLNVLKTSSSIRLAQLVSIFISVWLTAAGIIHLLENSGDPLDFNNAHRLSYWTCVYFLIVTMSTVGYGDVYCETVLGRTFLVFFLLVGLAMFASSIPEIIELVGSGNKYGGELKREHGKRHIVVCGHITYESVSHFLKDFLHEDREDVDVEVVFLHRKPPDLELEGLFKRHFTTVEFFQGTIMNPIDLQRVKVHEADACLVLANKYCQDPDAEDAANIMRVISIKNYSDDIRVIIQLMQYHNKAYLLNIPSWDWKQGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPDTQAWQNDYLQGTGCEMYTETLSPSFTGMTFPQASELCFSKLKLLLLAIEIK-GAEEGADSKISINPR-GAKIQANTQGFFIAQSADEVKRAWFYCKACHEDIKDETLIKKCKCKNLATFRKGVRAVQMVGRAILNRNVRRPNGTGNGTGGMHHMNNTAAAAAAAAAAGKQVNKVKPTVNVSRQVEGQVISPSQYNRPTSRSSGTGTQNQNGGVSLPAGIADDQSKDFDFEKTEMK-YDSTGMFHWSPAKSLEDCIL-DRNQAAMTVLNGHVVVCLFADPDSPLIGLRNLVMPLRASNFHYHELKHVVIVGSVDYIRREWKMLQNLPKISVLNGSPLSRADLRAVNVNLCDMCCILSAKVPSND--DPTLADKEAILASLNIKAMTFDDTIGVLSQRGPEFDNLSATAGSPIVLQRRGSVYGANVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSTTYFNQNALTLIRSLITGGATPELELILAEGAGLRGGYSTVESLSNRDRCRVGQISLYDGPLAQ-FGECGKYGDLFVAALKSYGMLCIGLYRF-----RDTSSSCDASSKRYVITNPPDDFSLLPTDQVFV 1110          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 962.6 bits (2487), Expect = 0.000e+0
Identity = 543/1109 (48.96%), Postives = 723/1109 (65.19%), Query Frame = 2
Query:  170 WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG--QSAKRRSQALNDTIHHIKFNEQSQ------RRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            W+ FL  S+ + FFG    LF   +  TLKY             LW       T+    + +N + QK+  P T +  G+    N              +  +  + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  +T  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELK GFIAQSCLA G ST+LANLF MRS+ K      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS  R    SSI INP   + ++ GT GFFIA  A + KRAF+YC ACH      K +K C C+                             R     P T+   +++R GG   S     + +      I  NEQ +      +R+DSTGMFHWC ++E E  ILT + + S TV S H+VVCIF D  S L+GLR+ VMPLR+SN+HY+EL+ I+FVG  DYLRREW++L NFPK+F+L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M+F D                 +  S D S +   +  ++    S IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL   ++     + S    R+V+TNP  E  ++  D +F
Sbjct:   40 WWAFLA-SSMVTFFG---GLFIILLWRTLKY-------------LW-------TVCCHCNIKNKEAQKVNNPITIQADGTTKTGNEKE-----------EAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRE---SSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCK-----------------------------RIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILT-RSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLG----APSQCTKRYVITNPPYEFEMVPTDLIF 1069          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 961.829 bits (2485), Expect = 0.000e+0
Identity = 542/1110 (48.83%), Postives = 723/1110 (65.14%), Query Frame = 2
Query:  170 WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHS-SSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG--QSAKRRSQALNDTIHHIKFNEQSQ------RRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            W+ FL  S+ + FFG    LF   +  TLKY             LW       T+    + +N + QK+  P T +  G+    N              +  +  + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  +T  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELK GFIAQSCLA G ST+LANLF MRS+ K      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS  R + S   I INP   + ++ GT GFFIA  A + KRAF+YC ACH      K +K C C+                             R     P T+   +++R GG   S     + +      I  NEQ +      +R+DSTGMFHWC ++E E  ILT + + S TV S H+VVCIF D  S L+GLR+ VMPLR+SN+HY+EL+ I+FVG  DYLRREW++L NFPK+F+L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M+F D                 +  S D S +   +  ++    S IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL   ++     + S    R+V+TNP  E  ++  D +F
Sbjct:   57 WWAFLA-SSMVTFFG---GLFIILLWRTLKY-------------LW-------TVCCHCNIKNKEAQKVNNPITIQADGTTKTGNEKE-----------EAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCK-----------------------------RIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILT-RSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLG----APSQCTKRYVITNPPYEFEMVPTDLIF 1090          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnma1a (potassium large conductance calcium-activated channel, subfamily M, alpha member 1a [Source:ZFIN;Acc:ZDB-GENE-070202-9])

HSP 1 Score: 951.044 bits (2457), Expect = 0.000e+0
Identity = 544/1137 (47.85%), Postives = 723/1137 (63.59%), Query Frame = 2
Query:  170 WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG--QSAKRRSQALNDTIHHIKFNEQSQ------RRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIP----------------------------MITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            W+ FL  S+ + FFG    LF   +  TLKY             LW       T+    + +N + QK+  P T +  G+    N              +  +  + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  +T  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELK GFIAQSCLA G ST+LANLF MRS+ K      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS  R    SSI INP   + ++ GT GFFIA  A + KRAF+YC ACH      K +K C C+                             R     P T+   +++R GG   S     + +      I  NEQ +      +R+DSTGMFHWC ++E E  ILT + + S TV S H+VVCIF D  S L+GLR+ VMPLR+SN+HY+EL+ I+FVG  DYLRREW++L NFPK+F+L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M+F D                 +  S D S +   +  ++    S IP                            MITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL   ++     + S    R+V+TNP  E  ++  D +F
Sbjct:   57 WWAFLA-SSMVTFFG---GLFIILLWRTLKY-------------LW-------TVCCHCNIKNKEAQKVNNPITIQADGTTKTGNEKE-----------EAPASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVYARTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPTVCELCYVKLKLLLIAIEYKSEQRE---SSILINPGNHVKMQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCK-----------------------------RIEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMRHDPLLIPGNEQIESMDANVKRYDSTGMFHWCPSKEIEKVILT-RSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVFILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLVRQASVTTGSNIPIITELAKPGKLLPLVSFSQEKNSGTNIQMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLG----APSQCTKRYVITNPPYEFEMVPTDLIF 1114          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: CABZ01092907.1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1b [Source:NCBI gene;Acc:798583])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 272/463 (58.75%), Postives = 359/463 (77.54%), Query Frame = 2
Query:  503 KDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVC 1888
            KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + +++T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRS+ K      W   Y+EG + EMYTEYLS +F GL+F   VC
Sbjct:    5 KDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD----PIESCEHFDKNFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSYIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSF-PTVC 461          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Match: kcnt2 (potassium channel, subfamily T, member 2 [Source:ZFIN;Acc:ZDB-GENE-130530-783])

HSP 1 Score: 169.474 bits (428), Expect = 3.473e-42
Identity = 188/831 (22.62%), Postives = 343/831 (41.28%), Query Frame = 2
Query: 1037 TYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGK--QHIILC-GHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNL--NQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPE-WVNQYVEGASLEMYTEYLSPS-----FHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSVKPCNCQSSQHFQ---DTLYNIVSCSWQMFNNNGKSLIERNS------FSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHW--------CSNRE-FESAILTNKDDLSSTVF---SNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLD----------------QDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETP 3385
            T FD  YF I T STVG+GD+V   W  KL+++F IL  L +      E+  +   R + GG + ++  +  +H++LC   I    + +FL +F    + + +  ++IL   + +  ++SVL+  +  ++V + QGS +   DL R +L+YA+AC IL  +   D +A D   I+R  ++K++ P   + VQ+++  NK ++        +  D +VC  E K   +A +C+ P  ST +  L       +  H PE W   Y + +  E+Y+  L+ S     + G  F  A    + K  + LI V  +       + SI +NP    T+      F+I+ + ++   ++     C  + K+  P     ++      D     +  S +   + G +  ER           P++      K   GQS    +   ++  + I +         ST + H         C + E F S    +KDD  + V+   S  ++V +    NS    L +F++PLR+S    NEL  I+ +          +++  FP I+ L GS  +   L    ++     V++    +    + Y+AD + I+             N+Q+  L  +F  L+           +ITEL+  ++++++                 ++ E   +       PFA GR F++S+LD+L+  ++  +  +T+ R ++    T             Q  +L   ++   D C                   +TYG L+ +     G +  G+YR     +E                  SPETP
Sbjct:  204 TVFDSFYFCIVTFSTVGFGDVVPDIWPSKLLVVFMILVTLMVLPIQFEELAYLWMERQKSGGYYSRQRAETEKHVVLCVSSIKIDLLMDFLNEFYAHPKLE-EHYVIILCPTELDAAVRSVLRIPMWSHRVIYLQGSALKDQDLVRAKLDYAEACFILTCRCVADRNAADYQTILRAWAVKDFAPGCTLFVQILKPENKFHV--------KFADHIVCEEEFKFAMLAMNCICPATSTFITLLVHTSQGLEGQHSPEDWHRIYGKCSGNEVYSIVLNKSIFFSEYEGNNFAYASFNAYNKYGICLIGVCPED------TKSILLNPGAQYTMNAMDTCFYISLTKEE--NSYVKQRECGNNSKTQPPMGSAITRPGTMAIDIQEISIPSSLEPSLSTGANTSERRQPIIIPVLELPDSPSFQASKLLSGQSKSHINGDESNDGYFIGYPPNLPYIGSSTILCHLRKKKMPTCCMHLEKFLSKTCNHKDDEDAKVYSLKSKLVIVSVETAGNS----LYNFILPLRASYRPQNELWPIVLLLEHVPDEEFLETISWFPMIYYLLGSIDSLDDLLRCGVSFAASMVVVDKESTMTAKEDYMADAKTIV-------------NVQT--LFRLFSGLN-----------IITELTHSANMRFMQFSTKDCHSLAFSKLAKKEREKGSNLSFIFHLPFAAGRVFSISMLDTLLYQSFVKDYMITITRLLLGLETTP------------QSGFLCAMSITEEDLCI------------------ETYGRLYQRLSSTVGDIPIGIYRTKSQTVE------------------SPETP 939          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 545/1109 (49.14%), Postives = 722/1109 (65.10%), Query Frame = 2
Query:  170 WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQT--NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKR--RSQAL----NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD------NLQ----------SKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            W+ FL  S+ + FFG    LF   +  T KY             LW       T+      +N D QK++   + +    D +   +   T              + W+   KDWAG +IS Q  TGRVL+  V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD P +   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS       S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+    F  +              NG    E+ S   P+   RN   R    S+    R   L    ND I ++  +  S +R+DSTGMFHWC  +E +  +LT + + + TV S H+VVCIF D  S LIG+R+ VMPLR+SN+HY+EL+ I+FVG  DYL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D       N Q          S D S +      ++    + IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG L+ K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   79 WWAFLA-SSMVTFFG---GLFIILVWRTFKY-------------LW-------TVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEET-------AAPGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN----PIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGD-PWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKS---EKGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRRSQFHKSPLQ------NKKKGNGPFEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNM--DSSSVKRYDSTGMFHWCPAKELDKVLLT-RSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLYCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1131          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 951.044 bits (2457), Expect = 0.000e+0
Identity = 541/1103 (49.05%), Postives = 723/1103 (65.55%), Query Frame = 2
Query:  170 WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQT--NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD------NLQ----------SKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            W+ FL  S+ + FFG    LF   +  T KY             LW       T+      +N D QK++   + +    D +   +   T +            + W+   KDWAG +IS Q  TGRVL+  V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD P +   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS       S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +  Q +     + S +    NG     R S +    ++R+      G          ND I ++  +  S +R+DSTGMFHWC  +E +  +LT + + + TV S H+VVCIF D  S LIG+R+ VMPLR+SN+HY+EL+ I+FVG  DYL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D       N Q          S D S +      ++    + IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG L+ K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   33 WWAFLA-SSMVTFFG---GLFIILVWRTFKY-------------LW-------TVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEETAA-------PGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN----PIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGD-PWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKS---EKGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPS-----ALSPKKKQRNGGM---RQSPNSSPNMMRHDPLLMTG----------NDQIDNM--DSSSVKRYDSTGMFHWCPAKELDKVLLT-RSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLYCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1067          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 547/1141 (47.94%), Postives = 730/1141 (63.98%), Query Frame = 2
Query:  170 WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQT--NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSC-----------SWQMFNNNGK-------SLIERNSFS---------KPETVIRNRRKRFGG--QSAKRRSQAL---------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD------NLQ----------SKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            W+ FL  S+ + FFG    LF   +  T KY             LW       T+      +N D QK++   + +    D +   +   T              + W+   KDWAG +IS Q  TGRVL+  V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD P +   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS       S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +           C           S  + +N G        S +  N FS         +P  +   +++R GG  QS       +         ND I ++  +  S +R+DSTGMFHWC  +E +  +LT + + + TV S H+VVCIF D  S LIG+R+ VMPLR+SN+HY+EL+ I+FVG  DYL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D       N Q          S D S +      ++    + IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG L+ K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   79 WWAFLA-SSMVTFFG---GLFIILVWRTFKY-------------LW-------TVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEET-------AAPGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN----PIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGD-PWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKS---EKGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRPKMSTRKRLIQACCMGCSEIDCSCMSGTLRSNMGTLEQAFPISPVSVNDFSTSLRGFEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNM--DSSSVKRYDSTGMFHWCPAKELDKVLLT-RSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLYCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1169          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 944.88 bits (2441), Expect = 0.000e+0
Identity = 541/1124 (48.13%), Postives = 724/1124 (64.41%), Query Frame = 2
Query:  170 WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQT--NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSS---------------------IAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD------NLQ----------SKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            W+ FL  S+ + FFG    LF   +  T KY             LW       T+      +N D QK++   + +    D +   +   T +            + W+   KDWAG +IS Q  TGRVL+  V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD P +   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS    +  S                      I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +  Q +     + S +    NG     R S +    ++R+      G          ND I ++  +  S +R+DSTGMFHWC  +E +  +LT + + + TV S H+VVCIF D  S LIG+R+ VMPLR+SN+HY+EL+ I+FVG  DYL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D       N Q          S D S +      ++    + IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG L+ K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   16 WWAFLA-SSMVTFFG---GLFIILVWRTFKY-------------LW-------TVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEETAA-------PGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN----PIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGD-PWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKSEKGESRGSKLEAVDILARFCVITFRVFFTRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCACKRLEDEQPS-----ALSPKKKQRNGGM---RQSPNSSPNMMRHDPLLMTG----------NDQIDNM--DSSSVKRYDSTGMFHWCPAKELDKVLLT-RSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLYCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1074          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Match: KCNMA1 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:100491898])

HSP 1 Score: 944.495 bits (2440), Expect = 0.000e+0
Identity = 547/1139 (48.02%), Postives = 730/1139 (64.09%), Query Frame = 2
Query:  170 WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQT--NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYC-------------------MACHMSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFS---------KPETVIRNRRKRFGG--QSAKRRSQAL---------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD------NLQ----------SKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            W+ FL  S+ + FFG    LF   +  T KY             LW       T+      +N D QK++   + +    D +   +   T +            + W+   KDWAG +IS Q  TGRVL+  V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD P +   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS       S I INP   + I+ GT GFFIA  A + KRAF+YC                    AC M C  +  C+C S      TL + +    Q F     S +  N FS         +P  +   +++R GG  QS       +         ND I ++  +  S +R+DSTGMFHWC  +E +  +LT + + + TV S H+VVCIF D  S LIG+R+ VMPLR+SN+HY+EL+ I+FVG  DYL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D       N Q          S D S +      ++    + IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG L+ K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   16 WWAFLA-SSMVTFFG---GLFIILVWRTFKY-------------LW-------TVCCHCGGKNKDAQKVVNAASSQVTDGDYKQTDDKEETAA-------PGVVEVGWMTSVKDWAGVMISAQTLTGRVLVVTVFALSIGALMIYFIDSSN----PIETCQNFYKDFTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGD-PWRNFENSQDLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPAVCELCFVKLKLLMIAIEFKS---EKGESRIIINPGNHVKIKEGTLGFFIASDAKEVKRAFFYCKQYFLLLYNKLSRIPVRLIQACCMGCSEID-CSCMSG-----TLRSNMGTLEQAF---PISPVSVNDFSTSLRGFEDEQPSALSPKKKQRNGGMRQSPNSSPNMMRHDPLLMTGNDQIDNM--DSSSVKRYDSTGMFHWCPAKELDKVLLT-RSEAAMTVLSGHVVVCIFGDMTSALIGVRNLVMPLRASNFHYHELKHIVFVGSLDYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGLLQANSQGFTPPGMERSSPDNSPVHGVARQASITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLYCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1095          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 524/1009 (51.93%), Postives = 698/1009 (69.18%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHS-SSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG-QSAKRRSQAL----------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR + S S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +      Y+      +    N   + +     +P T+   +++R GG +++   S  L          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   31 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRSRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLKVEARARYHKDPFMHKNATPNSPHVPKPVEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1023          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 523/1009 (51.83%), Postives = 697/1009 (69.08%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHS-SSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG-QSAKRRSQAL----------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR + S   I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +      Y+      +    N   + +     +P T+   +++R GG +++   S  L          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   91 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLKVEARARYHKDPFMHKNATPNSPHVPKPVEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1083          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 962.985 bits (2488), Expect = 0.000e+0
Identity = 522/997 (52.36%), Postives = 690/997 (69.21%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+   + +D     +S   +  N        RNS +    ++R+      G          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   31 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRPVYVEDEQPPTLSPKKKQRNGG-----MRNSPNTSPKLMRHDPLLIPG----------NDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 993          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 962.985 bits (2488), Expect = 0.000e+0
Identity = 523/997 (52.46%), Postives = 691/997 (69.31%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+   +F+D     +S   +  N        RNS +    ++R+      G          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  107 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLIYFEDEQPPTLSPKKKQRNGG-----MRNSPNTSPKLMRHDPLLIPG----------NDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1069          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Match: Kcnma1 (potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [Source:MGI Symbol;Acc:MGI:99923])

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 523/1008 (51.88%), Postives = 696/1008 (69.05%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG-QSAKRRSQAL----------NDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +      Y+      +    N   + +     +P T+   +++R GG +++   S  L          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   91 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRLKVEARARYHKDPFMHKNATPNSPHVPKPVEDEQPPTLSPKKKQRNGGMRNSPNTSPKLMRHDPLLIPGNDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1079          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q8AYS8|KCMA1_CHICK (Calcium-activated potassium channel subunit alpha-1 OS=Gallus gallus OX=9031 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 546/1113 (49.06%), Postives = 722/1113 (64.87%), Query Frame = 2
Query:  161 ENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCD-QKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGG--QSAKRRSQALNDTIHHIKFNEQ------SQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            +  W+ FL  S+ + FFG    LF   +  TLKY             LW       T+      +N + QKI         G D + +     TD       +  +  + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLAPG ST+LANLF MRSF K      W   Y+EG + EMYTEYLS +F GL+F     + F KL LL+IA+E KS  R    SSI INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +  Q                             P T+   +++R GG   S     + +      I  NEQ      + +++DSTGMFHWC  ++ E  ILT + + + TV S H+VVCIF D  S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YLRREW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M+F D                 +  S D S +   L   +    + IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:   42 QRMWWAFLA-SSMVTFFG---GLFIILLWRTLKY-------------LW-------TVCCHCGVKNKEAQKI-------NGGGDTQADGACKPTDE----KEENVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNNQQLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELVFAKLKLLMIAIEYKSEKRE---SSILINPGNHVKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQ-----------------------------PSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLLIPGNEQIDNMDANVKKYDSTGMFHWCPAKDIEKVILT-RSEAAMTVLSGHVVVCIFGDVKSALIGLRNLVMPLRASNFHYHELKHIVFVGSLEYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGLLRQPSITTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1074          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q28204|KCMA1_BOVIN (Calcium-activated potassium channel subunit alpha-1 OS=Bos taurus OX=9913 GN=KCNMA1 PE=1 SV=2)

HSP 1 Score: 962.6 bits (2487), Expect = 0.000e+0
Identity = 525/1003 (52.34%), Postives = 694/1003 (69.19%), Query Frame = 2
Query:  464 KTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            +T +  + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +  Q +     + S +    NG     RNS S    ++R+      G          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  138 ETVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPS-----TLSPKKKQRNGGM---RNSPSSSPKLMRHDPLLIPG----------NDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1103          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|O18866|KCMA1_PIG (Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Sus scrofa OX=9823 GN=KCNMA1 PE=2 SV=2)

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 524/997 (52.56%), Postives = 691/997 (69.31%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +  Q +     + S +    NG     RNS S    ++R+      G          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  130 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPS-----TLSPKKKQRNGGM---RNSPSSSPKLMRHDPLLIPG----------NDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1089          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|Q9BG98|KCMA1_RABIT (Calcium-activated potassium channel subunit alpha-1 OS=Oryctolagus cuniculus OX=9986 GN=KCNMA1 PE=2 SV=1)

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 523/997 (52.46%), Postives = 691/997 (69.31%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +  Q +     + S +    NG     RNS +    ++R+      G          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  157 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPS-----TLSPKKKQRNGGM---RNSPNSSPKLMRHDPLLIPG----------NDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1116          
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Match: sp|O18867|KCMA1_MACMU (Calcium-activated potassium channel subunit alpha-1 (Fragment) OS=Macaca mulatta OX=9544 GN=KCNMA1 PE=2 SV=1)

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 523/997 (52.46%), Postives = 691/997 (69.31%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L+++F S  LT+AGFIHL+E +GD  E   N Q  TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LL+IA+E KS NR    S I INP   + I+ GT GFFIA  A + KRAF+YC ACH      K +K C C+  +  Q +     + S +    NG     RNS +    ++R+      G          ND I ++  N    +++DSTGMFHWC+ +E E  ILT + + + TV S H+VVCIF D +S LIGLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + D  L DKE IL SLNIK+M+F D                 +  S D S +   L   +      IP+ITEL  D++VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE L++E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  129 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSN----PIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRE---SRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLEDEQPS-----TLSPKKKQRNGGM---RNSPNSSPKLMRHDPLLIPG----------NDQIDNMDSN---VKKYDSTGMFHWCAPKEIEKVILT-RSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLALLDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSTPSQCTKRYVITNPPYEFELVPTDLIF 1088          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A267GH63 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031175g2 PE=4 SV=1)

HSP 1 Score: 1047.73 bits (2708), Expect = 0.000e+0
Identity = 572/1107 (51.67%), Postives = 744/1107 (67.21%), Query Frame = 2
Query:  128 LKLMESNQLCKENR-WYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQ---NKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHM---SCKSVKPCNCQSSQH-------FQDTLYNI---VSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNME----DCSYSISTNKNRFVVTNPSPETP 3385
            L    +  LC  NR WY +L  S      G+  VL YR      +Y   + D ++ +R             V   TEN                    N+NA    +     ++     L W  EAKDWAGE+ISGQ  TGR+L+ +V  +S+ SL++Y  +  ++  V  E C+ W E+ + Q DLAFNIVFL++F +R+IAA DK WFW E+YSLVD+ T+PP+F+   +NR W+GLRFTRALR++S  DVL +LN+L++S+ IRL  L+T F SLVLT+AGFIHL E +GD P  TN+    +  YF   YF+I T++TVGYGD+ C T  G++     I+GGLA+FANSIPEI +I+ +RN+YGG F KE GKQHI+LCGHIT++SVSNFL DFLH+DREDVDVQIVILD   P+++LQ +LKR+  QV FFQGSVMN  DL RV L  ADACL+L ++Y  DPDAEDAANIMRVISIKN+C  IKVI+QLMQYHNK YL+NIPSWDW++GDD VCVAELKLGFIAQSCLA GFSTLLANLF MRS+++   +P W+N Y+EGA  EMYTE+LSP+F GLTF  A  +CF+KL LLLIAVE + N+  +  S IAINPK ++ ++ GTQGFF+A+SA++ K+A++YC  CH      K ++ C C+S          F++   N     +   Q    NG + +   +     T +R  R   GG     R Q++  +    K  +Q +R+FDSTGMFHWC +  FE A+L +++ +S TVFSNHIVVC+FADA+SPLIGLRSFVMPLR+SN+HY ELR +IFVG  DY+RREWK+LMNFPK+ V  GSPLNRS LR +NINL +M V+LS+  ++G  DA L DKEAILCSLNIKAM F D   +S+               + + + ++TEL+VD +VQ+LDQDD+D+PDT L++TQPFACG +FAVSVLDSLMSTAYFNENALTLIRT+VTGGAT ELE++L+EG+GI+G + +PET+ NRDR RV  + L +    EL     TY  LF+   + +GILC GLYR +    E    +   +      R+V+TNP    P
Sbjct:    4 LNATATTALCVANRRWYVYLSSSGIALASGVTLVLLYRLA----EYLFVRYDSYQRSR------------RVKSDTENSSNA----------------NANAPGEQT-----SEDEGPKLSWTTEAKDWAGELISGQTATGRILVVLVFLVSIASLVVYIADTVRM--VETEECVSWPENVSHQVDLAFNIVFLLYFFIRFIAAHDKLWFWFELYSLVDIFTIPPSFVAIYMNRTWIGLRFTRALRILSLPDVLQYLNVLRTSTSIRLFQLITFFASLVLTAAGFIHLAENSGDPPSFTNRNRNFDMNYFTCIYFVIVTIATVGYGDVFCTTTTGRIFSALVIMGGLAVFANSIPEIADILSSRNKYGGHFHKEAGKQHIVLCGHITYESVSNFLGDFLHEDREDVDVQIVILDKHVPDLELQGLLKRHFTQVDFFQGSVMNARDLGRVDLPTADACLVLANRYCPDPDAEDAANIMRVISIKNFCDHIKVIIQLMQYHNKTYLLNIPSWDWKQGDDAVCVAELKLGFIAQSCLAFGFSTLLANLFTMRSYREGKEMPVWLNNYLEGAGAEMYTEFLSPAFEGLTFPAAAELCFSKLRLLLIAVEAR-NDANSSESCIAINPKENVVVQKGTQGFFVAQSAEEVKKAYFYCKRCHGDVDDAKLIRKCRCRSVAEKPPSKMIFRNRHANAKFPKTVEQQNSARNGSAGVADGTPVGEATELRQLR---GG-----RKQSMIVSAQEAKLLDQVERKFDSTGMFHWCPDVSFEEALL-DREQMSLTVFSNHIVVCLFADASSPLIGLRSFVMPLRASNFHYGELRHVIFVGNTDYMRREWKTLMNFPKLSVFPGSPLNRSNLRAVNINLAQMCVVLSSKQNSGGDDATLVDKEAILCSLNIKAMTF-DTPPESR--------------RRANNVRVLTELAVDGNVQFLDQDDDDDPDTALYMTQPFACGTSFAVSVLDSLMSTAYFNENALTLIRTLVTGGATPELEQILAEGAGIRGGFSSPETLRNRDRTRVTQLPLADDRLRELSQPGSTYSDLFLGALRRHGILCIGLYRFLAAEHEATDSEQQATPPAPYKRYVITNPPATFP 1046          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A1I8JBG9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1015.37 bits (2624), Expect = 0.000e+0
Identity = 544/1001 (54.35%), Postives = 709/1001 (70.83%), Query Frame = 2
Query:  488 WIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQ---NKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKS---VKPCNCQSS-------------QHFQDTLYNIVSCS-------WQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLV-DAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            W+ EAKDWAGE+ISGQ  TGR+L+ +V  +S+ SL++Y I+  +++    E C+ WSES TQQ DLAFN++FL++F +R+IAA DK WFW E+YS+VD+LT+PP+F+   L++ W+GLR TRALR++S  DVL +LNIL++S+ IRL  L+T F SLVLT+AG IHL+E +GD P  TNK    +  YF   YF+I TMSTVGYGD+ C T  GK+     I+GGLA+FANSIPEI +I+ +RN+YGG F+KE GKQHI+LCGHITF+SV+NFL DFLH+DREDVDVQIV+LD   P++++Q +LKR+  QVQFFQGSVMNT DLARV LE ADACL+L +KY  DPDAEDAANIMRVISIKN+C  IKVI+QLMQYHNK YL+NIPSWDW++GDD VCVAELKLGF+AQSC+A GFSTLLANLF MRS++               A +EMYTE+LSP+F GL+F  A  VCF+KL+LLLIA+E ++         IAINPK  I +E GTQGFF+A+SA++ K+A++YC  CH        VK C C+ S             +H +D+  N+ +             N    S       S P +   N        +  RR   L+     I   +QS+RRFDSTGMFHWC    FE  +L+ ++ ++ TVFSNHIVVC+FAD++SPLIGLRSFVMPLR+SN+HY+ELR IIFVG  +YLRREWK+L+NFPK+    GSPLNRS LR +NINL +M V+LS+  ++G+  DA L DKEAILCSLNIKAM F    ++             S S++ + I ++TEL+VD++VQ+L+QDD+D+PDTEL++TQPFACG +FAVSVLDSLMSTAYFNENALTLIRT+VTGGAT ELE++L+EG+GI+G + +PET+  RDR RV  + + +    +   ++  +  LF+     +GILC GLYR I    E     I+    R+V+TNP+P+ P++  D VF
Sbjct:  101 WLTEAKDWAGELISGQTSTGRILVVLVFIVSMASLVVYQIDTVRMKNT--EECVAWSESVTQQVDLAFNVIFLVYFFVRFIAAQDKLWFWFEMYSIVDILTIPPSFVAVYLDQNWIGLRSTRALRILSLPDVLQYLNILRTSTGIRLLQLITFFASLVLTAAGLIHLVENSGDPPNFTNKNTLYDMNYFTCIYFVIVTMSTVGYGDVYCTTISGKIGSALVIMGGLAVFANSIPEIADILSSRNKYGGHFRKEAGKQHIVLCGHITFESVANFLGDFLHEDREDVDVQIVVLDKHVPDLEMQGLLKRHFTQVQFFQGSVMNTRDLARVGLESADACLVLANKYCPDPDAEDAANIMRVISIKNFCERIKVIIQLMQYHNKTYLLNIPSWDWKQGDDAVCVAELKLGFLAQSCMAFGFSTLLANLFTMRSYR---------------AGMEMYTEFLSPAFDGLSFPAAAEVCFSKLHLLLIAIEGETG--------IAINPKEGIKVEAGTQGFFVAQSAEEVKKAYFYCSRCHSDVADPELVKRCRCRQSNPKHSAGKTVIRNRHSKDSSANLTTTPAGNGGSGNPSGNGGSASSSGVGGTSAPASTELN--------AGSRRPSLLSPNEAKI-LGQQSERRFDSTGMFHWCQETSFEELVLS-REQVNLTVFSNHIVVCVFADSSSPLIGLRSFVMPLRASNFHYSELRHIIFVGNMEYLRREWKTLINFPKLSFFPGSPLNRSNLRAVNINLAQMCVVLSSKQNSGMGDDATLVDKEAILCSLNIKAMAFDTPPVEQG-----------SGSNRLNNICILTELAVDANVQFLEQDDDDDPDTELYMTQPFACGTSFAVSVLDSLMSTAYFNENALTLIRTLVTGGATPELEQILAEGAGIRGGFCSPETLRRRDRARVAQLPVSDERLRQY--SQGDFSKLFLGALHRHGILCIGLYRFITPPEEGEQALIA----RYVITNPAPDFPMLASDIVF 1049          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A2T7PWY1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_00521 PE=4 SV=1)

HSP 1 Score: 1011.13 bits (2613), Expect = 0.000e+0
Identity = 562/1123 (50.04%), Postives = 748/1123 (66.61%), Query Frame = 2
Query:  152 LCKENR-WYTFLVLSASIEFFGIG--SVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGD-IPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIER------------NSFSKPETVIRNRRKRFG-----GQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDN--LQSKDLSEIF-----------KNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            +C ++R W++FL  ++S+  FG+G  ++L YR +       R+K    K+ ++  K NP                         K+ S +  +          +   KT    + W+ EAKDWAGE+ISGQ  TGR+L+ +V  LS+ SLIIYF++ S  +GV  E C  WS S TQQ DLAFN+ F+I+F +R++AA DK WFW+E++S VD  T+PP+F+   L+R W+GLRF RALRL+S  D+L +LN+LK+S+ IRL  L+T F SL L +AGF+HLIE +GD   + +N  N TY++  YF++ TMSTVGYGDI  +T  G+L +I FIL  +A+F + IPEI EI+G R +YGG +KKE GK+H+++CGHIT+ SV NFL DFLHKDREDVDV+IV L    P+++L+ +LKR+  QV++FQGSVM+ NDL RV++  ADACL+L +KY  DPD EDAANIMRVISIKNY   IKVIVQL+QYHNKAYL+NIPSWDW+RGDD VCVAELKLGFIAQSCLAPGFSTL+ANLF MRS+K    +P+W   Y+ G ++EMYTEYLS +F+GLTF EA  +CFTKL LLL A+EV+  + R   S++AINP P + IE  TQGFFIAESA++ KRAFYYC  CH      +++K C C+    F+     ++  S+  F+    S++              + F   + + R  R   G      Q + R S +L+ T            +FDSTGMFHWC +R     ++ +++    T  SNH++VC+FADANSPLIGLR+ VMPLR+SN+HY+EL+  + VG  +YL+REWK+L NFP + +L GSPLNR+ LR +NINLC+M VI+S    N L D  L DKEAILCSLNIKAM F D    LQ+   +  F             +S   S   S IP+ITEL+ DS+VQ+LDQDD+D+PDTEL++TQPFACG AFAVSVLDSLMST+YFN+NALTLIRT++TGGAT ELE++L+EG+G++G Y TP  +ANRDRCRV  + L + P+S+ FG    YG LF+   + +GILC GLYR    N      + S +  R+V+TNP  +  L+  D  F
Sbjct:    9 VCTKDRLWHSFL--ASSLITFGVGLVAILAYRLVAWLC--CRKK----KSVQVFNKNNP-------------------------KQASGVAGDQAGGQRQGAGSFPNKTPDPEIGWMTEAKDWAGELISGQTTTGRILVGLVFLLSIASLIIYFVDASTNEGV--ETCQPWSSSTTQQVDLAFNVFFMIYFFIRFVAANDKLWFWLELFSFVDYFTIPPSFVAIYLDRNWLGLRFLRALRLMSIPDILTYLNVLKTSTLIRLVQLITYFVSLWLGAAGFLHLIENSGDPFHDFSNTHNLTYWECLYFLMVTMSTVGYGDIYAETVLGRLFIICFILISIALFTSCIPEIAEILGRRQKYGGSYKKERGKRHVVVCGHITYDSVLNFLKDFLHKDREDVDVEIVFLHKGLPDLELEGILKRHFTQVEYFQGSVMDANDLERVKIRQADACLVLANKYCHDPDQEDAANIMRVISIKNYHSEIKVIVQLLQYHNKAYLLNIPSWDWKRGDDAVCVAELKLGFIAQSCLAPGFSTLMANLFTMRSYKPTPDMPQWQTDYMRGTAMEMYTEYLSSAFNGLTFPEAAELCFTKLKLLLGAIEVRQEDTRE--STLAINPGPKVRIENATQGFFIAESAEEVKRAFYYCKNCHRDVTDVRAIKKCKCRPLAMFKKGAAAVLGISF-CFHCVSLSMVSSVAHWISDAFFPVSDFPLIQYLERVHRPASGRSATAPQDSVRDSMSLHSTSEAPMTPVDEPCKFDSTGMFHWCPDRPIHEVVM-DRNQAVLTGLSNHVIVCLFADANSPLIGLRNLVMPLRASNFHYHELKHTVIVGNLEYLQREWKTLQNFPNLSILPGSPLNRANLRAVNINLCDMCVIVSAKDKN-LDDPNLVDKEAILCSLNIKAMTFDDSIGLLQASAHTPAFMPPGFSPLGSLSTMSRRDSVSGSNIPLITELANDSNVQFLDQDDDDDPDTELYMTQPFACGTAFAVSVLDSLMSTSYFNDNALTLIRTLITGGATPELEQILAEGAGMRGGYCTPAVLANRDRCRVAQLTLFDGPFSQ-FGENGKYGDLFVYALRNFGILCIGLYRFRDTN----ESAKSPSSKRYVITNPPADFQLLPTDQAF 1086          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A0V1A3M2 (Calcium-activated potassium channel slo-1 OS=Trichinella patagoniensis OX=990121 GN=slo-1 PE=4 SV=1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 562/1126 (49.91%), Postives = 753/1126 (66.87%), Query Frame = 2
Query:  134 LMESNQLCKENRWYTFLVLSASIEF-FGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQT--NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSV---KPCNCQSSQHFQDTLYNI---------------------VSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSI------IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            + E  + C + R Y   +LS+ I F   +  V+ YR +        + RD +        ++P  +T +V       D K    +       D +   + V +       + TN  ++ W+ EAKDWAGE+ISGQ+ TGR+L+ +V  LS+ SLIIYF + S       E CI  S+S +QQ DLAFNI FLI+F +R+IAATDK WF +E+YS VD  T+PP+F+   L R W+GLRF RALRL++  D+L +LNI+K+S+ IRL  LV++F S+ LT+AGFIHL+E +GD P Q   N Q  TY++  YF++ TMSTVGYGDI CKT   +L M+FFILGGLA+FA+ +PEI ++IG R +YGG +K E GK+HI++CG ITF+SVS+FL DFLH+DREDVDV+++ L  + P+++L+ + KR+  +V+FFQG+VM++ DL RV+++ ADACL+L +KYS DPDAEDAANIMRVISIKNY   I+VIVQLMQYHNKAYL+NIPSWDWRRGDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK     PEW+  Y+ GAS+E+Y E LS SF G+++ EA  + +TKL LLL+A+E++   +R    +IAINP   + I+P TQGFFIA+SAD+ KRAF+YC  CH   + V   K C C++   F+  +  I                     +S +     ++ ++ I R ++         R+K FGG  A +    L      +K  EQ   ++DSTGMFHWC  R  E +IL  ++    TV   H+VVC+FAD +SPLIGLR+FVMPLR+SN+HY+EL+Q++ VG  +YLRREWK+L N PKI +LNGSPL+R+ LR +NIN+C+M VILS    N   D  LADKEAIL SLNIKAM+F D  L    L E    LST       +      +PMITEL  DS+VQ+LDQDDED+PDTEL+LTQPFACG AFA+SVLDSLMST YFN++ALTLIRT+VTGGAT ELE +L+EG+G++G   TPET+ NRDRCRV  + L +  +   +    TYG +  +  K+YG+LC GLYRL   + +D        + R+V+TNP P+  L++ D V+V
Sbjct:   29 MTEEERRCLDERKYWCFLLSSIITFCLSMLLVVTYRILSHLFCSRPKDRDRF--------DDP-NDTASVDDDKRTTDNKFFHDSCQSTANVDEKLTLSVVASSQ--QQQSTTNESHVGWMTEAKDWAGELISGQSTTGRILVVLVFVLSIASLIIYFYDASNPH-FQVETCIPLSQSPSQQIDLAFNIFFLIYFFIRFIAATDKVWFLLEVYSFVDYFTIPPSFVAIYLERNWLGLRFLRALRLMTLPDILQYLNIMKTSNAIRLAQLVSIFVSVSLTAAGFIHLLENSGD-PFQNFENPQRITYWECVYFLLVTMSTVGYGDIYCKTTLARLFMVFFILGGLAMFASYVPEIADLIGARQKYGGQYKGEHGKKHIVVCGFITFESVSHFLQDFLHEDREDVDVEVIFLHRVPPDLELEGLFKRHFTKVEFFQGTVMDSVDLTRVKIDEADACLVLANKYSPDPDAEDAANIMRVISIKNYSADIRVIVQLMQYHNKAYLLNIPSWDWRRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSSRSPEWLRYYLCGASMEVYPEILSHSFVGMSYAEAA-ILYTKLGLLLLAIEMRDEEKRE--CNIAINPGSSVRIDPHTQGFFIAQSADEVKRAFFYCNLCHADIQDVTLIKKCKCKNLALFRKEIKQIAMMSTSSRKVSTAVVRDTDRRMSDTRSRHISDARAAINRKAYKLELGPKITRKKSFGGSIAPKIDPEL------LKDFEQQAIKYDSTGMFHWCPGRPIEESIL-ERNQAKMTVLHGHVVVCLFADKDSPLIGLRNFVMPLRASNFHYHELKQVVIVGDVEYLRREWKTLYNLPKISILNGSPLSRADLRAVNINMCDMCVILSARIPNPTEDPTLADKEAILASLNIKAMQFEDSPLLYP-LPEGISPLSTPVKMSKILVKFGTQVPMITELVNDSNVQFLDQDDEDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPELELILAEGAGLRGGMSTPETLRNRDRCRVAQLSLADGCFQS-YHIGATYGQVLSQALKDYGMLCIGLYRLHDTSTDDL-------EKRYVITNPPPDLKLISTDKVYV 1122          
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Match: A0A4E9ETR5 (Calcium-activated potassium channel slo-1, putative OS=Brugia malayi OX=6279 GN=Bma-slo-1 PE=4 SV=1)

HSP 1 Score: 1002.28 bits (2590), Expect = 0.000e+0
Identity = 539/999 (53.95%), Postives = 717/999 (71.77%), Query Frame = 2
Query:  464 KTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGD-IPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRR---KRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQN---------SIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV 3412
            K     + W+ EAKDWAGE+ISGQ+ TGR+L+ +V  LS+GSLIIYF + S       E C+ WS+S +QQ DL FNI FLI+F +R+IAA+DK WF +E+YS +D  T+PP+F+   L R W+GLRF RALRL++  D+L +LN+LK+SS IRL  L+++F S+ LT AGF+H++E +GD      N    TY+D  YF++ TMSTVGYGDI C T+ G+L M+FFILGGLA+FA+ IPEI ++IG+R +YGG +K E GK+HI++CG+IT++SVS+FL DFLH+DREDVDV++V L  + P+++L+ + KR+  +V+FF G+VM++ DL+RV+++ ADACL+L +KYS DPDAEDAANIMRVISIKNY   I+VIVQLMQYHNKAYL+NIPSWDWRRGDDV+C+AELKLGFIAQSCLAPGFST++ANLF MRSFK   H P W+N Y+ GA +EMYTE LS S  GLTFTEA  + FT+L LLL+A+E+K + ++    +IAINP P  TI+P TQGFFIA+SAD+ KRAFY+C  CH   M    +K C C++   F+     +     Q+     ++    N+ +  +T ++ RR   +R  GQ         N TI   K  EQ   ++DSTGMFHWC  R  E  +L ++   + TV + H+VVC+FAD NSPLIGLR+FVMPLR+SN+HY+EL+ ++ VG  +YL+REWK+L N PKI +LNGSPL+R+ LR +NINLC+M VI+S    N   D  LADKEAIL SLNIKAM+F DD L    L +    +S   S  +         + +PMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFA+SVLDSLMST YFN++ALTLIRT+VTGGAT E+E +L+EG+G++G Y TPET+ NRDRCR+  + L++ P+ E      +YG +F    K++G LC GLYRL          ++ +NK R+V+TNP  E  L+  D+V+V
Sbjct:   47 KQEEVQIGWMTEAKDWAGELISGQSMTGRILVVLVFVLSIGSLIIYFYDASH-PNFQVETCVSWSDSPSQQIDLGFNIFFLIYFFIRFIAASDKVWFLLEVYSFIDYFTIPPSFVAIYLERNWLGLRFLRALRLMTVPDILQYLNVLKTSSSIRLTQLLSIFISVCLTGAGFVHVLENSGDPFKNFANTHRITYWDCVYFLLVTMSTVGYGDIYCTTFLGRLFMVFFILGGLAMFASYIPEIADLIGSRQKYGGEYKGEHGKKHIVVCGYITYESVSHFLQDFLHEDREDVDVEVVFLHRVPPDLELEGLFKRHFTKVEFFSGTVMDSIDLSRVKVDEADACLVLANKYSSDPDAEDAANIMRVISIKNYSSDIRVIVQLMQYHNKAYLLNIPSWDWRRGDDVICLAELKLGFIAQSCLAPGFSTMMANLFAMRSFKTSPHTPPWLNDYLRGAGMEMYTESLSHSCVGLTFTEAADLLFTRLGLLLLAIELKDDEKKE--CNIAINPAPTTTIQPQTQGFFIAQSADEVKRAFYWCKQCHEDIMDISLIKKCKCRNLALFRKGAKQV-----QLSKRIARATPVSNASN--DTAVQLRRLDERRSFGQKNSLSLPPENRTIDFSKEFEQQDMKYDSTGMFHWCPARTLEECVL-DRHQAAMTVLNGHVVVCLFADRNSPLIGLRNFVMPLRASNFHYHELKHVVIVGDVEYLKREWKTLYNLPKISILNGSPLSRADLRAVNINLCDMCVIVSARIPNPNEDPTLADKEAILASLNIKAMQF-DDTLGFYPLRQTGGTVSPLGSPLSLQKKGARFGTNVPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAISVLDSLMSTTYFNDSALTLIRTLVTGGATPEMELILAEGAGLRGGYSTPETLNNRDRCRISQLALQDRPF-EGITTGSSYGQMFSTALKKHGQLCIGLYRL------HDQAAVDSNK-RYVITNPPAELRLLLSDYVYV 1025          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000044980.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000044980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 942.569 bits (2435), Expect = 0.000e+0
Identity = 523/1033 (50.63%), Postives = 691/1033 (66.89%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAK--------RRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDN--LQSKDLS-------------------------------EIFKNLSTSASHQNSI-----------IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + E  T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS+ R    SS  INP   + ++ GT GFFIA  A + KRA YYC ACH      K +K C C+ S+                +N   KS+ E +      T+   +++R GG            R    L  +   ++  + + +++DSTGMFHWC +++ E  ILT + + + TV S H+VVCIF D  S ++GLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L GSPL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M F D    LQ+                                    I   L+ S    N++           IPMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  106 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD----PIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRE---SSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSK--------------SNYNGYIKSIEEVHQ----STLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILT-RSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIF 1104          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000051878.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000051878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 942.184 bits (2434), Expect = 0.000e+0
Identity = 521/1042 (50.00%), Postives = 689/1042 (66.12%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALN--------DTIHHIKFNEQSQRR-------------------------------------FDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + E  T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS+ R    SS  INP   + ++ GT GFFIA  A + KRA YYC ACH      K +K C C+ S+        +  C      + G   + R+  S  ET            SA  RS   N        + +H    + + ++R                                     +DSTGMFHWC +++ E  ILT + + + TV S H+VVCIF D  S ++GLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L GSPL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M F D                 +  S + S +   +  ++    + IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  106 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD----PIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRE---SSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKKACRRGTRLACCLDCGEADYGCLCMSRSVRSNAETAFPLSPTCLSDNSATLRSSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILT-RSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIF 1131          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000050702.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050702.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 519/1025 (50.63%), Postives = 687/1025 (67.02%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDN--LQSKDLS-------------------------------EIFKNLSTSASHQNSI-----------IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + E  T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS+ R    SS  INP   + ++ GT GFFIA  A + KRA YYC ACH      K +K C C+    F++   + +S   +  N   ++         P    +N R              L  +   ++  + + +++DSTGMFHWC +++ E  ILT + + + TV S H+VVCIF D  S ++GLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L GSPL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M F D    LQ+                                    I   L+ S    N++           IPMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  106 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD----PIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRE---SSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCK---RFEEVHQSTLSPKKKQRNGGMRT--------SPNCSPKNLR----------HDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILT-RSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIF 1093          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000050440.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:48528:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000050440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 935.636 bits (2417), Expect = 0.000e+0
Identity = 520/1033 (50.34%), Postives = 687/1033 (66.51%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAK--------RRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDN--LQSKDLS-------------------------------EIFKNLSTSASHQNSI-----------IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + E  T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA  +PEI  +I NR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS+ R    SS  INP   + ++ GT GFFIA  A + KRA YYC ACH      K +K C C+ S+                +N   KS+ E +      T+   +++R GG            R    L  +   ++  + + +++DSTGMFHWC +++ E  ILT + + + TV S H+VVCIF D  S ++GLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L GSPL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M F D    LQ+                                    I   L+ S    N++           IPMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  106 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD----PIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGTYNSTRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRE---SSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSK--------------SNYNGYIKSIEEVHQ----STLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILT-RSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIF 1104          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Match: ENSAMXT00000004500.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000822.1:37062:202682:-1 gene:ENSAMXG00000004398.2 transcript:ENSAMXT00000004500.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 526/1070 (49.16%), Postives = 690/1070 (64.49%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALN--------DTIHHIKFNEQSQRR-------------------------------------FDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDN--LQSKDLS-------------------------------EIFKNLSTSASHQNSI-----------IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  + E  T Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS+ R    SS  INP   + ++ GT GFFIA  A + KRA YYC ACH      K +K C C+ S+        +  C      + G   + R+  S  ET            SA  RS   N        + +H    + + ++R                                     +DSTGMFHWC +++ E  ILT + + + TV S H+VVCIF D  S ++GLR+ VMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L GSPL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M F D    LQ+                                    I   L+ S    N++           IPMITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL      D   S  +    R+V+TNP  E  L+  D +F
Sbjct:  106 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD----PIESCQIFDEDITLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQPLSYWECVYLLMVTMSTVGYGDVCAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPAVCELCYVKLKLLLIAIEYKSDQRE---SSTLINPGNHVKMQEGTLGFFIASDAKEVKRALYYCKACHDDITDPKRIKKCGCKRSKKACRRGTRLACCLDCGEADYGCLCMSRSVRSNAETAFPLSPTCLSDNSATLRSSKSNYNGYIKSIEEVHQSTLSPKKKQRNGGMRTSPNCSPKNLRHDPLLIPSHDQMETMDVNVKKYDSTGMFHWCPSKDIEKVILT-RSEAAMTVLSGHVVVCIFGDVKSAVVGLRNLVMPLRASNFHYHELKPIVFVGSLEYLKREWETLHNFPKVSILPGSPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIGLLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELAKSDRLLNAVCVRQDKSIGTNIPMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRL-----RDAHLSAPSQCTKRYVITNPPYEFELVPTDLIF 1159          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006399.1 (pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 441.81 bits (1135), Expect = 2.238e-145
Identity = 208/368 (56.52%), Postives = 275/368 (74.73%), Query Frame = 2
Query: 1022 NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSC---KSVKPCNCQ 2116
            N+QN TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA  +PEI  +I NR +YGG +    G++H+++CGHIT +SVSNFL DFLHKDR+DV+V+I+ L  + PN++L+++ +R+  QV+F+QGSV+N  DLARV++E ADAC+I+ +KY  DPDAEDA+NIMRVISIKNY P I+VI Q++QYHNKA+L+NIPSW WR GD  +C++ELKLGFIAQSCLA G ST+LANLF MRS+ K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LLLIA+E +S +  ++ SSI +NP   + I+ GT  FFIA  + + KRAFYYC ACH      K +K C+C+
Sbjct:   12 NQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKDRDDVNVEILFLHSISPNLELEALFRRHFTQVEFYQGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEE-DTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEH--SYGSSILLNPGSHVRIQDGTLAFFIANDSKEVKRAFYYCKACHEDVTDPKKIKKCSCR 376          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006404.1 (pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1 gene:ENSPMAG00000005728.1 transcript:ENSPMAT00000006404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 441.81 bits (1135), Expect = 3.629e-145
Identity = 208/371 (56.06%), Postives = 276/371 (74.39%), Query Frame = 2
Query: 1022 NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSC---KSVKPCNCQSSQ 2125
            N+QN TY++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA  +PEI  +I NR +YGG +    G++H+++CGHIT +SVSNFL DFLHKDR+DV+V+I+ L  + PN++L+++ +R+  QV+F+QGSV+N  DLARV++E ADAC+I+ +KY  DPDAEDA+NIMRVISIKNY P I+VI Q++QYHNKA+L+NIPSW WR GD  +C++ELKLGFIAQSCLA G ST+LANLF MRS+ K      W   Y+EG S EMYTEYLS +F GL+F     +CF KL LLLIA+E +S +  ++ SSI +NP   + I+ GT  FFIA  + + KRAFYYC ACH      K +K C+C+  +
Sbjct:   34 NQQNLTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRRKYGGEYLPTRGRKHVVVCGHITLESVSNFLKDFLHKDRDDVNVEILFLHSISPNLELEALFRRHFTQVEFYQGSVLNPLDLARVKIEAADACMIIANKYCPDPDAEDASNIMRVISIKNYHPRIRVITQMLQYHNKAHLLNIPSWSWREGDAAICLSELKLGFIAQSCLAQGISTMLANLFSMRSYIKIEE-DTWQKFYLEGVSNEMYTEYLSSAFVGLSFPAVSELCFVKLRLLLIAIEYRSEH--SYGSSILLNPGSHVRIQDGTLAFFIANDSKEVKRAFYYCKACHEDVTDPKKIKKCSCRQCE 401          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007042.1 (pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 gene:ENSPMAG00000006371.1 transcript:ENSPMAT00000007042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 300.442 bits (768), Expect = 8.384e-95
Identity = 140/215 (65.12%), Postives = 175/215 (81.40%), Query Frame = 2
Query: 1247 QHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPE------WVNQYVEGASLEMYTEYLSPSFHGLTF 1873
            +HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I+VI Q+ QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLAPG ST+LANLF MRS+ K   LP       W   Y+EG S EMYTEYLS +F GL+F
Sbjct:    1 RHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIEAADACLILANKYCGDPDAEDASNIMRVISIKNYHPRIRVITQMQQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAPGLSTMLANLFSMRSYIKRVPLPHQIEEDTWQKYYLEGVSNEMYTEYLSNAFTGLSF 215          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: KCNT1 (potassium sodium-activated channel subfamily T member 1 [Source:HGNC Symbol;Acc:HGNC:18865])

HSP 1 Score: 100.523 bits (249), Expect = 1.836e-22
Identity = 63/220 (28.64%), Postives = 111/220 (50.45%), Query Frame = 2
Query:  974 GFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGK--QHIILC-GHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNL--NQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNK 1618
            GF HL         +   +N + F   YF I T STVG+GD++ K W  +L+++  I   L +      E++ +   R + GG + +   +  +H++LC   +    + +FL +F    R   D   VIL     + Q++ +L   L   +V + QGS +   DL RV+++ A+AC IL  +  +D  A D   I+R  ++K++ P+  + VQ+++  NK
Sbjct:  211 GFQHL---------ERAAENISLFRSLYFCIVTFSTVGFGDVLPKIWPSQLLVVIMICVALMVLPVQFEELVYLYMERQKSGGNYSRYRAQTEKHVVLCVSSLKLDLLMDFLNEFYAHPRLQ-DFYTVILCPTDMDSQVRRMLHVPLWAQRVIYLQGSALKDQDLVRVKIDDAEACFILTSRNEVDRTAADHQTILRAWAVKDFAPSCPLYVQILKPENK 420          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008182.1 (pep scaffold:Pmarinus_7.0:GL477494:64178:71076:1 gene:ENSPMAG00000007403.1 transcript:ENSPMAT00000008182.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 5.187e-19
Identity = 42/90 (46.67%), Postives = 60/90 (66.67%), Query Frame = 2
Query:  557 ISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNR 826
            + +V  LS+G+L+IYFI+ S       E C  + +  T QFD+  NI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LN+
Sbjct:    5 VVLVFLLSIGALVIYFIDSSD----PIEDCHYFQKDTTLQFDMGLNIFFLLYFGLRFIAANDKLWFWLEVNSIVDFFTVPPVFVSVYLNQ 90          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO28098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F3])

HSP 1 Score: 127.102 bits (318), Expect = 1.935e-33
Identity = 55/119 (46.22%), Postives = 85/119 (71.43%), Query Frame = 2
Query: 2420 SSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIK 2776
            S+ +F++HI+VC+F     PL+GLR  VMPLR+SN H ++L++I+F+G +DY++ EW+ + NF ++++L GSP  R+ LR +N NL +M V LS    +   D  LADK++IL SLN+K
Sbjct:   65 SNVIFTHHILVCVFNKKEDPLVGLRKMVMPLRASNLHRSDLKKIVFLGDKDYMKLEWEEICNFHEVYILPGSPFCRADLRAVNANLADMVVFLSGTAVDQAGDPRLADKQSILASLNLK 183          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Match: EDO32743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU69])

HSP 1 Score: 107.842 bits (268), Expect = 1.057e-23
Identity = 88/340 (25.88%), Postives = 159/340 (46.76%), Query Frame = 2
Query: 1055 YFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIG--KQHIILCGH-ITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNL--NQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPS-----FHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADD 2044
            +F+I T STVGYGD V   W  +  ++  I   L +    +  +  ++ +R + GG +   +    +H++LC   +   ++ +FL +F + D    DV +V+L     +  L+ +L+  +   +V + +GS +   DL R +   A  C IL D+Y+ D +A D   I+R  +I+++ P   + VQ+++  NK ++           + VVC  E+K   +A +C+ PG STL+  L      +      +W   Y + A  E+Y   L  S     +   +FT A      K  + LI V+     R      + +NP P   +    + F+IA S+++
Sbjct:  257 WFVIVTFSTVGYGDTVPTHWTTQTFVMIMIGIALVLLPIELERLAFLLFSRQKEGGAYNHLLAGTDRHVVLCATTLRTGTLIDFLNEF-YADSRLHDVHVVLLCPSDLDSTLRILLQVPVWAQRVTYLKGSALIDEDLVRAR-RNAAGCFILADRYAADREAADQHTILRTWAIQDFAPATPLFVQILKPENKFHV--------SFAEHVVCEDEIKHALLAVNCVCPGISTLVTLLLHTLHEQYVRGSEKWHEIYGKCAGNEIYDIRLGDSMIFRPYAYKSFTHAAFHAHKKYGVTLIGVK-----RHGKGGRLMLNPGPSHNMAYDDRCFYIAISSEE 581          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 523/1006 (51.99%), Postives = 690/1006 (68.59%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHS-SSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHH---IKFNEQSQ------RRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELK GFIAQSCLA G ST+LANLF MRSF +      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS  R + S   I INP   + ++ GT GFFIA  A + KRAFYYC ACH      K +K C C+       T  N  S             I  +    P T+   +++R GG            + H    I  NEQ +      +R+DSTGMFHWC +++ E  ILT + + S TV S H+VVCIF D  S L+GLR+ VMPLR+SN+HY+EL+ I+FVG  DYLRREW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M+F D                 +  S D S +   +  ++    S IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL   ++     + S    R+V+TNP  E  L+  D +F
Sbjct:  132 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD----PIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCKRPAEGATTPGNTGSQKEAGVRFKADCNIVED--EHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILT-RSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLG----APSQCTKRYVITNPPYEFELVPSDLIF 1123          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: ENSORLT00000011055.2 (potassium calcium-activated channel subfamily M alpha 1 [Source:NCBI gene;Acc:101155390])

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 544/1126 (48.31%), Postives = 732/1126 (65.01%), Query Frame = 2
Query:  101 IHNCFLRIHLKLMESNQLCKEN---RWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            +H   + + +     N LC  N    W+ FL  S+ + FFG    LF   +  TLKY             LW         TV    +   +++   TT E      + +S A                 + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L+IYFI+ S       E C  +  +YT Q D+AFNI FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q  +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELKLGFIAQSCLA G ST+LANLF MRSF K      W   Y+EG S EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS+ R    SS  INP   + ++ GT GFFIA  A + KRA +YC ACH      K +K C C+    F++  ++ +S   +  N        RNS +    ++R+      G                I+  +++ +++DSTGMFHWC +R+ E  ILT + + + TV S H+VVCIF D  S LIGLR+FVMPLR+SN+HY+EL+ I+FVG  +YL+REW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M F D                 +  S + S +   +  ++    + IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL   ++     + S    R+V+TNP     L+  D +F
Sbjct:   13 VHMSKIDVVIPYSADNMLCDNNGQRMWWAFLA-SSMVTFFG---GLFIILLWRTLKY-------------LW---------TVCCHCKAKKKEVHRITTGEHIKRVDKGDSAA---------------SEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSD----PIEFCKHFYSNYTLQIDMAFNIFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQALSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEE-DTWQKYYLEGVSNEMYTEYLSSAFVGLSFPVICELCYVKLKLLLIAIEYKSDQRE---SSTLINPGNHVKMQEGTLGFFIASDAKEVKRALFYCKACHDDISDPKRIKKCGCKK---FEEDRHSALSPKKKQRNGG-----MRNSPNSSPKIMRHDPLFIPGS-------------EQIESMDENVKKYDSTGMFHWCPSRDIEKVILT-RSEAAMTVLSGHVVVCIFGDVKSALIGLRNFVMPLRASNFHYHELKHIVFVGSLEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IDDASLQDKECILASLNIKSMLFDDSIRVLQANSQGFTPPGMDRSSPENSPVHGLVRQTSVTTGANIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALKGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLN----AQSQCTKRYVITNPPYAFELVPSDLIF 1061          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 521/1005 (51.84%), Postives = 686/1005 (68.26%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHH---IKFNEQSQ------RRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELK GFIAQSCLA G ST+LANLF MRSF +      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS  R    SSI INP   + ++ GT GFFIA  A + KRAFYYC ACH      K +K C C+                             R     P T+   +++R GG            + H    I  NEQ +      +R+DSTGMFHWC +++ E  ILT + + S TV S H+VVCIF D  S L+GLR+ VMPLR+SN+HY+EL+ I+FVG  DYLRREW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M+F D                 +  S D S +   +  ++    S IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL   ++     + S    R+V+TNP  E  L+  D +F
Sbjct:  132 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD----PIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRE---SSILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCK-----------------------------RLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILT-RSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLG----APSQCTKRYVITNPPYEFELVPSDLIF 1092          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 521/1034 (50.39%), Postives = 686/1034 (66.34%), Query Frame = 2
Query:  482 LDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHS-SSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHH---IKFNEQSQ------RRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIP----------------------------MITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA+ +PEIIE+IGNR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMRVISIKNY P I++I Q++QYHNKA+L+NIPSW+W+ GDD +C+AELK GFIAQSCLA G ST+LANLF MRSF +      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS  R + S   I INP   + ++ GT GFFIA  A + KRAFYYC ACH      K +K C C+                             R     P T+   +++R GG            + H    I  NEQ +      +R+DSTGMFHWC +++ E  ILT + + S TV S H+VVCIF D  S L+GLR+ VMPLR+SN+HY+EL+ I+FVG  DYLRREW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M+F D                 +  S D S +   +  ++    S IP                            MITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL   ++     + S    R+V+TNP  E  L+  D +F
Sbjct:  132 VGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD----PIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVNGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRESRSRKRILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCK-----------------------------RLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILT-RSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELAKPGKLMPLVSHSQEKKSGTSIQMITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLG----APSQCTKRYVITNPPYEFELVPSDLIF 1124          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Match: kcnma1a (calcium-activated potassium channel subunit alpha-1 [Source:NCBI gene;Acc:101174692])

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 498/1008 (49.40%), Postives = 657/1008 (65.18%), Query Frame = 2
Query:  473 SHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQ-TNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACH---MSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHH---IKFNEQSQ------RRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDD----------------NLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            +  + W+   KDWAG +IS Q  TGRVL+ +V ALS+G+L IYFI+ S       E C  + + +T Q D+AFN+ FL++F LR+IAA DK WFW+E+ S+VD  TVPP F++  LNR W+GLRF RALRLI F+++L FLNILK+S+ I+L +L ++F S  LT+AGFIHL+E +GD  E   N Q+ +Y++  Y ++ TMSTVGYGD+  KT  G+L M+FFILGGLA+FA  +PEI  +I NR +YGG +    G++HI++CGHIT +SVSNFL DFLHKDR+DV+V+IV L  + PN++L+++ KR+  QV+F+QGSV+N +DLARV++E ADACLIL +KY  DPDAEDA+NIMR                   YH          W+W+ GDD +C+AELK GFIAQSCLA G ST+LANLF MRSF +      W   Y+EG + EMYTEYLS +F GL+F     +C+ KL LLLIA+E KS  R    SSI INP   + ++ GT GFFIA  A + KRAFYYC ACH      K +K C C+                             R     P T+   +++R GG            + H    I  NEQ +      +R+DSTGMFHWC +++ E  ILT + + S TV S H+VVCIF D  S L+GLR+ VMPLR+SN+HY+EL+ I+FVG  DYLRREW++L NFPK+ +L G+PL+R+ LR +NINLC+M VILS N +N + DA L DKE IL SLNIK+M+F D                 +  S D S +   +  ++    S IP+ITEL  DS+VQ+LDQDD+D+PDTEL+LTQPFACG AFAVSVLDSLMS  YFN+N LTLIRT+VTGGAT ELE LL+E + ++G Y TP+T+ANRDRCRV  + L + P+++L G+   YG LF K  K Y +LCFG+YRL   ++     + S    R+V+TNP  E  L+  D +F
Sbjct:  129 ASEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALGIYFIDSSD----PIESCQSFYDDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLCSIFISTWLTAAGFIHLVENSGDPWENFQNSQSLSYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFARYVPEIAALILNRKKYGGSYNSTRGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCGDPDAEDASNIMRYT----------------LYH---------IWNWKEGDDAICLAELKAGFIAQSCLAQGLSTMLANLFSMRSFIEIEE-DTWQKYYLEGVANEMYTEYLSSAFVGLSFPHICELCYVKLKLLLIAIEYKSEQRE---SSILINPGNHVKMQEGTLGFFIASDAKEVKRAFYYCKACHDDITDPKRIKKCGCK-----------------------------RLEDEHPSTLSPKKKQRNGGMRNSPNCSPKMMSRHDPLLIPGNEQIENMDMNIKRYDSTGMFHWCPSKDIEKVILT-RSEASMTVLSGHVVVCIFGDVTSALVGLRNLVMPLRASNFHYHELKPIVFVGSLDYLRREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNN-IEDASLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDSSPVHGFVRQASVTTGSNIPIITELVNDSNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEGLLAEENALRGGYSTPQTLANRDRCRVAQLALYDGPFADL-GDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLG----APSQCTKRYVITNPPYEFELVPSDLIF 1067          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000076792.1 (SMESG000076792.1)

HSP 1 Score: 2070.43 bits (5363), Expect = 0.000e+0
Identity = 1038/1091 (95.14%), Postives = 1042/1091 (95.51%), Query Frame = 2
Query:  137 MESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            MESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHLVTLFTSLVLTSAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQ  +    D  H   E   +   +    +P                            ARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVTGGATLELEELLSEGSGIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF
Sbjct:    1 MESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHLVTLFTSLVLTSAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQRTN---CDSGHPSTE-YSIAKCVEKKFKP----------------------------ARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVTGGATLELEELLSEGSGIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 1059          

HSP 2 Score: 66.2402 bits (160), Expect = 1.493e-10
Identity = 32/44 (72.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query: 3367 PISRNPINESRLGVCLRPFNIDLYKSFNTKKLDLTSTKGKMTAV 3498
            P    P+       CLRPFNIDLYKSFNTKKLDLTSTKGKMTAV
Sbjct: 1046 PSPETPLMNQDWVFCLRPFNIDLYKSFNTKKLDLTSTKGKMTAV 1089          

HSP 3 Score: 59.3066 bits (142), Expect = 1.955e-8
Identity = 25/29 (86.21%), Postives = 27/29 (93.10%), Query Frame = 1
Query: 1333 RRTNCDSGHPSTEYSIAKCVEKKFKPGTI 1419
            +RTNCDSGHPSTEYSIAKCVEKKFKP  +
Sbjct:  382 QRTNCDSGHPSTEYSIAKCVEKKFKPARV 410          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000050831.1 (SMESG000050831.1)

HSP 1 Score: 1145.95 bits (2963), Expect = 0.000e+0
Identity = 604/1113 (54.27%), Postives = 796/1113 (71.52%), Query Frame = 2
Query:  155 CKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEWKANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVMTDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMS--CKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETV-IRNRRKRFGGQSAKRRSQALND--TIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQN----------------SIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEK---TYGSLFMKCFKEYGILCFGLYRLI-IDNM--EDCSYSISTN-KNRFVVTNPSPETPLMNQDWVF 3409
            C++ +WY FL  S + +  GI  + FYR I    +++R      K N        LT            D+ +  P   + +  D          D V    +   S       + KDW+GEIISGQN TG+ L+S+V  LS+GS+ IY  E+S   G+T E+C+KW+ S TQQ DLAFNI+FL++F LR++A+ DK  FW+E+YS VD+ T+PP+F+   L RYW+GLRF RA+RL++ +DVL FLN++KSSS IRLCHL T F SLV+T++GFIHL+E +G      N QN+ + D+TYF+I T+STVGYGDIVC+T  GKLMM+FFILGGLA+FANSIPE+IEIIG+RNRY   F+K+  KQHIILCGHIT+ SVSNFLADFLHKDREDVDV+IVIL+   P ++L++VLKR    V+F+QGS MN+NDL+R+QL+ ADACL+L +KYS DPDAEDAANIMRVISIKN+CP IKVIVQLMQYHNKAYL+NIPSWDW+RGDD VC+AELKLGFIAQSCLAPGFSTLLANLF MRSFK   +LP W+N Y+EGA +EMY+EY SP+FHG TF EAV + F  L LLLIA+E KS    N  +SIAINPK DI IEPG QGFFIA+SAD++KRAF++C  CH++   K +K C+C + + FQ+TL+ +     + F        +  S    E+  ++ RR R    + ++R   + +  +   ++FNEQ  RRFD+TGMFHWC  R  E  +L + D L   VFSNHIVVC+FA++NS LIGL +FVMPLR+SN+HY+EL  I+F+G  +YL+REWKSL NFP + +L+GS L+R+ LR +N+N+ +M VILS+  +N + DA+L DKEAILCSLN++AM F  D+ + ++  E+   +S S S+ +                + I MITEL++DS+VQ+LDQDDED+P+TELF+TQPFACGRAFAVSVLDSLMSTAYFNENALTLIRT++TGGAT +LE++L+EG GIQGAYLTP+T+ NRDRCRV  +++  +P +E+F ++     YG LF++  + +GILC GLYRLI +DN+  ++    ++TN K R+V+TNP     +   D V+
Sbjct:   15 CQDEKWYIFLATSVACQLCGILIIGFYRVIQNLSRWFRNPNVNSKLN--------LT------------DEGLSRPDFIDTKFDD----------DQVHVEISNCFS-------DLKDWSGEIISGQNLTGKTLVSLVCILSIGSIAIYLYELSVYDGLT-EVCVKWNRSLTQQLDLAFNIIFLVYFFLRFLASNDKLCFWLELYSFVDLYTIPPSFVILYLGRYWIGLRFVRAMRLMTLSDVLGFLNVIKSSSSIRLCHLFTTFVSLVITASGFIHLVESSGGPVIADNGQNRNFLDFTYFIIVTISTVGYGDIVCRTPTGKLMMMFFILGGLALFANSIPEMIEIIGSRNRYRNPFRKQKDKQHIILCGHITYDSVSNFLADFLHKDREDVDVKIVILNNFPPELELKNVLKRYFIHVEFYQGSGMNSNDLSRIQLQNADACLVLANKYSPDPDAEDAANIMRVISIKNFCPRIKVIVQLMQYHNKAYLLNIPSWDWKRGDDAVCLAELKLGFIAQSCLAPGFSTLLANLFTMRSFKNDANLPNWLNTYLEGAGMEMYSEYFSPAFHGCTFAEAVAMSFKYLKLLLIAIETKST--VNEENSIAINPKNDIKIEPGMQGFFIAQSADESKRAFFFCRKCHLNRHYKYIKQCSCAAHKQFQNTLHKL-----RKFETTKSRHSKLESKKGDESSKVKLRRNRNIRPNERKRPHNIRNQKSFRGLRFNEQISRRFDTTGMFHWCPERPIEDVLLNDSDQLKMCVFSNHIVVCVFAESNSALIGLCNFVMPLRASNFHYSELSYIVFIGNLEYLKREWKSLANFPCLSILSGSSLSRTNLRAVNVNMSKMCVILSSKSNNSMDDAFLVDKEAILCSLNVQAMSFDIDSFKMENFPELLPQISKSVSYSSFGMEKDMTDDKISKSGADIKMITELAIDSNVQFLDQDDEDSPETELFMTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTLITGGATPDLEQVLAEGCGIQGAYLTPDTLGNRDRCRVTIIQVTQNPLAEIFISKNGGCNYGHLFLEALERFGILCIGLYRLINLDNLVNDNAGMMLNTNSKKRYVITNPPDFLQIHYSDMVY 1082          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000044594.1 (SMESG000044594.1)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 361/1023 (35.29%), Postives = 566/1023 (55.33%), Query Frame = 2
Query:  479 NLDWIIEA-------KDWAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDIPEQT---NKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHLP---EWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCK---SVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILS--TNHSNGLVDAYLADKEAILCSLNIKA------MKFTDDNLQSKDLS-------EIFKNLSTSASHQNSI----------IPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSEL-----FGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVF 3409
            NL+ +IE        + +  ++IS Q   GR++ SI +  +L S ++Y  EI  L  +  E C   +       DLA N VFLI+F LR+  +T+K  FW+  ++++D  T+P      VL++ W+GLRF R L LI   +V+   N++KS + IR+  L+T F S+++  AGF HL+E +G+I   +   N Q   Y D  YF+I TMSTVGYGDI  KT  GK+ ++ FIL  LA FA+ IPE+ E +   ++Y G + K  G++HII+CGHI + SVS FL DFLH+DR   DV ++ ++  +P+I+++S+LK    QV++FQG+VM+  DL RVQ+  ADACLIL D+   DP+ EDA NIMR IS KNYC    VI+QL+Q+ NK YL NIP+W+ R GD ++C +E++LG +AQSCL PGFSTLL N+F +RS K+    P    W+N Y+ G ++E+Y+  LS SF+  ++ E V  CF  LNLLLIA+EVK +  +     + +NP     I PG+ GFFI +S  DA  A  YC  CH + +   ++K C C+ S    D    ++S                             R +   + +  +    ND    ++F ++    +   G F+ CS ++    +++++  + +     HI++CIF+D  +  IG+R+F+MPLRS     NEL++++ +  +D++ +EW  +  FPKI V+      R    +I+I+ C   VIL+  TN ++   DAY+ DKE I+ +L  +A      MK       +K +S          +  + S S  N            +P+I++L+++S+VQYLD  +++  +   +L +PFA G AF  S+LDSLMSTAY+N+NA+ ++  ++ GG+                     +T  N ++ R    R+  +P S++     + N   Y  +F++   ++  +  GLYR    N+      + T  +R+V+TNP P  P+   D V+
Sbjct:   61 NLESLIEDPSFSVAFRPYVNQLISTQFLIGRIVASIATVAALLSTVLYLYEIICLP-LKLEKCYPLTNPIFCS-DLACNFVFLIYFLLRFFTSTEKLAFWLGFHTVIDCFTIPQILTALVLDQEWIGLRFIRVLSLIRVFEVIQCFNVVKSGTSIRVIQLITYFASILIVGAGFFHLLENSGEITSGSFYNNSQPIGYGDSLYFIIVTMSTVGYGDIFAKTMCGKIFVVLFILLALATFASFIPELAEFLFAGSQYLGFYIKIAGRRHIIVCGHINYASVSTFLTDFLHEDRSSSDVDVIFINKKEPDIEMKSLLKIYFTQVKYFQGTVMDQVDLHRVQMSNADACLILADQNCSDPNDEDAGNIMRAISFKNYCYRCPVIIQLLQFENKTYLQNIPTWNKRNGDQIICYSEIELGILAQSCLVPGFSTLLTNIFSVRSEKECKQNPSNESWLNDYMRGVTMEIYSAKLSRSFNEFSYKELVEFCFKNLNLLLIAIEVKDSVSKKK--MLLMNPLNCKRIIPGSVGFFICDSYRDALNANIYCSRCHATLRDLTNLKVCGCKGSPG--DYELTVIS-----------------------------RLKSEEEVSLTKCDVEND-FKEMEFIDEKCCSYKKNGNFYTCSPQKLMKNVISSEHQIEN--LRGHIILCIFSDNRTSSIGIRNFLMPLRSVTISENELKELVIIADKDFIEKEWSEICGFPKIKVVFHQISIRRIAHLISIDTCSRCVILNNKTNIADLQNDAYMVDKEIIIANLFFQAESKRRIMKNNSKIEMAKSISIKAAGGETQIERTNQSKSEGNETFQVSKGSETQVPIISKLAIESNVQYLDVREDNVLNIPNYLRKPFAFGCAFTTSMLDSLMSTAYYNQNAIYIMEMLINGGSVD------------DLDQDDSDTEINLEQ-RNNQFRINLTPVSQINKTVNWSNTVFYRDIFIELMSKHESVSLGLYRK--RNLLRKETRVET-IDRYVITNPPPNFPIEPTDMVY 1029          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000014623.1 (SMESG000014623.1)

HSP 1 Score: 538.88 bits (1387), Expect = 1.374e-173
Identity = 333/971 (34.29%), Postives = 533/971 (54.89%), Query Frame = 2
Query:  509 WAGEIISGQNGTGRVLISIVSALSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDI---PEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRS------FKKYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILSTNHSN---GLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTPETVANRDRCRVETMRLENSPYSELFGNEK--TYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPE 3379
            W  + ISGQN TG++++ I    +  ++  Y  E +      +   I +  ++    DL     F  ++ +R++AA +K  FW  +YSLVD+LT+P  F+   L+  W+GLRF RA+ L+   D+L +L +LKS++K RL  L T+F  + +  +G  H++E TGD     E  +K   T+ D  YF I TMSTVGYGDI   ++ GK+ +  FIL   AIFA+ IPEI EI+ + ++Y G +  +   +HI++CG+  F S+ +F+ADF ++DR    + +V ++  +P+ +L+++LK N  + +F +G+VM+  DL R  ++ ADAC IL +    +P  EDAANIMRVIS+KN+  +++V++QL+QY NK+YL NIP+W+  +GD VVC +E++L  +A+SCL PG+ST ++NLF +RS      F+K  +   W+N Y+ G  LE+YT  LS S  G+TF + V   +  LNLLLIAVEVK  N +    ++ INP         T G+FI  S  +++R   YC  CH +                               N G  L       K + V  N+      +  ++ S  L+         +++++  D    F  C  ++F+ +++  K+ L    FSNHI++CIFAD +SP IGL++F++PLRS      +LR II    +++L REW+SL  FP +  ++ + +N+  L ++ +  C + VI+S   S      +D +L DKE IL +LN+K+       +  K L + F  +  S    N    +IT+L V+++VQ+LDQ+DED P+  +FL++ FACG AF   +LD L+S AYFN +   +I  ++ G           E + +           N  +C++    L +  +   F N     Y +LF   FK Y +L  GLY+++    E     +S++K + ++TNP  E
Sbjct:   81 WTSKFISGQNTTGKIIVFIACVCTFITVGDYIYEATYFPMQIERCGIYYEGAFLLAIDLFCYSFFTCYYIIRFLAAENKIEFWFGVYSLVDLLTIPSFFVEIYLDHLWMGLRFLRAIWLMQVPDLLQYLGVLKSATKFRLGQLSTMFICMWIVGSGMTHMLENTGDTWLSAEVNDKNFLTFGDSMYFTIVTMSTVGYGDISPHSFLGKIWVAIFILVSFAIFASFIPEIAEILFSGSKYTGSYVPKEEYKHIVVCGNFEFSSIQSFMADFFNEDRPISKINVVFINQEEPDFELRNLLKMNFMRSKFIKGTVMDQVDLKRASIDEADACFILANHNCKNPKDEDAANIMRVISLKNFSSSVRVLIQLLQYENKSYLTNIPTWNKDKGDTVVCYSEMELRILAKSCLIPGYSTFISNLFSIRSEAQCKEFRKSGN--SWINDYINGMGLELYTSNLSLSLIGMTFYDLVLFSYEYLNLLLIAVEVKMRNGK----TVFINPASQSYTTKETVGYFICNSFKESQRVALYCNVCHGA-------------------------------NEGTPL----RVDKFKCVCINKVASL-NEKIRQTSFRLSRQQFQYAILDKAEKEID----FLKCDYKDFKESLI--KNPLEPIKFSNHIILCIFADNDSPSIGLKNFIIPLRSKKLDTADLRPIIIASNEEFLHREWRSLACFPNLHPISFNNINKKSLSVLQVENCHVCVIMSARVSKRNAANLDFHLVDKEIILGTLNVKS-------IFKKKLQKKF--IGKSGEIPNRF--LITKLLVENNVQFLDQEDEDEPNCPVFLSEIFACGSAFTTKMLDCLLSIAYFNPDVNKVITHLIAGEIHCFENINDEESTNMAN---------NNVKCQIRIFNLFDDKFQSCFANTNRCLYKNLFTYAFKHYHLLLLGLYKVV----ETTQNILSSSKKKVILTNPDGE 979          
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Match: SMESG000078105.1 (SMESG000078105.1)

HSP 1 Score: 407.142 bits (1045), Expect = 2.455e-124
Identity = 301/972 (30.97%), Postives = 494/972 (50.82%), Query Frame = 2
Query:  530 GQNGTGRVLISIVSA-LSLGSLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAATDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVLVFLNILKSSSKIRLCHXXXXXXXXXXXXAGFIHLIELTGDI-PEQTNKQNKTYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEIIEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVDVQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADACLILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNIPSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFK---KYHHLPEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVKSNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMSCKS---VKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVIRNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREFESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYNELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEMTVILST----NHSNGLVDAYLADKEAILCSLN-IKAMKFTDDNLQSKDLSEIFKNLSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRAFAVSVLDSLMSTAYFNENALTLIRTMVXXXXXXXXXXXXXXXXXIQGAYLTP-ETVANRD-RCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFGLYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQD 3400
            GQ GT    I++++  L+L S  IY    ++   +  E C  W+E+  +   L  +I FLI F + +    D   FW ++Y+++++ TVP  F+   L R +VG  F R + +    DV+  L++L+  S IRL HL ++F  + +  AG  +L E TGDI     N Q  +Y    YF++ TMSTVGYGDI  KT  G++ +  F+L  LAIFA+ IPE+ +I+ +R+ Y   F+    K+H I+CG +  Q + +FL+ F H++R   +++I+ + + +P + L+ ++KR   QV++ +G+ M + DL R+++E AD CL++  +   + DAED ANIMRVISIK  CP  +VI+QL Q+ NK +L+NIP+W    GD+V+C  E+KLG +A+SCL  GFST + + F + S K   K  + P W+ QY  G S  +Y E  S  F+G TF E V +C+ +  +++I +EV  +      S+I + P P   I      + I+E+         YC  CH    S   +K C C+                          +I  NS    +  ++        +  K  ++ L++     KF   S+R F             + S +  +K     T+F +HIV+ +F+  NS   GL +FV PLR     Y +++ II VG   YL +EWK++  FP+I+V+ GS  +   L +  +N     V+++     NH   + D YL DKE IL +LN +  +K+   +L   D S    N             +IT++S+D+++ +L  +  D+     + T+ FA G A+  S+L+SL+S+ Y++ N + L+R                    I+G+Y    E V  +    +++ +   +  +  L  N KT+  +F     +  IL  G+YRL   N+++ +   +    R V+  P P+  L   D
Sbjct:   80 GQ-GTFYGTITLLNVVLNLFSFFIYVFNTNEYYIL--ENCCPWNENLLEIIQLVLSIFFLISFLIDFSMQKDHLEFWKDLYAIINIFTVPNTFIGIYLQRNYVGTFFLRFIWVYKIPDVIQQLDLLEVKSVIRLWHLGSIFMCIWVCGAGLFYLFENTGDIWHNYKNSQKISYGACFYFILVTMSTVGYGDIYPKTDSGRIFLCLFLLIALAIFASYIPEMWDILKSRSIYDKTFRPVYNKKHNIVCGSLEDQEIESFLSTFYHENRNSKNIRIIFISLNRPKLYLKGLMKR-YPQVEYVEGTEMKSEDLKRIRVEIADCCLVITKRNCENEDAEDKANIMRVISIKECCPNQRVIIQLHQFQNKIHLLNIPNWCPLIGDEVICFNEIKLGILARSCLCAGFSTAICHAFTILSPKHIIKNENNP-WIEQYKRGFSASIYRERFSQFFYGRTFLETVHICYDRFKIIVIGLEVIDSYGE---STIKLYPNPKHVITKQCWAYCISENQILPYNMSIYCKRCHSDKNSNLYLKKCYCE--------------------------IITINSNMSVKIPLKQSLLAHNKEMEKILNKNLDN-----KFEITSRRSF-------------YHSFVKYDK-----TLF-DHIVLLVFSHENSKSAGLINFVKPLRIKKDDYVKIKPIILVGNGVYLEKEWKTISIFPEIYVVVGSCFDLEVLDLAQVNRARTCVLINAPKPFNHK--VEDPYLVDKEVILGTLNLLNYLKYNKVSLSESDFSSSSVNTK-----------IITDVSIDTNMHFLYPNSLDSSQNGAYFTKVFASGHAYCNSILNSLLSSTYYDWNTINLLRLF------------------IEGSYDDSFEKVPGKYWHTQLKLISFSSERFLNL-RNCKTFDEVFQTALNQNNILIIGIYRLF--NLKNITEFKNDIVKRIVLMIPHPDLELHFSD 959          
The following BLAST results are available for this feature:
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA10.000e+051.93potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+051.98potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+051.98potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+051.98potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+051.93potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo-10.000e+049.33Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+049.12Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+048.78Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+049.12Calcium-activated potassium channel slo-1 [Source... [more]
slo-10.000e+048.65Calcium-activated potassium channel slo-1 [Source... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slo0.000e+051.42gene:FBgn0003429 transcript:FBtr0334294[more]
slo0.000e+051.02gene:FBgn0003429 transcript:FBtr0100632[more]
slo0.000e+051.21gene:FBgn0003429 transcript:FBtr0100636[more]
slo0.000e+051.12gene:FBgn0003429 transcript:FBtr0100637[more]
slo0.000e+050.58gene:FBgn0003429 transcript:FBtr0334296[more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a0.000e+048.96potassium large conductance calcium-activated chan... [more]
kcnma1a0.000e+048.83potassium large conductance calcium-activated chan... [more]
kcnma1a0.000e+047.85potassium large conductance calcium-activated chan... [more]
CABZ01092907.10.000e+058.75potassium large conductance calcium-activated chan... [more]
kcnt23.473e-4222.62potassium channel, subfamily T, member 2 [Source:Z... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNMA10.000e+049.14potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+049.05potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+047.94potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+048.13potassium calcium-activated channel subfamily M al... [more]
KCNMA10.000e+048.02potassium calcium-activated channel subfamily M al... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnma10.000e+051.93potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+051.83potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+052.36potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+052.46potassium large conductance calcium-activated chan... [more]
Kcnma10.000e+051.88potassium large conductance calcium-activated chan... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AYS8|KCMA1_CHICK0.000e+049.06Calcium-activated potassium channel subunit alpha-... [more]
sp|Q28204|KCMA1_BOVIN0.000e+052.34Calcium-activated potassium channel subunit alpha-... [more]
sp|O18866|KCMA1_PIG0.000e+052.56Calcium-activated potassium channel subunit alpha-... [more]
sp|Q9BG98|KCMA1_RABIT0.000e+052.46Calcium-activated potassium channel subunit alpha-... [more]
sp|O18867|KCMA1_MACMU0.000e+052.46Calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GH630.000e+051.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JBG90.000e+054.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7PWY10.000e+050.04Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0V1A3M20.000e+049.91Calcium-activated potassium channel slo-1 OS=Trich... [more]
A0A4E9ETR50.000e+053.95Calcium-activated potassium channel slo-1, putativ... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044980.10.000e+050.63pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051878.10.000e+050.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050702.10.000e+050.63pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050440.10.000e+050.34pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000004500.20.000e+049.16pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006399.12.238e-14556.52pep scaffold:Pmarinus_7.0:GL477091:41003:110164:-1... [more]
ENSPMAT00000006404.13.629e-14556.06pep scaffold:Pmarinus_7.0:GL477091:42221:110230:-1... [more]
ENSPMAT00000007042.18.384e-9565.12pep scaffold:Pmarinus_7.0:GL486096:7796:16492:-1 g... [more]
KCNT11.836e-2228.64potassium sodium-activated channel subfamily T mem... [more]
ENSPMAT00000008182.15.187e-1946.67pep scaffold:Pmarinus_7.0:GL477494:64178:71076:1 g... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO280981.935e-3346.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327431.057e-2325.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnma1a0.000e+051.99calcium-activated potassium channel subunit alpha-... [more]
ENSORLT00000011055.20.000e+048.31potassium calcium-activated channel subfamily M al... [more]
kcnma1a0.000e+051.84calcium-activated potassium channel subunit alpha-... [more]
kcnma1a0.000e+050.39calcium-activated potassium channel subunit alpha-... [more]
kcnma1a0.000e+049.40calcium-activated potassium channel subunit alpha-... [more]
back to top
BLAST of Calcium-activated potassium channel slo-1, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076792.11.493e-1095.14SMESG000076792.1[more]
SMESG000050831.10.000e+054.27SMESG000050831.1[more]
SMESG000044594.10.000e+035.29SMESG000044594.1[more]
SMESG000014623.11.374e-17334.29SMESG000014623.1[more]
SMESG000078105.12.455e-12430.97SMESG000078105.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017593 ID=SMED30017593|Name=Calcium-activated potassium channel slo-1, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=3520bp
GTAAGTTTCGTTTCATTCGATTGGATAAATGGAATTGACGAATCAGAATT
CGATGCTACTTTTGTTAGTTATCGAAGAACAATAAAGGAAATGTAATTTT
ATTCACAATTGTTTTCTACGAATCCATCTCAAATTAATGGAATCCAATCA
ATTGTGCAAAGAAAATCGATGGTATACGTTTCTTGTGTTGAGTGCATCAA
TTGAATTTTTTGGAATCGGATCAGTTCTGTTTTATCGATTCATTGTAGAA
ACTTTAAAATATTATCGCAGAAAACGAGATGAATGGAAAGCAAATCGGCT
GTTATGGAAAGAAAACCCATTGACCGAAACAATAACGGTGACGGTATCGA
CAGAGAATTGCGATCAGAAAATTCTTGAACCAACAACCTTTGAAAAACGA
GGTTCCGATTTACGATTTAATAGCAATGCTGTCATGACAGATTCGGTTTT
TACATCATATACAAAAACTAATTCCCACAATCTCGATTGGATAATCGAAG
CAAAAGATTGGGCTGGAGAAATAATTTCTGGTCAAAATGGAACGGGTAGA
GTTTTGATTTCAATAGTTAGCGCTTTAAGCTTAGGATCATTGATAATCTA
TTTCATTGAGATTAGTCAACTTCAAGGAGTAACAGATGAATTGTGTATTA
AATGGTCAGAAAGCTACACTCAACAATTTGATTTGGCGTTTAATATAGTG
TTTCTGATATTCTTCTGCCTGCGATGGATCGCCGCTACCGATAAATTTTG
GTTCTGGATTGAAATTTATTCACTTGTCGATGTGTTAACAGTTCCACCCG
CCTTCATGACTTTTGTGTTGAATCGGTATTGGGTCGGTTTGAGGTTCACT
AGAGCTTTACGGTTGATCAGTTTTACCGATGTACTAGTTTTCTTGAATAT
TTTAAAGTCTTCTAGTAAAATTAGACTTTGTCATTTGGTAACTTTGTTTA
CAAGTTTAGTGTTGACATCGGCTGGTTTCATACATTTAATTGAATTGACT
GGAGATATTCCGGAACAAACTAATAAACAAAACAAAACATATTTTGATTA
TACATATTTCATGATTGCGACCATGTCAACGGTCGGCTACGGGGATATTG
TTTGCAAAACCTGGCAAGGAAAATTGATGATGATCTTTTTCATTCTTGGA
GGTCTAGCAATATTTGCTAATTCCATACCAGAAATCATAGAAATTATCGG
CAATCGAAATAGATACGGTGGAATATTCAAAAAAGAAATCGGCAAACAAC
ACATTATTCTATGCGGCCACATAACTTTTCAGTCAGTTTCAAATTTTTTG
GCTGATTTTCTTCATAAAGACCGTGAAGATGTAGACGTACAAATTGTGAT
TCTGGACATCCTTCAACCGAATATTCAATTGCAAAGTGTGTTGAAAAGAA
ATTTAAACCAGGTACAATTTTTTCAAGGAAGTGTAATGAATACAAATGAT
TTAGCTCGAGTTCAGCTGGAATATGCCGACGCGTGTCTAATATTGTGTGA
TAAATATTCAATGGATCCTGATGCTGAAGATGCTGCAAATATTATGAGAG
TGATATCCATTAAAAACTATTGTCCGACAATAAAAGTGATAGTTCAGTTA
ATGCAATATCACAATAAAGCTTATTTAATGAATATTCCAAGTTGGGATTG
GAGACGAGGTGACGATGTCGTTTGCGTAGCAGAATTGAAACTTGGATTCA
TAGCCCAATCGTGCTTGGCACCTGGATTTTCAACTTTATTGGCTAATTTA
TTCGTCATGAGATCGTTTAAAAAGTATCATCATTTACCAGAATGGGTTAA
CCAATATGTTGAAGGTGCTAGTTTAGAAATGTACACAGAATATCTTTCTC
CTTCCTTTCATGGTTTGACTTTTACCGAAGCAGTTTGTGTGTGTTTTACT
AAGCTTAATCTATTGCTAATCGCCGTTGAAGTTAAATCAAATAACCGACG
GAATCACAGCAGCAGTATTGCGATTAATCCTAAGCCCGATATTACAATTG
AACCAGGAACTCAAGGATTCTTTATAGCTGAATCGGCTGATGATGCAAAA
CGGGCGTTCTATTATTGTATGGCATGCCATATGTCTTGCAAATCAGTTAA
ACCTTGCAACTGCCAAAGCAGTCAACATTTTCAGGACACTCTCTATAATA
TTGTCTCATGTTCTTGGCAAATGTTTAATAATAATGGTAAATCTCTTATT
GAAAGGAATTCTTTTTCTAAACCAGAAACTGTAATTCGAAATCGTAGAAA
AAGATTTGGAGGGCAATCTGCCAAACGACGTTCCCAAGCCTTAAATGATA
CAATTCATCACATAAAATTCAATGAACAGAGCCAACGAAGATTTGATTCA
ACTGGAATGTTTCATTGGTGCTCCAATAGAGAATTTGAAAGTGCGATTCT
CACTAATAAAGATGATCTCTCATCGACAGTGTTTTCAAATCATATAGTAG
TTTGTATTTTTGCCGATGCTAATAGTCCTCTTATTGGTCTTAGAAGTTTC
GTTATGCCACTTAGATCAAGCAATTATCACTATAATGAGTTACGACAAAT
CATTTTCGTTGGACCTCAAGATTATCTCCGTAGAGAATGGAAATCGTTGA
TGAATTTTCCAAAGATATTTGTTCTCAATGGATCGCCGTTGAATAGATCC
AAACTGAGAATGATCAATATAAATCTTTGTGAAATGACGGTTATCTTATC
CACGAATCATTCGAATGGCTTGGTTGATGCTTATCTAGCCGATAAAGAAG
CAATCTTATGCTCTTTAAACATCAAAGCTATGAAATTCACAGATGACAAT
CTTCAATCAAAAGATTTATCAGAAATATTTAAAAACCTCTCGACCAGTGC
TTCACATCAAAATAGTATTATACCGATGATAACGGAATTAAGTGTTGATT
CAAGTGTGCAATATTTGGATCAAGATGATGAAGATAATCCGGATACTGAG
TTATTTTTAACTCAACCATTTGCTTGTGGTCGAGCGTTTGCTGTCAGTGT
TTTAGACTCATTGATGAGTACAGCGTATTTTAATGAAAATGCTTTGACAT
TAATTAGAACAATGGTCACAGGCGGTGCTACTTTGGAATTAGAAGAATTA
CTGTCTGAGGGATCTGGAATCCAAGGAGCATACTTAACTCCGGAAACTGT
TGCTAATAGAGATAGATGTCGAGTAGAAACGATGCGCTTAGAAAATTCTC
CTTACAGCGAATTGTTTGGAAACGAAAAGACCTATGGTTCATTATTCATG
AAATGCTTTAAAGAATATGGAATTCTTTGTTTTGGACTCTATCGCTTGAT
AATTGATAACATGGAAGACTGTTCTTACAGCATTTCCACCAACAAAAATA
GATTTGTTGTCACAAACCCATCTCCAGAAACCCCATTAATGAATCAAGAT
TGGGTGTTTGTTTAAGGCCTTTTAATATTGATTTATATAAAAGTTTTAAT
ACTAAAAAGTTAGATTTGACATCGACAAAAGGTAAAATGACTGCTGTGTA
ATATTTTTAATAAAACTTTA
back to top

protein sequence of SMED30017593-orf-1

>SMED30017593-orf-1 ID=SMED30017593-orf-1|Name=SMED30017593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1093bp
MESNQLCKENRWYTFLVLSASIEFFGIGSVLFYRFIVETLKYYRRKRDEW
KANRLLWKENPLTETITVTVSTENCDQKILEPTTFEKRGSDLRFNSNAVM
TDSVFTSYTKTNSHNLDWIIEAKDWAGEIISGQNGTGRVLISIVSALSLG
SLIIYFIEISQLQGVTDELCIKWSESYTQQFDLAFNIVFLIFFCLRWIAA
TDKFWFWIEIYSLVDVLTVPPAFMTFVLNRYWVGLRFTRALRLISFTDVL
VFLNILKSSSKIRLCHLVTLFTSLVLTSAGFIHLIELTGDIPEQTNKQNK
TYFDYTYFMIATMSTVGYGDIVCKTWQGKLMMIFFILGGLAIFANSIPEI
IEIIGNRNRYGGIFKKEIGKQHIILCGHITFQSVSNFLADFLHKDREDVD
VQIVILDILQPNIQLQSVLKRNLNQVQFFQGSVMNTNDLARVQLEYADAC
LILCDKYSMDPDAEDAANIMRVISIKNYCPTIKVIVQLMQYHNKAYLMNI
PSWDWRRGDDVVCVAELKLGFIAQSCLAPGFSTLLANLFVMRSFKKYHHL
PEWVNQYVEGASLEMYTEYLSPSFHGLTFTEAVCVCFTKLNLLLIAVEVK
SNNRRNHSSSIAINPKPDITIEPGTQGFFIAESADDAKRAFYYCMACHMS
CKSVKPCNCQSSQHFQDTLYNIVSCSWQMFNNNGKSLIERNSFSKPETVI
RNRRKRFGGQSAKRRSQALNDTIHHIKFNEQSQRRFDSTGMFHWCSNREF
ESAILTNKDDLSSTVFSNHIVVCIFADANSPLIGLRSFVMPLRSSNYHYN
ELRQIIFVGPQDYLRREWKSLMNFPKIFVLNGSPLNRSKLRMININLCEM
TVILSTNHSNGLVDAYLADKEAILCSLNIKAMKFTDDNLQSKDLSEIFKN
LSTSASHQNSIIPMITELSVDSSVQYLDQDDEDNPDTELFLTQPFACGRA
FAVSVLDSLMSTAYFNENALTLIRTMVTGGATLELEELLSEGSGIQGAYL
TPETVANRDRCRVETMRLENSPYSELFGNEKTYGSLFMKCFKEYGILCFG
LYRLIIDNMEDCSYSISTNKNRFVVTNPSPETPLMNQDWVFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0006813potassium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0034765regulation of ion transmembrane transport
GO:0040011locomotion
GO:0042493response to drug
GO:0043050pharyngeal pumping
GO:0045214sarcomere organization
GO:0046928regulation of neurotransmitter secretion
GO:0048149behavioral response to ethanol
GO:0050804modulation of synaptic transmission
GO:0055085transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027359Volt_channel_dom_sf
IPR024939Ca-act_K_channel_Slo-1
IPR036291NAD(P)-bd_dom_sf
IPR028325VG_K_chnl
IPR003929K_chnl_BK_asu
IPR016040NAD(P)-bd_dom
IPR013099K_chnl_dom
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0015269calcium-activated potassium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
GO:0005515protein binding
GO:0060072large conductance calcium-activated potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031430M band
GO:0045202synapse
GO:0055120striated muscle dense body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 206..226
score: 24.15
coord: 328..354
score: 24.7
coord: 299..321
score: 37.38
NoneNo IPR availablePRINTSPR01449BKCHANNELAcoord: 524..539
score: 83.07
coord: 402..422
score: 36.9
coord: 478..491
score: 50.0
coord: 574..591
score: 42.59
coord: 926..941
score: 75.0
coord: 445..465
score: 76.19
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 760..898
e-value: 8.3E-6
score: 27.7
coord: 365..501
e-value: 1.2E-17
score: 65.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 264..360
e-value: 2.3E-17
score: 64.7
NoneNo IPR availablePANTHERPTHR10027CALCIUM-ACTIVATED POTASSIUM CHANNEL ALPHA CHAINcoord: 108..1093
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 173..355
NoneNo IPR availableTMHMMTMhelixcoord: 206..228
NoneNo IPR availableTMHMMTMhelixcoord: 263..285
NoneNo IPR availableTMHMMTMhelixcoord: 305..322
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 177..199
NoneNo IPR availableTMHMMTMhelixcoord: 238..256
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 272..350
e-value: 1.2E-14
score: 54.0
IPR003929Calcium-activated potassium channel BK, alpha subunitPFAMPF03493BK_channel_acoord: 501..597
e-value: 2.2E-35
score: 120.8
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 138..263
e-value: 2.0E-7
score: 32.8
IPR024939Calcium-activated potassium channel Slo-1PANTHERPTHR10027:SF28CALCIUM-ACTIVATED POTASSIUM CHANNEL SUBUNIT ALPHA-1coord: 108..1093
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 370..533