Ras-related protein Rab-1B, putative

Overview
NameRas-related protein Rab-1B, putative
Smed IDSMED30017581
Length (bp)683
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-1B, putative (SMED30017581) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-1B, putative (SMED30017581) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-1B, putative (SMED30017581) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-1B, putative (SMED30017581) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017581

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017581h1SMcG0007171 SmedASXL_008780SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30017581h1SMcG0007171 dd_Smed_v6_14510_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30017581h1SMcG0007171 Contig52882uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017581h1SMcG0007171 Contig52882newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30017581h1SMcG0007171 dd_Smed_v4_14510_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Human
Match: RAB1A (RAB1A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9758])

HSP 1 Score: 189.504 bits (480), Expect = 2.578e-60
Identity = 91/174 (52.30%), Postives = 129/174 (74.14%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            SM+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV+++F T+A EI +++
Sbjct:    3 SMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM 176          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Human
Match: RAB1A (RAB1A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9758])

HSP 1 Score: 189.504 bits (480), Expect = 2.578e-60
Identity = 91/174 (52.30%), Postives = 129/174 (74.14%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            SM+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV+++F T+A EI +++
Sbjct:    3 SMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM 176          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Human
Match: RAB1B (RAB1B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:18370])

HSP 1 Score: 186.808 bits (473), Expect = 3.135e-59
Identity = 90/173 (52.02%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ S+  + +W+  I++ + +N   +LVGNKSD   K+ +     K+FA +  I F ETSAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Human
Match: AL358472.6 (novel protein)

HSP 1 Score: 181.03 bits (458), Expect = 5.197e-57
Identity = 87/172 (50.58%), Postives = 125/172 (72.67%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRK 573
            M + YD+L KL+LIGDS VGK+ L++RF +D F+++YISTIG+DFK    +I  +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+TD  SF  +  WM  I +++    + +L+GNK D + KR++  E+  + A  + I F ETSAKS+ NVDEAF +LA +I+ K
Sbjct:    1 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLK 172          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Human
Match: RAB13 (RAB13, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9762])

HSP 1 Score: 181.03 bits (458), Expect = 5.197e-57
Identity = 87/172 (50.58%), Postives = 125/172 (72.67%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRK 573
            M + YD+L KL+LIGDS VGK+ L++RF +D F+++YISTIG+DFK    +I  +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+TD  SF  +  WM  I +++    + +L+GNK D + KR++  E+  + A  + I F ETSAKS+ NVDEAF +LA +I+ K
Sbjct:    1 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLK 172          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 184.882 bits (468), Expect = 6.934e-59
Identity = 87/172 (50.58%), Postives = 126/172 (73.26%), Query Frame = 1
Query:   52 IISMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEI 564
            + +M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYD+TD+ +F  + +W+  I++ + +N   +LVGNK D   KR +  +  + +A    I F ETSAKS+ NV++AF T+A+EI
Sbjct:    1 MAAMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEI 172          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 175.637 bits (444), Expect = 4.107e-55
Identity = 85/173 (49.13%), Postives = 125/173 (72.25%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKS-ANVDEAFKTLATEIIRKV 576
            M + YDYL KL+LIGDS VGK+ +L RF DD F++S+ISTIG+DFK    E++ +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+T+  SF  +  W+  I + +  + + +++GNK D +++RE++ + G+Q A      F ETSAK+  N+DEAF TLA +I  K+
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 175.637 bits (444), Expect = 4.107e-55
Identity = 85/173 (49.13%), Postives = 125/173 (72.25%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKS-ANVDEAFKTLATEIIRKV 576
            M + YDYL KL+LIGDS VGK+ +L RF DD F++S+ISTIG+DFK    E++ +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+T+  SF  +  W+  I + +  + + +++GNK D +++RE++ + G+Q A      F ETSAK+  N+DEAF TLA +I  K+
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 169.859 bits (429), Expect = 4.479e-53
Identity = 82/171 (47.95%), Postives = 122/171 (71.35%), Query Frame = 1
Query:   67 QNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKV 576
            + YD L KL+LIGDS VGK+ +L RF DD F+ ++ISTIG+DFK    E+  +K+KLQ+WDT+GQ+RF TITTSYYRG+ G +LVYD+T+  SF  +++W+  I++ + ++   +++GNK D  D+R ++ E G++ A  + I F ETSAK + +VD AF  LA  I+ K+
Sbjct:    4 RPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKM 174          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 169.859 bits (429), Expect = 4.479e-53
Identity = 82/171 (47.95%), Postives = 122/171 (71.35%), Query Frame = 1
Query:   67 QNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKV 576
            + YD L KL+LIGDS VGK+ +L RF DD F+ ++ISTIG+DFK    E+  +K+KLQ+WDT+GQ+RF TITTSYYRG+ G +LVYD+T+  SF  +++W+  I++ + ++   +++GNK D  D+R ++ E G++ A  + I F ETSAK + +VD AF  LA  I+ K+
Sbjct:    4 RPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKM 174          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 186.808 bits (473), Expect = 1.612e-59
Identity = 91/174 (52.30%), Postives = 126/174 (72.41%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            S++  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYD TD+ SF  + +W+  I + + +N   +LVGNKSD   K+ + +    ++AA   I F ETSAKSA NV++AF T+A EI  +V
Sbjct:    3 SVNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNRV 176          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 178.333 bits (451), Expect = 3.747e-56
Identity = 86/169 (50.89%), Postives = 123/169 (72.78%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEI 564
            M + YDYL KL+LIGDS VGK+ +L RF +D F+ ++ISTIG+DFK    E++ +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+T   SF  +  W+  I +++  + + +L+GNK +  DKR+++ E G+Q A    I F ETSAK S NV+EAF TLA++I
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI 169          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 178.333 bits (451), Expect = 3.747e-56
Identity = 86/169 (50.89%), Postives = 123/169 (72.78%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEI 564
            M + YDYL KL+LIGDS VGK+ +L RF +D F+ ++ISTIG+DFK    E++ +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+T   SF  +  W+  I +++  + + +L+GNK +  DKR+++ E G+Q A    I F ETSAK S NV+EAF TLA++I
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDI 169          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0473383)

HSP 1 Score: 174.866 bits (442), Expect = 1.328e-54
Identity = 83/174 (47.70%), Postives = 126/174 (72.41%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKV 576
            + DQN+DY+ KL++IG+S VGK+S L R+ DD F+ +++ST+G+DFK      ++++VKLQ+WDT+GQ+R+ TITT+YYRG+ GF+L+YDVT+ +SF  + +W+T+I   S  N ++ILVGNK D +D+R I++E G+Q A    + F ETSAK + NV   F+ L   I  K+
Sbjct:   13 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKM 186          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Fly
Match: Rab3 (gene:FBgn0005586 transcript:FBtr0088257)

HSP 1 Score: 174.866 bits (442), Expect = 1.328e-54
Identity = 83/174 (47.70%), Postives = 126/174 (72.41%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKV 576
            + DQN+DY+ KL++IG+S VGK+S L R+ DD F+ +++ST+G+DFK      ++++VKLQ+WDT+GQ+R+ TITT+YYRG+ GF+L+YDVT+ +SF  + +W+T+I   S  N ++ILVGNK D +D+R I++E G+Q A    + F ETSAK + NV   F+ L   I  K+
Sbjct:   13 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVDIICDKM 186          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Zebrafish
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 190.274 bits (482), Expect = 8.212e-61
Identity = 91/173 (52.60%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAKS+ NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTAAKEFADSLSIPFLETSAKSSTNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Zebrafish
Match: rab1ab (RAB1A, member RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-030616-564])

HSP 1 Score: 189.504 bits (480), Expect = 1.495e-60
Identity = 91/173 (52.60%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Zebrafish
Match: rab1ba (zRAB1B, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-040426-873])

HSP 1 Score: 188.734 bits (478), Expect = 3.982e-60
Identity = 90/173 (52.02%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ S+  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLAIPFLETSAKNATNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Zebrafish
Match: rab1bb (RAB1B, member RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-040625-133])

HSP 1 Score: 184.496 bits (467), Expect = 1.543e-58
Identity = 88/173 (50.87%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS +L+RF DD +++S+ISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ S+  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCILLRFADDTYTESFISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLKEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAEEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Zebrafish
Match: rab1bb (RAB1B, member RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-040625-133])

HSP 1 Score: 184.496 bits (467), Expect = 1.543e-58
Identity = 88/173 (50.87%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS +L+RF DD +++S+ISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ S+  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCILLRFADDTYTESFISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLKEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAEEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 191.045 bits (484), Expect = 5.746e-61
Identity = 94/186 (50.54%), Postives = 134/186 (72.04%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKS 612
            SM+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++     +  Q+K+
Sbjct:    3 SMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATAGGQEKN 188          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Xenopus
Match: rab1a (RAB1A, member RAS oncogene family [Source:NCBI gene;Acc:448007])

HSP 1 Score: 185.652 bits (470), Expect = 9.985e-59
Identity = 94/186 (50.54%), Postives = 133/186 (71.51%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKS 612
            SM  N DYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++     +  Q+K+
Sbjct:    5 SMPTN-DYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATAGGQEKN 189          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Xenopus
Match: maf (v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog [Source:Xenbase;Acc:XB-GENE-6053271])

HSP 1 Score: 182.956 bits (463), Expect = 1.042e-57
Identity = 90/171 (52.63%), Postives = 124/171 (72.51%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIR 570
            M ++YD+L KL++IGDS VGKSSLL+RF D+ FS SYI+TIGVDFK    EIN EKVKLQ+WDT+GQ+RF TIT++YYRG+ G ++VYDVT   SF  +  W+  IN++ D  C+ ILVGNK+D  +++ +  E+  +FAA  +I   ETSAK + NV+E F  +   ++R
Sbjct:    1 MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCR-ILVGNKNDDPERKVVETEDAYKFAAQMDIQLFETSAKENLNVEEMFNCITELVLR 170          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 180.259 bits (456), Expect = 1.315e-56
Identity = 87/173 (50.29%), Postives = 127/173 (73.41%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M + YDYL KL+LIGDS VGK+ LL RF +D F+ ++ISTIG+DFK    E++ +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+T+  SF  +  W+  I + +  + + +++GNK D  DKR+++ E+G++ A    I F ETSAKS+ NV+EAF TLA +I+ K+
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEAFFTLARDIMTKL 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Xenopus
Match: clcn7 (chloride channel, voltage-sensitive 7 [Source:Xenbase;Acc:XB-GENE-995168])

HSP 1 Score: 171.4 bits (433), Expect = 5.479e-53
Identity = 82/176 (46.59%), Postives = 126/176 (71.59%), Query Frame = 1
Query:   52 IISMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKS-ANVDEAFKTLATEIIRKV 576
            + +M + YDYL KL+LIGDS VGK+ +L RF +D F+ ++ISTIG+DFK    E++ +++KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+T+  SF  +  W+  I + +  + + +++GNK D  +KR+++ E+G++ A    I F ETSAK+  NV+ AF TLA +I  K+
Sbjct:   11 VFNMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVEKMILGNKCDVNEKRQVSKEKGEKLALEYGIKFMETSAKANINVENAFFTLARDIKAKM 186          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 189.504 bits (480), Expect = 1.770e-60
Identity = 91/174 (52.30%), Postives = 129/174 (74.14%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            SM+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV+++F T+A EI +++
Sbjct:    3 SMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM 176          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 187.963 bits (476), Expect = 7.559e-60
Identity = 90/173 (52.02%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV+++F T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Mouse
Match: Rab1b (RAB1B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1923558])

HSP 1 Score: 186.422 bits (472), Expect = 3.474e-59
Identity = 89/173 (51.45%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ S+  + +W+  I++ + +N   +LVGNKSD   K+ +     K+FA +  + F ETSAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Mouse
Match: Rab13 (RAB13, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1927232])

HSP 1 Score: 182.57 bits (462), Expect = 1.012e-57
Identity = 86/172 (50.00%), Postives = 125/172 (72.67%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRK 573
            M + YD+L KL+LIGDS VGK+ L++RF +D F+ +YISTIG+DFK    +I  +++KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+TD  SF  +  WM  I +++    + +L+GNK D + KR++  E+ ++ A  + I F ETSAKS+ NVDEAF +LA +I+ K
Sbjct:    1 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDILLK 172          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Mouse
Match: Rab35 (RAB35, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1924657])

HSP 1 Score: 180.644 bits (457), Expect = 4.907e-57
Identity = 89/171 (52.05%), Postives = 122/171 (71.35%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIR 570
            M ++YD+L KL++IGDS VGKSSLL+RF D+ FS SYI+TIGVDFK    EIN EKVKLQ+WDT+GQ+RF TIT++YYRG+ G ++VYDVT   SF  +  W+  IN++ D  C+ ILVGNK+D  +++ +  E+  +FA    I   ETSAK + NV+E F  +   ++R
Sbjct:    1 MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCR-ILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLR 170          
BLAST of Ras-related protein Rab-1B, putative vs. UniProt/SwissProt
Match: sp|Q05974|RAB1A_LYMST (Ras-related protein Rab-1A OS=Lymnaea stagnalis OX=6523 GN=RAB1A PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.817e-60
Identity = 93/186 (50.00%), Postives = 133/186 (71.51%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKS 612
            +M+ +YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNKSD   K+ + +   K++A    I F ETSAK+A NV++AF T+A EI  ++  I  +   K S
Sbjct:    3 TMNPDYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDFTTAKEYADQLGIPFLETSAKNATNVEQAFMTMAAEIKNRMGPITAASDSKPS 188          
BLAST of Ras-related protein Rab-1B, putative vs. UniProt/SwissProt
Match: sp|P31584|YPTV1_VOLCA (GTP-binding protein yptV1 OS=Volvox carteri OX=3067 GN=YPTV1 PE=3 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 4.134e-60
Identity = 92/169 (54.44%), Postives = 125/169 (73.96%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEI 564
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNKSD   K+ + Y+  K FA    I F ETSAK+A NV++AF T+A EI
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTVELDGKVIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLAEIDRYASENVNKLLVGNKSDLTGKKVVDYQAAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEI 169          
BLAST of Ras-related protein Rab-1B, putative vs. UniProt/SwissProt
Match: sp|Q39571|YPTC1_CHLRE (GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii OX=3055 GN=YPTC1 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 9.152e-60
Identity = 92/169 (54.44%), Postives = 124/169 (73.37%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEI 564
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNKSD   K+ + Y   K FA    I F ETSAK+A NV++AF T+A EI
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTVELDGKVIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKLLVGNKSDLTSKKVVEYSVAKAFADEIGIPFLETSAKNATNVEQAFMTMAAEI 169          
BLAST of Ras-related protein Rab-1B, putative vs. UniProt/SwissProt
Match: sp|Q52NJ2|RAB1A_PIG (Ras-related protein Rab-1A OS=Sus scrofa OX=9823 GN=RAB1A PE=2 SV=3)

HSP 1 Score: 189.889 bits (481), Expect = 9.745e-60
Identity = 91/174 (52.30%), Postives = 129/174 (74.14%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            SM+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV+++F T+A EI +++
Sbjct:    3 SMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQGSFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM 176          
BLAST of Ras-related protein Rab-1B, putative vs. UniProt/SwissProt
Match: sp|P22125|RAB1_DIPOM (Ras-related protein ORAB-1 OS=Diplobatis ommata OX=1870830 PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.011e-59
Identity = 94/187 (50.27%), Postives = 133/187 (71.12%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKSKL 618
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++     S   +KS +
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATSGGSEKSNV 187          
BLAST of Ras-related protein Rab-1B, putative vs. TrEMBL
Match: A0A1A8N8D2 (Uncharacterized protein (Fragment) OS=Nothobranchius pienaari OX=704102 GN=Nfu_g_1_017174 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 4.099e-62
Identity = 95/174 (54.60%), Postives = 130/174 (74.71%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
             M ++YDYL KL++IGDS VGKSSLL+RF D+ FS SYI+TIGVDFK    E+N EKVKLQ+WDT+GQ+RF  +T SYYRG++G L+VYD+T R+++  LS W+T     ++ N  IIL+GNK+D + +R++TYEE KQFA  N ++F E SAK+  NV+EAF   A +I + +
Sbjct:    3 GMARDYDYLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVELNGEKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEEAFLEAAKKIYQNI 176          
BLAST of Ras-related protein Rab-1B, putative vs. TrEMBL
Match: A0A1J1H3I3 (Ras-related protein Rab-1B, putative OS=Plasmodium gallinaceum OX=5849 GN=RAB1b PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 6.014e-62
Identity = 102/186 (54.84%), Postives = 138/186 (74.19%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKSK 615
            M+ +YD L K++LIGDS VGKS LL+RF DD ++DSYISTIGVDFK    EI+++ +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTDR+SF  +  W+  I K + ++ + IL+GNK D K+ R ++YEEGK+ A +  I F ETSAK A NV++AFKT+A EI  K +L    E Q+K K
Sbjct:    1 MNDSYDSLFKILLIGDSGVGKSCLLLRFADDTYTDSYISTIGVDFKIKTIEIDDKIIKLQIWDTAGQERFRTITSSYYRGAQGIIIVYDVTDRDSFNNVKNWIIEIEKYASEDVQKILIGNKIDLKNDRNVSYEEGKELADSCNIQFLETSAKIAHNVEQAFKTMAYEIKNKSHL----ENQQKGK 182          
BLAST of Ras-related protein Rab-1B, putative vs. TrEMBL
Match: A0A139XVT8 (Putative small GTP binding protein rab1a OS=Toxoplasma gondii ARI OX=1074872 GN=TGARI_214770 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.168e-61
Identity = 100/185 (54.05%), Postives = 134/185 (72.43%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKS 612
            M   YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    +++ + VKLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTDR SF  +  WM  I+K + +    +LVGNK D   KR +TYEEGK+FA +  + F ETSAK+A NV++AF  +A+EI  +V    V++QQ + 
Sbjct:    1 MKPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDLDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDRESFNNVKNWMMEIDKYAMEGVSKLLVGNKCDLTSKRTVTYEEGKEFADSCNMRFIETSAKNAHNVEQAFHIMASEIKARV---QVNQQQSRP 182          
BLAST of Ras-related protein Rab-1B, putative vs. TrEMBL
Match: A0A125YLS2 (Small GTP binding protein rab1a, putative OS=Toxoplasma gondii (strain ATCC 50611 / Me49) OX=508771 GN=TGME49_214770 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.168e-61
Identity = 100/185 (54.05%), Postives = 134/185 (72.43%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKS 612
            M   YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    +++ + VKLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTDR SF  +  WM  I+K + +    +LVGNK D   KR +TYEEGK+FA +  + F ETSAK+A NV++AF  +A+EI  +V    V++QQ + 
Sbjct:    1 MKPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDLDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDRESFNNVKNWMMEIDKYAMEGVSKLLVGNKCDLTSKRTVTYEEGKEFADSCNMRFIETSAKNAHNVEQAFHIMASEIKARV---QVNQQQSRP 182          
BLAST of Ras-related protein Rab-1B, putative vs. TrEMBL
Match: A0A086JV56 (Putative small GTP binding protein rab1a OS=Toxoplasma gondii GAB2-2007-GAL-DOM2 OX=1130820 GN=TGDOM2_214770 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.168e-61
Identity = 100/185 (54.05%), Postives = 134/185 (72.43%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKS 612
            M   YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    +++ + VKLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTDR SF  +  WM  I+K + +    +LVGNK D   KR +TYEEGK+FA +  + F ETSAK+A NV++AF  +A+EI  +V    V++QQ + 
Sbjct:    1 MKPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDLDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDRESFNNVKNWMMEIDKYAMEGVSKLLVGNKCDLTSKRTVTYEEGKEFADSCNMRFIETSAKNAHNVEQAFHIMASEIKARV---QVNQQQSRP 182          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Cavefish
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:103045400])

HSP 1 Score: 190.274 bits (482), Expect = 8.553e-61
Identity = 95/184 (51.63%), Postives = 134/184 (72.83%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKK 609
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + VKLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  L +W+  I++ + +N   +LVGNKSD   K+ + +   K+FA   +I F E+SAK+A NV++AF T+A+EI +++   NV  +  K
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIEMDGKIVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNLKQWLEEIDRYACENVSKLLVGNKSDLTSKKVVDFTTAKEFAEPLKIPFLESSAKNASNVEKAFLTMASEIQKRLGSENVQNETVK 184          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Cavefish
Match: rab1ab (ras-related protein Rab-1A [Source:NCBI gene;Acc:103035225])

HSP 1 Score: 189.504 bits (480), Expect = 1.293e-60
Identity = 91/173 (52.60%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Cavefish
Match: rab13 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:103044636])

HSP 1 Score: 184.496 bits (467), Expect = 1.440e-58
Identity = 94/202 (46.53%), Postives = 135/202 (66.83%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEII-----------RKVYLINVSEQQKKSKLCRLF 630
            M + YD+L KL+LIGDS VGK+ L++RF +D F+ +YISTIG+DFK    E+  +KVKLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+TD  SF  +  WM  I +++      +L+GNK D + KR+++ E G++ A  + I F ETSAKS+ NV+E+F +LA +I+           R+V L   +  +KKS  C L 
Sbjct:    1 MAKKYDFLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVSRMLLGNKCDIEAKRKVSKEMGEKLAKDHGIRFFETSAKSSINVEESFMSLARDILLKSGKKSGPTGREVKLTTTTTPEKKSSKCLLL 202          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Cavefish
Match: ENSAMXT00000045110.1 (ras-related protein Rab-1A [Source:NCBI gene;Acc:103028654])

HSP 1 Score: 184.496 bits (467), Expect = 1.456e-58
Identity = 88/173 (50.87%), Postives = 127/173 (73.41%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + ++   ++VGNK D   K+ + Y   K+FA +  I F E SAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASESVNKLMVGNKCDLTTKKVVDYTTAKEFADSLGIPFLEASAKNATNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Cavefish
Match: rab1ba (zRAB1B, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-040426-873])

HSP 1 Score: 184.882 bits (468), Expect = 1.928e-58
Identity = 88/171 (51.46%), Postives = 127/171 (74.27%), Query Frame = 1
Query:   67 QNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            + +DYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ S+  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++
Sbjct:   24 RKHDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLAIPFLETSAKNATNVEQAFMTMAAEIKKRM 194          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 192.586 bits (488), Expect = 2.067e-62
Identity = 92/174 (52.87%), Postives = 130/174 (74.71%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            +M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA + EI F ETSAK+A NV++AF T+A EI +++
Sbjct:    3 TMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKRM 176          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 174.096 bits (440), Expect = 3.441e-55
Identity = 84/173 (48.55%), Postives = 124/173 (71.68%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKV 576
            M + YDYL KL+LIGDS VGK+ +L RF +D F+ ++ISTIG+DFK    +++ +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+T+  SF  +  W+  I + +  + + +++GNK D  ++R++T E G++ A    I F ETSAK S NV+EAF TLA +I  K+
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 174.096 bits (440), Expect = 8.168e-55
Identity = 81/174 (46.55%), Postives = 124/174 (71.26%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKV 576
            + DQN+DY+ KL++IG+S VGK+S L R+ D+ F+ +++ST+G+DFK      NE+++KLQ+WDT+GQ+R+ TITT+YYRG+ GF+L+YD+T+ +SF  +S+W T+I   S  N +++LVGNK D +D R +  E+G+Q A      F ETSAK + NV + F+ L   I  K+
Sbjct:   21 AADQNFDYMFKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYSWDNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVDVICEKM 194          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002219.1 (pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene:ENSPMAG00000002006.1 transcript:ENSPMAT00000002219.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 1.091e-53
Identity = 80/170 (47.06%), Postives = 117/170 (68.82%), Query Frame = 1
Query:   70 NYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            NY Y+ K ++IGD  VGKS LL +F +  F      TIGV+F T + E++ +KVKLQ+WDT+GQ+RF  +T SYYRG++G L+VYD+T R+++  LS W+T     ++ N  I L+GNK+D + +R++TYEE KQFA  N ++F E SAK+  NV+EAF   A +I + +
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGDNVEEAFLETAKKIYQNI 176          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 167.933 bits (424), Expect = 1.367e-52
Identity = 82/170 (48.24%), Postives = 118/170 (69.41%), Query Frame = 1
Query:   70 NYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKV 576
            +Y YL K ++IGD+ VGKS LL++F D  F   +  TIGV+F   +  I  ++VKLQ+WDT+GQ+ F +IT SYYRG++G LLVYD+T R++F  L+ W+    + S+ N  I+L+GNKSD + +RE+  EEG+ FA  + ++F ETSAK +ANV+EAF   A EI  K+
Sbjct:    7 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHSNSNMVIMLIGNKSDLESRREVKCEEGEAFAREHGLVFMETSAKTAANVEEAFINTAREIYEKI 176          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 185.267 bits (469), Expect = 8.667e-60
Identity = 94/184 (51.09%), Postives = 130/184 (70.65%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSA-KSANVDEAFKTLATEIIRKVYLINVSEQQKK 609
            M+  YDYL KL+LIG+S VGKS LL+RF DD +++ YISTIGVDFK    E++ + VKLQ+WDT+GQ+RF TIT+SYYRGS G ++VYDVTD+ SF  +  W+  I++ +      +LVGNK D KDKR + Y+  K+FA  N++ F ETSA  S NV++AF T+A +I   +   N++E  +K
Sbjct:    1 MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQK 184          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 175.637 bits (444), Expect = 8.048e-56
Identity = 88/171 (51.46%), Postives = 126/171 (73.68%), Query Frame = 1
Query:   67 QNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKS-ANVDEAFKTLATEIIRKV 576
            ++YD ++K++LIGDS VGKS LLVRFV+D F+ S+I+TIG+DFK    +IN +KVKLQ+WDT+GQ+RF TITT+YYRG+ G +LVYDVTD  +FT + +W   +N+ ++   +++LVGNKSD  + R +T ++G+  A    I F E+SAK+  NV+E F TLA  I  K+
Sbjct:   15 KSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM-ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKI 184          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 164.466 bits (415), Expect = 2.053e-51
Identity = 80/170 (47.06%), Postives = 116/170 (68.24%), Query Frame = 1
Query:   70 NYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSA-KSANVDEAFKTLATEIIRKV 576
            +YDYL K+VLIGDS VGKS+LL RF  D F+    STIGV+F T   E+  +K+K Q+WDT+GQ+R+  IT++YYRG+ G L+VYD++  +S+   + W+T + +++D N  + L+GNKSD    R +  +E K FA  N+++F ETSA  S NVD+AF+ L   I + V
Sbjct:    9 DYDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMV 178          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 161.384 bits (407), Expect = 4.295e-50
Identity = 79/169 (46.75%), Postives = 116/169 (68.64%), Query Frame = 1
Query:   73 YDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSA-KSANVDEAFKTLATEIIRKV 576
            YD L K+VLIGDS VGKS+LL RF  + F+    STIGV+F T   EI+ +++K Q+WDT+GQ+R+  IT++YYRG+ G L+VYD++  +S+   + W++ + +++D N  + L+GNKSD    R +  EE K FA  N+++F ETSA  S NVD+AF+ L   I +KV
Sbjct:   10 YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKV 178          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 130.954 bits (328), Expect = 2.033e-38
Identity = 67/167 (40.12%), Postives = 106/167 (63.47%), Query Frame = 1
Query:   85 LKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSD---QKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRK 573
            +KLVL+G++ VGKSS+++RFV + F+++   TIG  F T    INE  VK ++WDT+GQ+RF ++   YYR +   L+VYDVT   SF +   W+  +++ + K+  I LVGNK D   +  +R++  EEG++ A    ++F ETSAK+  NV++ F  +  +I  K
Sbjct:    8 IKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLK 174          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 185.652 bits (470), Expect = 1.725e-59
Identity = 88/170 (51.76%), Postives = 126/170 (74.12%), Query Frame = 1
Query:   58 SMDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEI 564
            +M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + +   K++A +  + F ETSAK+A NV++AF T+A EI
Sbjct:    3 TMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACENVNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAFMTMAAEI 172          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Nematostella
Match: EDO42144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G3])

HSP 1 Score: 182.57 bits (462), Expect = 3.724e-58
Identity = 88/173 (50.87%), Postives = 123/173 (71.10%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKSSLL+RF DD FS++YISTIGVDFK     ++ + +KLQ+WDT+GQ+RF T+TT+YYR + G +L+YDV +  +F  LS+W+  +++ + +    ILVGNK D  D R++ Y   K+FA   +I F ETSAK S NV+  F+T+A E+  K+
Sbjct:    1 MNSEYDYLFKLLLIGDSGVGKSSLLLRFADDTFSNTYISTIGVDFKIRTLTVDGKTIKLQIWDTAGQERFRTLTTAYYRSAHGIVLIYDVNESETFLHLSQWLEEVSEYACEGVNTILVGNKCDLIDCRQVGYNTAKEFAEKLDISFIETSAKDSTNVESVFRTMAAELKAKL 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 178.718 bits (452), Expect = 7.857e-57
Identity = 83/170 (48.82%), Postives = 127/170 (74.71%), Query Frame = 1
Query:   67 QNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKS-ANVDEAFKTLATEIIRK 573
            ++YDYL KL+LIGDS VGK+ +L RF DD F+ ++ISTIG+DFK    E+  +K+KLQ+WDT+GQ+RF TITTSYYRG+ G +LVYD+T   +F  +S+W+  I + ++++ + +++GNK D  D+R ++ E G+Q A  + I F ETSAK+  N+++AF+ LA +I++K
Sbjct:    4 KSYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHANEDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILKK 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 176.792 bits (447), Expect = 6.837e-56
Identity = 84/169 (49.70%), Postives = 124/169 (73.37%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEI 564
            M + YD+L KL+LIGDS VGK+ +L RF +D F+ ++ISTIG+DFK    E++ +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+T+  SF  +  W+  I + + ++ + +++GNK D +D+R+++ E G+Q A    I F ETSAK S NV+EAF TLA +I
Sbjct:    1 MAKTYDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVLGNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDI 169          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 174.481 bits (441), Expect = 2.398e-55
Identity = 86/178 (48.31%), Postives = 126/178 (70.79%), Query Frame = 1
Query:   76 DYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKS-ANVDEAFKTLATEIIRKVYLINVSEQQK 606
            D   KL+LIGDS VGK+ ++ RF D+ F+ S+ISTIG+DFK    E+  +K+KLQ+WDT+GQ+RF TITT+YYRG+ G +LVYDVT+  SF+ +S+W+ +I+  ++++ K +LVGNK D  DKR I+  +G+Q A++  I F ETSA S  NV+++F  L  +I+  V    V E +K
Sbjct:    7 DLFFKLLLIGDSGVGKTCIIFRFADNTFNPSFISTIGIDFKIKTLELGGKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKIDDHANEDVKRMLVGNKCDMYDKRVISQTKGEQLASSYGISFIETSALSNINVEKSFVVLTEDILNAVCPPTVEETEK 184          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Medaka
Match: rab1aa (ras-related protein Rab-1A [Source:NCBI gene;Acc:101162421])

HSP 1 Score: 189.504 bits (480), Expect = 1.271e-60
Identity = 91/173 (52.60%), Postives = 127/173 (73.41%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   ++ + Y   K+FA    I F ETSAKSA NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTRKVVDYTTAKEFADNLGIPFLETSAKSATNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Medaka
Match: rab1ab (ras-related protein ORAB-1 [Source:NCBI gene;Acc:101161080])

HSP 1 Score: 189.504 bits (480), Expect = 1.448e-60
Identity = 91/173 (52.60%), Postives = 128/173 (73.99%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKV 576
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  + +W+  I++ + +N   +LVGNK D   K+ + Y   K+FA +  I F ETSAK+A NV++AF T+A EI +++
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRM 173          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Medaka
Match: ENSORLT00000032751.1 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:101156603])

HSP 1 Score: 181.03 bits (458), Expect = 3.188e-57
Identity = 86/172 (50.00%), Postives = 126/172 (73.26%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRK 573
            M + YD+L KL+LIGDS VGK+ L++RF +D ++ +YISTIG+DFK    E++ +KVKLQ+WDT+GQ+RF TITT+YYRG+ G +LVYD+TD  SF  +  WM  I +++      +L+GNK D + KR+++ E G+  A  + I F ETSAKS+ NV+E+F+ LA +I++K
Sbjct:    1 MAKKYDFLFKLLLIGDSGVGKTCLIIRFAEDNYNTTYISTIGIDFKVKTIEVDGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIRENASAGVTRMLLGNKCDVEAKRKVSKETGETLAKEHAIRFFETSAKSSINVEESFQALARDILQK 172          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Medaka
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:101173484])

HSP 1 Score: 179.874 bits (455), Expect = 1.088e-56
Identity = 88/169 (52.07%), Postives = 126/169 (74.56%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEI 564
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    +++ + VKLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVT++ SF  + +W+  I++ + +N   +LVGNKSD   K+ +     +  A++ +I F ETSAKS+ NV++AF T+A+EI
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDMDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTEQESFNNVRQWLEEIDRYACENVSRLLVGNKSDLVSKKVVDAATAQDLASSLKIPFLETSAKSSGNVEKAFLTMASEI 169          
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Medaka
Match: zgc:171927 (ras-related protein ORAB-1-like [Source:NCBI gene;Acc:101173484])

HSP 1 Score: 179.874 bits (455), Expect = 1.088e-56
Identity = 88/169 (52.07%), Postives = 126/169 (74.56%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEI 564
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    +++ + VKLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVT++ SF  + +W+  I++ + +N   +LVGNKSD   K+ +     +  A++ +I F ETSAKS+ NV++AF T+A+EI
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIDMDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTEQESFNNVRQWLEEIDRYACENVSRLLVGNKSDLVSKKVVDAATAQDLASSLKIPFLETSAKSSGNVEKAFLTMASEI 169          
BLAST of Ras-related protein Rab-1B, putative vs. Planmine SMEST
Match: SMESG000030620.1 (SMESG000030620.1)

HSP 1 Score: 384.03 bits (985), Expect = 1.377e-137
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSANVDEAFKTLATEIIRKVYLINVSEQQKKSKLCRLF 630
            MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSANVDEAFKTLATEIIRKVYLINVSEQQKKSKLCRLF
Sbjct:    1 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSANVDEAFKTLATEIIRKVYLINVSEQQKKSKLCRLF 190          
BLAST of Ras-related protein Rab-1B, putative vs. Planmine SMEST
Match: SMESG000030620.1 (SMESG000030620.1)

HSP 1 Score: 308.145 bits (788), Expect = 3.734e-108
Identity = 160/190 (84.21%), Postives = 160/190 (84.21%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSANVDEAFKTLATEIIRKVYLINVSEQQKKSKLCRLF 630
            MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINK                              FAATNEIMFCETSAKSANVDEAFKTLATEIIRKVYLINVSEQQKKSKLCRLF
Sbjct:    1 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINK------------------------------FAATNEIMFCETSAKSANVDEAFKTLATEIIRKVYLINVSEQQKKSKLCRLF 160          
BLAST of Ras-related protein Rab-1B, putative vs. Planmine SMEST
Match: SMESG000030619.1 (SMESG000030619.1)

HSP 1 Score: 196.823 bits (499), Expect = 1.764e-63
Identity = 95/172 (55.23%), Postives = 132/172 (76.74%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRK 573
            M ++YDYL KL+LIGDS VGK+SLLVRF D+ FS S+I+TIG+DFK    ++  +KVKLQ+WDT+GQ+RF TITTSYYRG++G +LVYDVT  +SF  +++WM  I + ++ + + +L+GNKSD  D+REI+ E G + A  + I+F ETSAKS+ NVD+AF+ L  EI +K
Sbjct:    1 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADETFSTSFITTIGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKK 172          
BLAST of Ras-related protein Rab-1B, putative vs. Planmine SMEST
Match: SMESG000026323.1 (SMESG000026323.1)

HSP 1 Score: 187.193 bits (474), Expect = 8.854e-60
Identity = 93/187 (49.73%), Postives = 132/187 (70.59%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAKSA-NVDEAFKTLATEIIRKVYLINVSEQQKKSKL 618
            M+  YDYL KL+LIGDS VGKS LL+RF DD +++SYISTIGVDFK    E++ + +KLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD++SF  +  W++ I++ +++N   +LVGNK+D   KR +     K++A +  I F ETSAK A NV++AF T+A EI  +      S Q+   K+
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQDSFNNVKNWLSEIDRYANENVNKLLVGNKTDLISKRVVEASNAKEYADSLNIPFLETSAKDATNVEQAFLTMAGEIKSRSGPPASSSQKPTVKV 187          
BLAST of Ras-related protein Rab-1B, putative vs. Planmine SMEST
Match: SMESG000049854.1 (SMESG000049854.1)

HSP 1 Score: 185.652 bits (470), Expect = 3.159e-59
Identity = 91/185 (49.19%), Postives = 128/185 (69.19%), Query Frame = 1
Query:   61 MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCETSAK-SANVDEAFKTLATEIIRKVYLINVSEQQKKS 612
            M+  YDYL KL+LIGDS VGKS +L+RF DD ++DSYISTIGVDFK    E++ + VKLQ+WDT+GQ+RF TIT+SYYRG+ G ++VYDVTD+ SF  +  W+  I + +++N   +L+GNKSD   K+ +     K+FA +  I F ETSA+ S NV++ F T+A EI  ++     +  Q+ S
Sbjct:    1 MNPEYDYLFKLLLIGDSGVGKSCILLRFADDTYTDSYISTIGVDFKIRTIELDGKTVKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQTSFNNVKNWLNEIERYANENVNKLLIGNKSDMVSKKVVDSGTAKEFADSLNIPFLETSARDSTNVEKTFITMAQEIKNRLGPAAAASNQRPS 185          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB1A2.578e-6052.30RAB1A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB1A2.578e-6052.30RAB1A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB1B3.135e-5952.02RAB1B, member RAS oncogene family [Source:HGNC Sym... [more]
AL358472.65.197e-5750.58novel protein[more]
RAB135.197e-5750.58RAB13, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-16.934e-5950.58RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
rab-84.107e-5549.13RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-84.107e-5549.13RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-104.479e-5347.95Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
rab-104.479e-5347.95Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab11.612e-5952.30gene:FBgn0285937 transcript:FBtr0084104[more]
Rab83.747e-5650.89gene:FBgn0262518 transcript:FBtr0308833[more]
Rab83.747e-5650.89gene:FBgn0262518 transcript:FBtr0074921[more]
Rab31.328e-5447.70gene:FBgn0005586 transcript:FBtr0473383[more]
Rab31.328e-5447.70gene:FBgn0005586 transcript:FBtr0088257[more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab1aa8.212e-6152.60RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab1ab1.495e-6052.60RAB1A, member RAS oncogene family b [Source:ZFIN;A... [more]
rab1ba3.982e-6052.02zRAB1B, member RAS oncogene family a [Source:ZFIN;... [more]
rab1bb1.543e-5850.87RAB1B, member RAS oncogene family b [Source:ZFIN;A... [more]
rab1bb1.543e-5850.87RAB1B, member RAS oncogene family b [Source:ZFIN;A... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab1a5.746e-6150.54RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
rab1a9.985e-5950.54RAB1A, member RAS oncogene family [Source:NCBI gen... [more]
maf1.042e-5752.63v-maf avian musculoaponeurotic fibrosarcoma oncoge... [more]
pknox21.315e-5650.29PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
clcn75.479e-5346.59chloride channel, voltage-sensitive 7 [Source:Xenb... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab1a1.770e-6052.30RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a7.559e-6052.02RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
Rab1b3.474e-5951.45RAB1B, member RAS oncogene family [Source:MGI Symb... [more]
Rab131.012e-5750.00RAB13, member RAS oncogene family [Source:MGI Symb... [more]
Rab354.907e-5752.05RAB35, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05974|RAB1A_LYMST2.817e-6050.00Ras-related protein Rab-1A OS=Lymnaea stagnalis OX... [more]
sp|P31584|YPTV1_VOLCA4.134e-6054.44GTP-binding protein yptV1 OS=Volvox carteri OX=306... [more]
sp|Q39571|YPTC1_CHLRE9.152e-6054.44GTP-binding protein YPTC1 OS=Chlamydomonas reinhar... [more]
sp|Q52NJ2|RAB1A_PIG9.745e-6052.30Ras-related protein Rab-1A OS=Sus scrofa OX=9823 G... [more]
sp|P22125|RAB1_DIPOM1.011e-5950.27Ras-related protein ORAB-1 OS=Diplobatis ommata OX... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1A8N8D24.099e-6254.60Uncharacterized protein (Fragment) OS=Nothobranchi... [more]
A0A1J1H3I36.014e-6254.84Ras-related protein Rab-1B, putative OS=Plasmodium... [more]
A0A139XVT81.168e-6154.05Putative small GTP binding protein rab1a OS=Toxopl... [more]
A0A125YLS21.168e-6154.05Small GTP binding protein rab1a, putative OS=Toxop... [more]
A0A086JV561.168e-6154.05Putative small GTP binding protein rab1a OS=Toxopl... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1719278.553e-6151.63ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
rab1ab1.293e-6052.60ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
rab131.440e-5846.53RAB13, member RAS oncogene family [Source:NCBI gen... [more]
ENSAMXT00000045110.11.456e-5850.87ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
rab1ba1.928e-5851.46zRAB1B, member RAS oncogene family a [Source:ZFIN;... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab1aa2.067e-6252.87RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab8a3.441e-5548.55RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab3c8.168e-5546.55RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000002219.11.091e-5347.06pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene... [more]
RAB2B1.367e-5248.24RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT18.667e-6051.09Rab family GTPase; involved in the ER-to-Golgi ste... [more]
SEC48.048e-5651.46Rab family GTPase; essential for vesicle-mediated ... [more]
YPT322.053e-5147.06Rab family GTPase involved in the exocytic pathway... [more]
YPT314.295e-5046.75Rab family GTPase; involved in the exocytic pathwa... [more]
VPS212.033e-3840.12Endosomal Rab family GTPase; required for endocyti... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401671.725e-5951.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421443.724e-5850.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474717.857e-5748.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410186.837e-5649.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408452.398e-5548.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab1aa1.271e-6052.60ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
rab1ab1.448e-6052.60ras-related protein ORAB-1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000032751.13.188e-5750.00RAB13, member RAS oncogene family [Source:NCBI gen... [more]
zgc:1719271.088e-5652.07ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
zgc:1719271.088e-5652.07ras-related protein ORAB-1-like [Source:NCBI gene;... [more]
back to top
BLAST of Ras-related protein Rab-1B, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030620.11.377e-137100.00SMESG000030620.1[more]
SMESG000030620.13.734e-10884.21SMESG000030620.1[more]
SMESG000030619.11.764e-6355.23SMESG000030619.1[more]
SMESG000026323.18.854e-6049.73SMESG000026323.1[more]
SMESG000049854.13.159e-5949.19SMESG000049854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017581 ID=SMED30017581|Name=Ras-related protein Rab-1B, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=683bp
CAATGGAATTTCGATTGAATTTGGTTATTTTTTGACATAATTTTGGTAGA
TATAATTTCGATGGACCAAAATTATGATTATTTATTGAAATTAGTTTTAA
TTGGTGATTCGAAGGTCGGCAAGTCGAGCTTGCTTGTGAGATTCGTCGAC
GACATCTTCAGCGATTCTTACATTTCAACGATTGGTGTAGATTTTAAAAC
TCTGGTTACTGAAATAAATGAGGAAAAGGTGAAGCTGCAAATGTGGGATA
CCTCAGGACAAAAGAGGTTTGACACAATCACCACATCATATTATCGTGGA
TCATCGGGCTTCCTGCTAGTATACGACGTGACCGACCGAAATTCCTTCAC
AAGGTTAAGCGAGTGGATGACAAGAATAAATAAATCAAGTGATAAAAACT
GTAAAATAATTCTTGTTGGTAACAAAAGCGATCAAAAAGACAAGCGAGAA
ATAACGTATGAAGAGGGGAAACAGTTTGCTGCCACCAACGAAATCATGTT
CTGCGAAACCAGTGCGAAATCTGCAAACGTTGATGAAGCTTTCAAAACCT
TGGCAACGGAAATAATTCGGAAAGTTTATTTGATTAACGTAAGTGAACAA
CAGAAAAAATCCAAGTTATGTCGGCTGTTCTGAAGGAATGTGTCTTATTT
CCTTATCTTGCTTAGATATTTTCAGATCGGAAG
back to top

protein sequence of SMED30017581-orf-1

>SMED30017581-orf-1 ID=SMED30017581-orf-1|Name=SMED30017581-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MDQNYDYLLKLVLIGDSKVGKSSLLVRFVDDIFSDSYISTIGVDFKTLVT
EINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLS
EWMTRINKSSDKNCKIILVGNKSDQKDKREITYEEGKQFAATNEIMFCET
SAKSANVDEAFKTLATEIIRKVYLINVSEQQKKSKLCRLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 146..168
score: 24.97
coord: 112..125
score: 47.51
coord: 9..30
score: 52.68
coord: 32..48
score: 38.57
coord: 50..72
score: 39.55
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 14..189
e-value: 5.8E-4
score: 7.9
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 6..171
e-value: 1.5E-35
score: 134.1
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 9..171
e-value: 1.3E-82
score: 290.4
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 11..172
e-value: 4.3E-11
score: 22.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..187
e-value: 2.0E-63
score: 215.4
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 3..187
NoneNo IPR availablePANTHERPTHR24073:SF963RAS-RELATED PROTEIN RAB-1Acoord: 3..187
NoneNo IPR availablePROSITEPS51419RABcoord: 4..190
score: 32.847
NoneNo IPR availableCDDcd00154Rabcoord: 9..166
e-value: 1.69225E-78
score: 229.265
IPR001806Small GTPasePFAMPF00071Rascoord: 10..169
e-value: 5.1E-58
score: 195.3
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 8..164
e-value: 6.8E-31
score: 105.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 3..185