Transmembrane protein 68

Overview
NameTransmembrane protein 68
Smed IDSMED30017566
Length (bp)2142
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 68 (SMED30017566) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 68 (SMED30017566) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 68 (SMED30017566) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 68 (SMED30017566) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017566

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017566h1SMcG0001372 SmedASXL_081669SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 68 vs. Ensembl Human
Match: TMEM68 (transmembrane protein 68 [Source:HGNC Symbol;Acc:HGNC:26510])

HSP 1 Score: 163.696 bits (413), Expect = 1.886e-44
Identity = 91/194 (46.91%), Postives = 124/194 (63.92%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L  +  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE  R L  G   +  LYEK R P   +YG FP KLRTY+GDPI PY+ +  AE  A++ K +++ LI + Q +PGNI+ ++ +RF
Sbjct:  135 IDFYYFMAKIF--IHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-RSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVPIIPMFTQNIREGFRSLG-GTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGDPI-PYDPQITAEELAEKTKNAVQALIDKHQRIPGNIMSALLERF 323          
BLAST of Transmembrane protein 68 vs. Ensembl Human
Match: TMEM68 (transmembrane protein 68 [Source:HGNC Symbol;Acc:HGNC:26510])

HSP 1 Score: 163.696 bits (413), Expect = 1.886e-44
Identity = 91/194 (46.91%), Postives = 124/194 (63.92%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L  +  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE  R L  G   +  LYEK R P   +YG FP KLRTY+GDPI PY+ +  AE  A++ K +++ LI + Q +PGNI+ ++ +RF
Sbjct:  135 IDFYYFMAKIF--IHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-RSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVPIIPMFTQNIREGFRSLG-GTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGDPI-PYDPQITAEELAEKTKNAVQALIDKHQRIPGNIMSALLERF 323          
BLAST of Transmembrane protein 68 vs. Ensembl Human
Match: TMEM68 (transmembrane protein 68 [Source:HGNC Symbol;Acc:HGNC:26510])

HSP 1 Score: 140.584 bits (353), Expect = 7.368e-38
Identity = 81/167 (48.50%), Postives = 105/167 (62.87%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADR 1561
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L  +  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE  R L  G   +  LYEK R P   +YG FP KLRTY+GDPI PY+ +  AE  A++
Sbjct:   21 IDFYYFMAKIF--IHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-RSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVPIIPMFTQNIREGFRSLG-GTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGDPI-PYDPQITAEELAEK 182          
BLAST of Transmembrane protein 68 vs. Ensembl Human
Match: TMEM68 (transmembrane protein 68 [Source:HGNC Symbol;Acc:HGNC:26510])

HSP 1 Score: 105.531 bits (262), Expect = 5.492e-26
Identity = 56/115 (48.70%), Postives = 73/115 (63.48%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVL 1408
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L  +  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE  R L
Sbjct:   21 IDFYYFMAKIF--IHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-RSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVPIIPMFTQNIREGFRSL 132          
BLAST of Transmembrane protein 68 vs. Ensembl Human
Match: TMEM68 (transmembrane protein 68 [Source:HGNC Symbol;Acc:HGNC:26510])

HSP 1 Score: 102.834 bits (255), Expect = 6.536e-24
Identity = 54/110 (49.09%), Postives = 71/110 (64.55%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIRE 1393
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L  +  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE
Sbjct:  135 IDFYYFMAKIF--IHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-RSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVPIIPMFTQNIRE 241          
BLAST of Transmembrane protein 68 vs. Ensembl Celegans
Match: Y38C1AA.1 (pep chromosome:WBcel235:IV:210957:217390:1 gene:WBGene00021394.1 transcript:Y38C1AA.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38C1AA.1)

HSP 1 Score: 173.326 bits (438), Expect = 8.294e-48
Identity = 91/193 (47.15%), Postives = 127/193 (65.80%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQN-YNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIY-PYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY++  L+ +    +R   CV D+F+F +PG+R L      T G++E C + L E N +L ++PGGVREALFSD N Y+ILWGKRLGFAK+ + +K PV PMFTEN RE  R  + G+SF+  +YEKT+IPL  +YG FP K+ T++G PIY  ++    E     VK+ I  +I E Q LPG++ R +AQR+
Sbjct:  119 YYLISKLVIH---KNRSLHCVGDKFIFKIPGWRPLCKLFSITSGTVEECTEELKEGN-LLCIAPGGVREALFSDPNVYDILWGKRLGFAKVIIGSKTPVIPMFTENCRESFRTPEWGRSFFRWIYEKTKIPLCPIYGGFPVKMITHLGKPIYFDFDTVTPEEVRKTVKREIRMMIKEHQRLPGSVWRGIAQRW 307          
BLAST of Transmembrane protein 68 vs. Ensembl Celegans
Match: Y38C1AA.1 (pep chromosome:WBcel235:IV:210957:217002:1 gene:WBGene00021394.1 transcript:Y38C1AA.1d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38C1AA.1)

HSP 1 Score: 173.326 bits (438), Expect = 8.918e-48
Identity = 91/193 (47.15%), Postives = 127/193 (65.80%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQN-YNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIY-PYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY++  L+ +    +R   CV D+F+F +PG+R L      T G++E C + L E N +L ++PGGVREALFSD N Y+ILWGKRLGFAK+ + +K PV PMFTEN RE  R  + G+SF+  +YEKT+IPL  +YG FP K+ T++G PIY  ++    E     VK+ I  +I E Q LPG++ R +AQR+
Sbjct:  119 YYLISKLVIH---KNRSLHCVGDKFIFKIPGWRPLCKLFSITSGTVEECTEELKEGN-LLCIAPGGVREALFSDPNVYDILWGKRLGFAKVIIGSKTPVIPMFTENCRESFRTPEWGRSFFRWIYEKTKIPLCPIYGGFPVKMITHLGKPIYFDFDTVTPEEVRKTVKREIRMMIKEHQRLPGSVWRGIAQRW 307          
BLAST of Transmembrane protein 68 vs. Ensembl Celegans
Match: Y38C1AA.1 (pep chromosome:WBcel235:IV:208189:217390:1 gene:WBGene00021394.1 transcript:Y38C1AA.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38C1AA.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.176e-47
Identity = 91/193 (47.15%), Postives = 127/193 (65.80%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQN-YNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIY-PYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY++  L+ +    +R   CV D+F+F +PG+R L      T G++E C + L E N +L ++PGGVREALFSD N Y+ILWGKRLGFAK+ + +K PV PMFTEN RE  R  + G+SF+  +YEKT+IPL  +YG FP K+ T++G PIY  ++    E     VK+ I  +I E Q LPG++ R +AQR+
Sbjct:  140 YYLISKLVIH---KNRSLHCVGDKFIFKIPGWRPLCKLFSITSGTVEECTEELKEGN-LLCIAPGGVREALFSDPNVYDILWGKRLGFAKVIIGSKTPVIPMFTENCRESFRTPEWGRSFFRWIYEKTKIPLCPIYGGFPVKMITHLGKPIYFDFDTVTPEEVRKTVKREIRMMIKEHQRLPGSVWRGIAQRW 328          
BLAST of Transmembrane protein 68 vs. Ensembl Celegans
Match: Y38C1AA.1 (pep chromosome:WBcel235:IV:208189:217399:1 gene:WBGene00021394.1 transcript:Y38C1AA.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y38C1AA.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.224e-47
Identity = 91/193 (47.15%), Postives = 127/193 (65.80%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQN-YNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIY-PYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY++  L+ +    +R   CV D+F+F +PG+R L      T G++E C + L E N +L ++PGGVREALFSD N Y+ILWGKRLGFAK+ + +K PV PMFTEN RE  R  + G+SF+  +YEKT+IPL  +YG FP K+ T++G PIY  ++    E     VK+ I  +I E Q LPG++ R +AQR+
Sbjct:  140 YYLISKLVIH---KNRSLHCVGDKFIFKIPGWRPLCKLFSITSGTVEECTEELKEGN-LLCIAPGGVREALFSDPNVYDILWGKRLGFAKVIIGSKTPVIPMFTENCRESFRTPEWGRSFFRWIYEKTKIPLCPIYGGFPVKMITHLGKPIYFDFDTVTPEEVRKTVKREIRMMIKEHQRLPGSVWRGIAQRW 328          
BLAST of Transmembrane protein 68 vs. Ensembl Fly
Match: CG34348 (gene:FBgn0085377 transcript:FBtr0112557)

HSP 1 Score: 160.229 bits (404), Expect = 1.681e-43
Identity = 81/182 (44.51%), Postives = 120/182 (65.93%), Query Frame = 2
Query: 1115 RIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPY-ENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDK 1657
            R+   + DRFLF LPG+ T+ +  H +PG+++ CV +L + N +L +SPGGV EA F D  Y +LW  R+GFAK+A+ AK P+ P FT+N+RE  R + + ++F+  LY K RIP+  +YG FP K RTY+G PI PY EN   +    +V  +IE+LI++ Q LPG+I+ ++  R P F +
Sbjct:  137 RLIYTIGDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRDGN-LLAISPGGVYEAQFGDHYYELLWRNRVGFAKVAIEAKAPIIPCFTQNLREGFRQVGIFRTFFMRLYNKVRIPVYPIYGGFPVKFRTYLGKPI-PYDENLTPQDLQIKVATAIEDLINQHQRLPGSILLALLDRLPTFRR 316          
BLAST of Transmembrane protein 68 vs. Ensembl Zebrafish
Match: tmem68 (transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE-040426-1267])

HSP 1 Score: 159.844 bits (403), Expect = 3.808e-43
Identity = 87/192 (45.31%), Postives = 127/192 (66.15%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY + T+I       R    V D FLF +PGF+ LL+      G  E CVK L     +L +SPGGVREALFSD+ Y +LWGKR GFA++A+ +K PV PMFT+N+RE  R L   + F+  +YE+ R+P+  +YG FP K RT++GDPI PY+ + +A   A++V+++++ LI + Q +PGNI+R++ +RF
Sbjct:  139 YYFLATVIIQ---KGRTCHSVADHFLFKVPGFKLLLEVFSVIHGPQEECVKAL-RNGHLLGISPGGVREALFSDETYPLLWGKRKGFAQVAIDSKVPVIPMFTQNLREGFRSLGTLR-FFRWVYERFRLPVAPIYGGFPVKFRTFLGDPI-PYDPKLNAAELAEKVQQAVQALIDKHQKIPGNILRALLERF 324          
BLAST of Transmembrane protein 68 vs. Ensembl Zebrafish
Match: tmem68 (transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE-040426-1267])

HSP 1 Score: 159.844 bits (403), Expect = 3.808e-43
Identity = 87/192 (45.31%), Postives = 127/192 (66.15%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY + T+I       R    V D FLF +PGF+ LL+      G  E CVK L     +L +SPGGVREALFSD+ Y +LWGKR GFA++A+ +K PV PMFT+N+RE  R L   + F+  +YE+ R+P+  +YG FP K RT++GDPI PY+ + +A   A++V+++++ LI + Q +PGNI+R++ +RF
Sbjct:  139 YYFLATVIIQ---KGRTCHSVADHFLFKVPGFKLLLEVFSVIHGPQEECVKAL-RNGHLLGISPGGVREALFSDETYPLLWGKRKGFAQVAIDSKVPVIPMFTQNLREGFRSLGTLR-FFRWVYERFRLPVAPIYGGFPVKFRTFLGDPI-PYDPKLNAAELAEKVQQAVQALIDKHQKIPGNILRALLERF 324          
BLAST of Transmembrane protein 68 vs. Ensembl Xenopus
Match: slc26a1 (solute carrier family 26 (anion exchanger), member 1 [Source:Xenbase;Acc:XB-GENE-1012013])

HSP 1 Score: 164.466 bits (415), Expect = 1.073e-44
Identity = 90/191 (47.12%), Postives = 120/191 (62.83%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY V  +I       R    V D FLF +PGF+ LLD      G  E CVK L+ +  +L +SPGGVREALFSD++Y ++WGKR GFA++A+ AK P+ PMFT+N+RE  R L  G   +  +YE+ +IPLV +YG FP K RTY+GDPI    N  A   A + K +I  LI + Q +PGNI R++ +RF
Sbjct:  138 YYFVAKVILR---KGRTCHSVGDHFLFKIPGFKPLLDLFGVIHGPKEECVKALT-SGHLLAVSPGGVREALFSDESYTLMWGKRTGFAQVAIDAKVPIIPMFTQNVREGFRSLG-GLWLFRWIYERFKIPLVPIYGGFPVKFRTYLGDPIQYDPNITAVELAQKTKCAIHSLIEKHQKVPGNIFRALLERF 323          
BLAST of Transmembrane protein 68 vs. Ensembl Mouse
Match: Tmem68 (transmembrane protein 68 [Source:MGI Symbol;Acc:MGI:1919348])

HSP 1 Score: 161.384 bits (407), Expect = 1.303e-43
Identity = 90/194 (46.39%), Postives = 122/194 (62.89%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L  +  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE  R L  G   +  LYEK R P   +YG FP KLRT++GDPI PY+ +  AE  A++ K +++ LI + Q +PGNI  ++  RF
Sbjct:  134 IDFYYFMAKIF--IQKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-RSGHLLAISPGGVREALLSDETYNIIWGNRKGFAQVAIDAKVPIIPMFTQNIREGFRSLG-GTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPI-PYDPKVTAEELAEKTKNAVQALIDKHQRIPGNIRSALLDRF 322          
BLAST of Transmembrane protein 68 vs. UniProt/SwissProt
Match: sp|Q0VCR6|TMM68_BOVIN (Transmembrane protein 68 OS=Bos taurus OX=9913 GN=TMEM68 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 5.520e-44
Identity = 91/194 (46.91%), Postives = 125/194 (64.43%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L ++  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE  R L  G   +  LYEK R P   +YG FP KLRTY+GDPI PY+ +  AE  A++ K +++ LI + Q +PGNI+ ++ +RF
Sbjct:  135 IDFYYFMAKIF--IHKGRTCRVVADHFVFKIPGFSLLLDVFCAIHGPREKCVEIL-QSGHLLAISPGGVREALMSDETYNIVWGNRKGFAQVAIDAKVPIIPMFTQNIREGFRSLG-GTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGDPI-PYDPKITAEELAEKTKDAVQALIDKHQRIPGNIMSALLERF 323          
BLAST of Transmembrane protein 68 vs. UniProt/SwissProt
Match: sp|Q96MH6|TMM68_HUMAN (Transmembrane protein 68 OS=Homo sapiens OX=9606 GN=TMEM68 PE=2 SV=2)

HSP 1 Score: 163.696 bits (413), Expect = 9.059e-44
Identity = 91/194 (46.91%), Postives = 124/194 (63.92%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L  +  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE  R L  G   +  LYEK R P   +YG FP KLRTY+GDPI PY+ +  AE  A++ K +++ LI + Q +PGNI+ ++ +RF
Sbjct:  135 IDFYYFMAKIF--IHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-RSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVPIIPMFTQNIREGFRSLG-GTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGDPI-PYDPQITAEELAEKTKNAVQALIDKHQRIPGNIMSALLERF 323          
BLAST of Transmembrane protein 68 vs. UniProt/SwissProt
Match: sp|Q9D850|TMM68_MOUSE (Transmembrane protein 68 OS=Mus musculus OX=10090 GN=Tmem68 PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 9.116e-43
Identity = 90/194 (46.39%), Postives = 122/194 (62.89%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            I++Y  +  IF      R    V D F+F +PGF  LLD   A  G  E CV++L  +  +L +SPGGVREAL SD+ YNI+WG R GFA++A+ AK P+ PMFT+NIRE  R L  G   +  LYEK R P   +YG FP KLRT++GDPI PY+ +  AE  A++ K +++ LI + Q +PGNI  ++  RF
Sbjct:  134 IDFYYFMAKIF--IQKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-RSGHLLAISPGGVREALLSDETYNIIWGNRKGFAQVAIDAKVPIIPMFTQNIREGFRSLG-GTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPI-PYDPKVTAEELAEKTKNAVQALIDKHQRIPGNIRSALLDRF 322          
BLAST of Transmembrane protein 68 vs. UniProt/SwissProt
Match: sp|Q5ZJD8|TMM68_CHICK (Transmembrane protein 68 OS=Gallus gallus OX=9031 GN=TMEM68 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 5.025e-42
Identity = 80/173 (46.24%), Postives = 116/173 (67.05%), Query Frame = 2
Query: 1127 CVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYE-NEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
             V D F+F LPG +  ++ +    G  E CV  L +   +L +SPGGVREALFSD+ Y I+WG R GFA++A+ AK P+ PMFT+N+RE IR L  G   +  LYE+ R+P+V +YG+FP K RT++G+PI PY+ N  AE    + K +++ LI + Q +PGNI+R++ +RF
Sbjct:  156 VVADHFVFRLPGLKMFIEVLGVMHGPKEVCVSALKK-GYLLAISPGGVREALFSDETYAIMWGNRKGFAQVAIDAKVPIIPMFTQNVREGIRTLG-GIKIFRKLYERIRLPIVPMYGWFPVKFRTFIGEPI-PYDPNITAEELTAKTKAALQALITKHQKIPGNILRALMERF 325          
BLAST of Transmembrane protein 68 vs. TrEMBL
Match: A0A5K3FL51 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 2.055e-64
Identity = 113/225 (50.22%), Postives = 141/225 (62.67%), Query Frame = 2
Query: 1130 VVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLL----------------------------------SETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDKWF-----HNYYQSKR 1687
            VVDRFLF LPG +T+L    A  GS++ CV LL                                  S   EVLLLSPGGVREALFSD+ Y++LWGKR GFA+IA+ AKKP+YP+FTENIRE IRV+Q GKS+W  +YE TR+P+   YGYFP KLRTY+GDP+YP E E  E  ADR +++IE +I   Q  PGNI+ ++ QRFP+FD W       NY+  +R
Sbjct:    1 VVDRFLFRLPGLQTILRLTCAIEGSVDECVALLNPRLAKANSSRHRDEAVVGRDAAATNGDPRVEGSSGGGEVLLLSPGGVREALFSDEYYSVLWGKRRGFARIAINAKKPIYPVFTENIREGIRVVQYGKSWWRRIYEVTRLPIAIFYGYFPVKLRTYIGDPVYPREGETDEQLADRAREAIEGMISRYQWRPGNIIVALLQRFPWFDAWVQSRNAQNYHSRRR 225          
BLAST of Transmembrane protein 68 vs. TrEMBL
Match: A0A094ZLH2 (Transmembrane protein 68 OS=Schistosoma haematobium OX=6185 GN=MS3_01959 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.227e-63
Identity = 109/210 (51.90%), Postives = 144/210 (68.57%), Query Frame = 2
Query: 1112 SRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLS----------ETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDKW--------FHNYYQSKR 1687
             R P+ VVDRFLF +PG   LL+ + A  GS++ CV  L              +VLL+SPGGVREALFSD+ Y ++W  R GFA+I+LL+ +P+YPMFTENIRE IR++Q GK +W +LYE+TR+PL   YGYFP KLRTY+GDPIYP  NE ++  A RV+ SIEELI   Q++P N+  ++ QRFP FD+W        FH+Y+Q +R
Sbjct:  223 DRFPVPVVDRFLFRVPGLGRLLETIGAIKGSVDECVAHLQPGHILKNGKVSQGDVLLISPGGVREALFSDEFYTVMWENRRGFARISLLSGQPIYPMFTENIRETIRIVQFGKGWWRSLYERTRLPLAIFYGYFPVKLRTYIGDPIYPLPNETSDELASRVRISIEELISRHQLIPANLFCAIMQRFPVFDRWLTKYKLKLFHHYHQHQR 432          
BLAST of Transmembrane protein 68 vs. TrEMBL
Match: A0A4S2LR72 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006998 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.589e-63
Identity = 106/214 (49.53%), Postives = 143/214 (66.82%), Query Frame = 2
Query: 1109 NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNE----------------VLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDKWFHNYYQSKRPPIKS 1702
            + R PI VVDRFLF LPG + +LD + A  G++E C   L+ +                  VLLL+PGGVREALF+D++Y  +WGKR GFAK+ALLAK+P+YPMFTENIRE IRV+Q+GKS+W  LYE+TR+P    YGYFP KLRTY+G+PIYP E E  E  A+R + +I+++I E Q  P N+  ++ QR P FD+W     + ++  + S
Sbjct:  176 HDRFPIAVVDRFLFRLPGMKYVLDLVGAIEGTVEQCAAYLNPSMRDERTAMRLNDDNPNGCVLLLAPGGVREALFADESYCTIWGKRNGFAKVALLAKQPIYPMFTENIRESIRVVQMGKSWWCRLYERTRLPFALFYGYFPVKLRTYIGEPIYPLEGETPEELAERTRMAIDQMISEYQWTPANLFCALLQRIPAFDRWLERRKRQRQIDVDS 389          
BLAST of Transmembrane protein 68 vs. TrEMBL
Match: C1L465 (Transmembrane protein 68 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 3.220e-63
Identity = 106/208 (50.96%), Postives = 144/208 (69.23%), Query Frame = 2
Query: 1115 RIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSE----------TNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDKWFHNYYQSKRPPIKSKT 1708
            R P+ VVDRF+F +PG   LL+ + A  GS++ CV  L +            +VLL+SPGGVREALFSD+ Y ++W  R GFA+I+LL+ +P+YPMFTENIRE IR++Q GK +W +LYE+TR+PL   YGYFP KLRTY+GDPIYP  NE ++  A+RV+ SIEELI E Q++P N+  ++ QRFP FD W   +  S+    + +T
Sbjct:  193 RFPVPVVDRFVFRVPGLGRLLETIGAIKGSVDECVAHLQQGRILKNGKVSQGDVLLISPGGVREALFSDEFYTVMWENRRGFARISLLSGQPIYPMFTENIRETIRIVQFGKGWWRSLYERTRLPLAIFYGYFPVKLRTYIGDPIYPLPNETSDELANRVRVSIEELIREHQLIPSNLFCAIMQRFPVFDCWLTKHKHSRSSQHQRRT 400          
BLAST of Transmembrane protein 68 vs. TrEMBL
Match: Q5DDI2 (SJCHGC08974 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 5.867e-63
Identity = 106/208 (50.96%), Postives = 143/208 (68.75%), Query Frame = 2
Query: 1115 RIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLS----------ETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDKWFHNYYQSKRPPIKSKT 1708
            R P+ VVDRF+F +PG   LL+ + A  GS++ CV  L              +VLL+SPGGVREALFSD+ Y ++W  R GFA+I+LL+ +P+YPMFTENIRE IR++Q GK +W +LYE+TR+PL   YGYFP KLRTY+GDPIYP  NE ++  A+RV+ SIEELI E Q++P N+  ++ QRFP FD W   +  S+    + +T
Sbjct:  193 RFPVPVVDRFVFRVPGLGRLLETIGAIKGSVDECVAHLQPGRILKNGKVSQGDVLLISPGGVREALFSDEFYTVMWENRRGFARISLLSGQPIYPMFTENIRETIRIVQFGKGWWRSLYERTRLPLAIFYGYFPVKLRTYIGDPIYPLPNETSDELANRVRVSIEELIREHQLIPSNLFCAIMQRFPVFDCWLTKHKHSRSSQHQRRT 400          
BLAST of Transmembrane protein 68 vs. Ensembl Cavefish
Match: tmem68 (transmembrane protein 68 [Source:NCBI gene;Acc:103025502])

HSP 1 Score: 158.688 bits (400), Expect = 8.015e-43
Identity = 87/191 (45.55%), Postives = 124/191 (64.92%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENE-DAESFADRVKKSIEELIHEKQILPGNIVRSVAQR 1639
            YY + +LI       R    V D FLF +PGF+ LL+      G  E CVK L  +  +L +SPGGVREALFSD+ Y ++WGKR GFA++A+ +K P+ PMFT+N+RE  R L   K F+  LYE+ R+P+  +YG FP K RTY+GDPI PY+ +  A   A++V+ +++ LI   Q +PGNI+R++ +R
Sbjct:  139 YYFLASLIIQ---KGRTCHSVADHFLFKVPGFKLLLEVFSVIHGPQEECVKAL-RSGHLLGISPGGVREALFSDETYPLVWGKRKGFAQVAIDSKVPIIPMFTQNVREGFRSLGTLK-FFRWLYERFRLPIAPVYGGFPVKFRTYLGDPI-PYDPKLTAAELAEKVQAAVQALIDRHQKVPGNILRALLER 323          
BLAST of Transmembrane protein 68 vs. Ensembl Cavefish
Match: TMEM68 (transmembrane protein 68-like [Source:NCBI gene;Acc:103047292])

HSP 1 Score: 147.902 bits (372), Expect = 3.614e-39
Identity = 74/173 (42.77%), Postives = 110/173 (63.58%), Query Frame = 2
Query: 1130 VVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPY 1648
            V D  LF +PGFR LL+      G  E CV+ L +   +L +SPGGVREAL SD  Y + WGKR GFA++A+ ++ P+ PMFT+N+RE  R L   + F+  +YE+ R+P+  +YG FP K  T++G PI    N  A   A++V+ ++  LI E Q +PG+I+R++ +RF +
Sbjct:  125 VADHILFKMPGFRLLLEVFSVIHGPREECVRALQD-GHLLGISPGGVREALLSDHTYQLQWGKRTGFAQVAIDSRAPIIPMFTQNVREGFRSLGTLR-FFRWVYERFRVPIAPVYGGFPVKFHTFLGRPILYDPNVTATELAEKVQGALHALIKEHQKIPGSIIRALLERFSH 295          
BLAST of Transmembrane protein 68 vs. Ensembl Cavefish
Match: TMEM68 (transmembrane protein 68-like [Source:NCBI gene;Acc:103047292])

HSP 1 Score: 93.2041 bits (230), Expect = 4.729e-22
Identity = 47/99 (47.47%), Postives = 62/99 (62.63%), Query Frame = 2
Query: 1130 VVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSF 1426
            V D  LF +PGFR LL+      G  E CV+ L +   +L +SPGGVREAL SD  Y + WGKR GFA++A +  +P+ PMFT+N+RE  R L    +F
Sbjct:   41 VADHILFKMPGFRLLLEVFSVIHGPREECVRALQD-GHLLGISPGGVREALLSDHTYQLQWGKRTGFAQVA-IDSRPIIPMFTQNVREGFRSLGTLSNF 137          
BLAST of Transmembrane protein 68 vs. Ensembl Cavefish
Match: TMEM68 (transmembrane protein 68-like [Source:NCBI gene;Acc:103047292])

HSP 1 Score: 75.8702 bits (185), Expect = 1.079e-15
Identity = 42/118 (35.59%), Postives = 65/118 (55.08%), Query Frame = 2
Query: 1064 INYYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAK--KPVYPMFTENIREPIRVLQ 1411
            I+YY  +  +       R    V D  LF +PGFR LL+      G  E CV+ L +   +L +SPGGVREAL SD  Y + WGKR GFA++A+ ++    ++ +  E+ + P  +++
Sbjct:   21 IDYYYFLAKVI--ILKGRTCHSVADHILFKMPGFRLLLEVFSVIHGPREECVRALQD-GHLLGISPGGVREALLSDHTYQLQWGKRTGFAQVAIDSRVQGALHALIKEHQKIPGSIIR 135          
BLAST of Transmembrane protein 68 vs. Ensembl Sea Lamprey
Match: tmem68 (transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE-040426-1267])

HSP 1 Score: 166.392 bits (420), Expect = 1.928e-46
Identity = 90/193 (46.63%), Postives = 125/193 (64.77%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSF-WANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYE-NEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY++ ++I       RI   V D FLF LPGFR LL+      G  E CV++L     +L +SPGG+REALFSD  Y +LWG R GFA++A+ AK P+ P+FT+N+RE  R L     F W  LYE+ R+P+V +YG FP K RTY+GDPI PY+   DA   A++ K++++ LI E Q +PGNI+ ++A+R 
Sbjct:  115 YYLLSSIILT---KGRICYSVADHFLFKLPGFRLLLEVFRVIHGPKEQCVRVLRR-GHLLAISPGGLREALFSDNAYRLLWGNRRGFAQVAIDAKAPIIPVFTQNLREGFRTLGSLCVFRW--LYERCRLPVVPIYGGFPVKFRTYLGDPI-PYDPGTDAAELAEKTKQAMQGLIEEHQDIPGNILHALAERL 300          
BLAST of Transmembrane protein 68 vs. Ensembl Sea Lamprey
Match: tmem68 (transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE-040426-1267])

HSP 1 Score: 130.568 bits (327), Expect = 1.913e-35
Identity = 70/166 (42.17%), Postives = 106/166 (63.86%), Query Frame = 2
Query: 1160 GFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQ----LGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYEN-EDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            GFR LL+      G  E CV++L     +L +SP  +REALF+D  Y +LWG R GFA++A+ AK P+ P+FT+N+RE +R L     + K  W+   EK R+P+V +YG FP K RTY+GDPI PY++   A   A++ K++++ LI E Q +P NI+ ++ ++ 
Sbjct:    1 GFRLLLEVFRVIHGPREQCVRVLRR-GHLLAISPSSLREALFTDNAYRLLWGNRRGFAEVAIDAKVPIIPVFTQNLREGLRTLGSLYYMFKKMWSP--EKCRLPVVPIYGGFPVKFRTYLGDPI-PYDSGTGAAELAEKTKQAMQGLIEEHQDIPRNILHALVEQL 162          
BLAST of Transmembrane protein 68 vs. Ensembl Sea Lamprey
Match: tmem68 (transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE-040426-1267])

HSP 1 Score: 128.257 bits (321), Expect = 1.341e-34
Identity = 67/162 (41.36%), Postives = 102/162 (62.96%), Query Frame = 2
Query: 1160 GFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYEN-EDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            GFR LL+      G  E CV++L     +L +SP  +REALF+D  Y +LWG R GFA++A+ AK P+ P+FT+N+RE +R L     F      + R+P+V +YG FP K RTY+GDPI PY++   A   A++ K++++ LI E Q +P NI+ ++ ++ 
Sbjct:    1 GFRLLLEVFRVIHGPREQCVRVLRR-GHLLAISPSSLREALFTDNAYRLLWGNRRGFAEVAIDAKVPIIPVFTQNLREGLRTLGSLSEFKKMWSPEKRLPVVPIYGGFPVKFRTYLGDPI-PYDSGTGAAELAEKTKQAMQGLIEEHQDIPRNILHALVEQL 160          
BLAST of Transmembrane protein 68 vs. Ensembl Nematostella
Match: EDO44580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVI1])

HSP 1 Score: 154.836 bits (390), Expect = 4.140e-42
Identity = 86/193 (44.56%), Postives = 123/193 (63.73%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSI-EGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYE-NEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY++  LI       R    V   FLF++PG + LL+      G   E C ++L    ++L +SPGGVREALFSD+ Y ++W  R GFAK+AL AK PVYP+FT+N+RE IR ++ G+ F   LYE T++PLV LYG FP K+RT +GDPI PY+     +   + V++ IE+LI+  Q +PG+I+ + A R+
Sbjct:  100 YYIMARLILQ---KKRRLRNVAATFLFYVPGIQLLLEVFGVVEGRTREQCHEILM-NGDLLAISPGGVREALFSDEYYGMIWNSRKGFAKVALAAKVPVYPVFTQNVRECIRTVKTGRGFLRKLYEWTKLPLVPLYGGFPVKMRTIIGDPI-PYDPTLTCDELTETVQQEIEKLIYRYQRIPGSILAAFADRW 287          
BLAST of Transmembrane protein 68 vs. Ensembl Medaka
Match: tmem68 (transmembrane protein 68 [Source:NCBI gene;Acc:101174695])

HSP 1 Score: 152.525 bits (384), Expect = 1.049e-40
Identity = 86/193 (44.56%), Postives = 121/193 (62.69%), Query Frame = 2
Query: 1070 YYMVITLIFN*T*NSRIPICVVDRFLFHLPGFRTLLDFMHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSF-WANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYE-NEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRF 1642
            YY +  +I       R    V D  LF +PGF+ LL+      G  E CV+ L     +L +SPGGVREALFSD+ Y +LW KR GFA++A+ ++ PV PMFT+N+RE  R L   + F W  LYE+ R+P+  +YG FP K RT++GDPI PY+ N  A   A+RVK +++ LI E Q +PG+I+ ++ +RF
Sbjct:  133 YYFLARVILQ---KGRTCHSVADHLLFKIPGFKLLLEVFSVIHGPQEECVRAL-RNGHLLGISPGGVREALFSDETYPLLWSKRRGFAQVAIDSQVPVIPMFTQNVREGFRSLGTLRLFRW--LYERFRLPIAPVYGGFPVKFRTFLGDPI-PYDPNTSAVELAERVKLAVQSLIDEHQQIPGSILCALLERF 318          
BLAST of Transmembrane protein 68 vs. Planmine SMEST
Match: SMESG000019415.1 (SMESG000019415.1)

HSP 1 Score: 363.614 bits (932), Expect = 9.696e-123
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 2
Query: 1184 MHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDKWFHNYYQSKRPPIKSKTK 1711
            MHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDKWFHNYYQSKRPPIKSKTK
Sbjct:    1 MHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFAKIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYFPSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVAQRFPYFDKWFHNYYQSKRPPIKSKTK 176          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 68 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM681.886e-4446.91transmembrane protein 68 [Source:HGNC Symbol;Acc:H... [more]
TMEM681.886e-4446.91transmembrane protein 68 [Source:HGNC Symbol;Acc:H... [more]
TMEM687.368e-3848.50transmembrane protein 68 [Source:HGNC Symbol;Acc:H... [more]
TMEM685.492e-2648.70transmembrane protein 68 [Source:HGNC Symbol;Acc:H... [more]
TMEM686.536e-2449.09transmembrane protein 68 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y38C1AA.18.294e-4847.15pep chromosome:WBcel235:IV:210957:217390:1 gene:WB... [more]
Y38C1AA.18.918e-4847.15pep chromosome:WBcel235:IV:210957:217002:1 gene:WB... [more]
Y38C1AA.11.176e-4747.15pep chromosome:WBcel235:IV:208189:217390:1 gene:WB... [more]
Y38C1AA.11.224e-4747.15pep chromosome:WBcel235:IV:208189:217399:1 gene:WB... [more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG343481.681e-4344.51gene:FBgn0085377 transcript:FBtr0112557[more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem683.808e-4345.31transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE... [more]
tmem683.808e-4345.31transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc26a11.073e-4447.12solute carrier family 26 (anion exchanger), member... [more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tmem681.303e-4346.39transmembrane protein 68 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Transmembrane protein 68 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q0VCR6|TMM68_BOVIN5.520e-4446.91Transmembrane protein 68 OS=Bos taurus OX=9913 GN=... [more]
sp|Q96MH6|TMM68_HUMAN9.059e-4446.91Transmembrane protein 68 OS=Homo sapiens OX=9606 G... [more]
sp|Q9D850|TMM68_MOUSE9.116e-4346.39Transmembrane protein 68 OS=Mus musculus OX=10090 ... [more]
sp|Q5ZJD8|TMM68_CHICK5.025e-4246.24Transmembrane protein 68 OS=Gallus gallus OX=9031 ... [more]
back to top
BLAST of Transmembrane protein 68 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FL512.055e-6450.22Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A094ZLH21.227e-6351.90Transmembrane protein 68 OS=Schistosoma haematobiu... [more]
A0A4S2LR722.589e-6349.53Uncharacterized protein OS=Opisthorchis felineus O... [more]
C1L4653.220e-6350.96Transmembrane protein 68 OS=Schistosoma japonicum ... [more]
Q5DDI25.867e-6350.96SJCHGC08974 protein OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmem688.015e-4345.55transmembrane protein 68 [Source:NCBI gene;Acc:103... [more]
TMEM683.614e-3942.77transmembrane protein 68-like [Source:NCBI gene;Ac... [more]
TMEM684.729e-2247.47transmembrane protein 68-like [Source:NCBI gene;Ac... [more]
TMEM681.079e-1535.59transmembrane protein 68-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem681.928e-4646.63transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE... [more]
tmem681.913e-3542.17transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE... [more]
tmem681.341e-3441.36transmembrane protein 68 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO445804.140e-4244.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 68 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem681.049e-4044.56transmembrane protein 68 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Transmembrane protein 68 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000019415.19.696e-123100.00SMESG000019415.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017566 ID=SMED30017566|Name=Transmembrane protein 68|organism=Schmidtea mediterranea sexual|type=transcript|length=2142bp
TATAATCTCCCGGGTTCGAGGTTGGGGGAGTTGGCAACCCTAATAGTCAA
AATAACTCATGTAATAAGCGTTATAGTAGATATATCACAAATCAATATTA
AATAGCATATTTAGTATAAACAGTACATTTTTACTGGAATGATTACATAT
CATTTTCAACATTAACTCTTCCTGTTGACAGTCTTGGAGGAAAATAAATT
AACATATGTTTAAAGGGTTTCTCAATTTTCTCAATAGGTGTTGCTACCAA
TTTTATAATGTTTTAATTACTTTAAGACTCCGAATGCAAATAATAATAAT
GGGGGCAAGAGTTTAACACTGAAGGCTACGTTTTGGATTTAGATGAATAA
GAAGAGCGTCTGAGAACAAGTATACGAACACTAGGTCTGAGAAACAATTT
GGTTTTCAATGATGACAGATAAAGAATTGTGGTTATTTGACTAGAAGGAT
ATGGGACAAACTGCCAAACCACTCACAGTATTGTAAAAAATACTTATAGA
CTGGAAAAGTATTCCAGAGGAAGGGGAGGGTCTATAGAGGCTTTAAACTT
AGTTTAGAGTTTAAAAAGCAATTGCTCATCTATGTGGATCAATAATTTAC
GTTTACGCCAGTTCAGCTTTCTGCTTGGGTACTAATTCCGCTATTTTACT
GAAAATAATATCACCTCAAAACCGAAAGTTTGAGAGTACAATAGAAATCA
GGAAAACATATGCAATTTGTTATCGTAATCAGGATACGGATAATGACGAA
GAAAGAAGCAGAAAGATTTCAGTGATAGCGGCAATGAATAAATAAAGTAT
GGTTGATCATAAAATTTATGAAAGAGCAGTCAACATCAGACAAATGTTTA
GAATAACAGTAAAGTTTATTAACTTGAAAATCAGTATCTTATTTCAACTC
TTCTTCCTATCCATCATTATCCAAATCTTCGACCATTACTTTCATGTTCA
AAAATAATATTTTTGTAAAATCAGTTTAAGAGATGACTTTCAATTTTTTA
CTTGATCAATAAATTTGAAAAATTTTGGAGCCTAATAAAATCGAATATGT
AGTAACAGAATAAATTAATTATTATATGGTGATTACTTTAATTTTTAATT
AAACTTAAAATTCTAGAATACCGATCTGTGTTGTGGATCGATTTTTATTT
CATTTACCAGGTTTCCGGACATTATTAGACTTTATGCATGCCACTCCTGG
TTCCATAGAAGGTTGTGTTAAACTTTTATCGGAAACTAACGAAGTGTTAT
TATTATCTCCCGGTGGTGTCCGGGAAGCTCTGTTTTCTGATCAAAATTAT
AATATTCTCTGGGGAAAACGTCTTGGATTTGCAAAAATAGCTCTATTAGC
TAAAAAGCCGGTCTATCCAATGTTTACTGAGAATATCCGAGAACCCATAC
GAGTGCTACAATTGGGAAAATCTTTCTGGGCTAATTTGTATGAAAAGACA
AGGATTCCTCTTGTATTTCTTTACGGATATTTCCCATCAAAATTAAGAAC
CTATGTCGGTGATCCAATATATCCATATGAAAATGAAGATGCTGAGAGCT
TTGCAGATAGAGTGAAGAAATCAATAGAGGAACTAATTCATGAAAAGCAA
ATTCTCCCCGGAAATATTGTCCGATCTGTGGCACAGAGATTTCCCTATTT
TGACAAATGGTTTCATAATTATTATCAGTCAAAAAGACCGCCAATCAAAA
GCAAAACCAAATAGTTGAAAAATAAAAATGTTTTGTTTTTTATTTTTAGC
ACATTTTCTGCGTTCTCTGTGATTATGGAAAGAGTTTTGTTTTATTTTTT
AAATGTCGGATAAGGTTATTTGTTATCTCGTTTATCCGTAAAGTTATTGC
TAGTATTTGTTCTTATTTTGCGTTTGTAATTTGTTTTCTGTGTTTGTCTC
AAAAATGTCAATATCAATCCTGTTGATTAATAAATTTTTTATTACCTCAA
GAAATTAATGTATTGTCAGTATTATTGGAGCTAGATGATGCCTATGTTTG
CGGTTAGGAGTGTTTTGTTTTAGTTTTCGAATCATCACTAAATGTCTTCA
TGGCAATTTTACCTTTTCAATCCTTCTACTCATGGCGACTTCCATGTTGG
TAATGTACACGGAGGCTGAAAATCAATGAGCAAACGAGCTCC
back to top

protein sequence of SMED30017566-orf-1

>SMED30017566-orf-1 ID=SMED30017566-orf-1|Name=SMED30017566-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MHATPGSIEGCVKLLSETNEVLLLSPGGVREALFSDQNYNILWGKRLGFA
KIALLAKKPVYPMFTENIREPIRVLQLGKSFWANLYEKTRIPLVFLYGYF
PSKLRTYVGDPIYPYENEDAESFADRVKKSIEELIHEKQILPGNIVRSVA
QRFPYFDKWFHNYYQSKRPPIKSKTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR22753TRANSMEMBRANE PROTEIN 68coord: 2..154
NoneNo IPR availablePANTHERPTHR22753:SF1TRANSMEMBRANE PROTEIN 68coord: 2..154