Ephrin type-B receptor 2

Overview
NameEphrin type-B receptor 2
Smed IDSMED30017565
Length (bp)3625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ephrin type-B receptor 2 (SMED30017565) t-SNE clustered cells

Violin plots show distribution of expression levels for Ephrin type-B receptor 2 (SMED30017565) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ephrin type-B receptor 2 (SMED30017565) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ephrin type-B receptor 2 (SMED30017565) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017565

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017565h1SMcG0013039 SmedASXL_016271SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30017565h1SMcG0013039 Contig49963uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017565h1SMcG0013039 Contig49963newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30017565h1SMcG0013039 dd_Smed_v4_16928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017565h1SMcG0013039 dd_Smed_v4_16928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017565h1SMcG0013039 dd_Smed_v4_16928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30017565h1SMcG0013039 dd_Smed_v4_16928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30017565h1SMcG0013039 dd_Smed_v4_16928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30017565h1SMcG0013039 dd_Smed_v6_16928_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ephrin type-B receptor 2 vs. Ensembl Human
Match: EPHB2 (EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 354/1013 (34.95%), Postives = 538/1013 (53.11%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEAD--SSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDV---------SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFD--KSPINS-----------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEAL-ASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   S++NWLR+ FIRR  A  I +E+ F++R C S P    +C++T  L  YEAD  S++    +W +  + +VD I+ D +++ +     +  +N +  S  P  RSGF++A +D G C  +  +R++Y  CP I    A +   L  +    +   +G C+  AE + +  +  L C   G+W +     C CK G+ ++++  VC  CP  T+K+++G E C +CP  S  +  GA  CVC  G +        + C     +P+ +  +  +   L L W                 + + IIC SC          G +V         ++  + I  L +   Y F + +++ V+    FS   P  A ++I T  A  S    +++ Q ++   S+ +SWS   +   +I                    LD +LQ  +    E+     KSP N+           Y  +VRAR+ + +G +              K +   + E+    S Q KL +II     G + ++  + +   C         NR++         +  + +Y+  H  +   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   +++I VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKFGQI +++  ++R P +L A  PLS  I                        + PLL ++ P +   +++ +WL+ + +  YK++F          + +    D++ + +T   H +K++N+I+ M+   + +QS
Sbjct:   54 NTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIK--LYCNGDGEWLVP-IGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNET-SLMLEWTPPRDSGGRE------DLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFS---PQFASVNITTNQAAPSA--VSIMHQVSRTVDSITLSWSQPDQPNGVI--------------------LDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRY------------SGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVC---------NRRRGFERADSEYTDKLQHYTSGHM-TPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHL-KLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI------------------------NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS 984          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Human
Match: EPHB2 (EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 356/1013 (35.14%), Postives = 540/1013 (53.31%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEAD--SSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDV---------SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFD--KSPINS-----------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEAL-ASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   S++NWLR+ FIRR  A  I +E+ F++R C S P    +C++T  L  YEAD  S++    +W +  + +VD I+ D +++ +     +  +N +  S  P  RSGF++A +D G C  +  +R++Y  CP I    A +   L  +    +   +G C+  AE + +  +  L C   G+W +     C CK G+ ++++  VC  CP  T+K+++G E C +CP  S  +  GA  CVC  G +        + C     +P+ +  +  +   L L W                 + + IIC SC          G +V         ++  + I  L +   Y F + +++ V+    FS   P  A ++I T  A  S    +++ Q ++   S+ +SWS   +   +I                    LD +LQ  +    E+     KSP N+           Y  +VRAR+ + +G +              K +   + E+    S Q KL +II     G + ++  + +   C    NR    R  +  +  ++  L   +Y+  H  +   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   +++I VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKFGQI +++  ++R P +L A  PLS  I                        + PLL ++ P +   +++ +WL+ + +  YK++F          + +    D++ + +T   H +K++N+I+ M+   + +QS
Sbjct:   54 NTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIK--LYCNGDGEWLVP-IGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNET-SLMLEWTPPRDSGGRE------DLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFS---PQFASVNITTNQAAPSA--VSIMHQVSRTVDSITLSWSQPDQPNGVI--------------------LDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRY------------SGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVC----NR----RGFERADSEYTDKLQ--HYTSGHM-TPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHL-KLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI------------------------NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS 983          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Human
Match: EPHB2 (EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393])

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 355/1013 (35.04%), Postives = 541/1013 (53.41%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEAD--SSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDV---------SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFD--KSPINS-----------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   S++NWLR+ FIRR  A  I +E+ F++R C S P    +C++T  L  YEAD  S++    +W +  + +VD I+ D +++ +     +  +N +  S  P  RSGF++A +D G C  +  +R++Y  CP I    A +   L  +    +   +G C+  AE + +  +  L C   G+W +     C CK G+ ++++  VC  CP  T+K+++G E C +CP  S  +  GA  CVC  G +        + C     +P+ +  +  +   L L W                 + + IIC SC          G +V         ++  + I  L +   Y F + +++ V+    FS   P  A ++I T  A  S    +++ Q ++   S+ +SWS   +   +I                    LD +LQ  +    E+     KSP N+           Y  +VRAR+ + +G +              K +   + E+    S Q KL +II     G + ++  + +   C    NR    R  +  +  ++  L   +Y+  H  +   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   +++I VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKFGQI +++  ++R P +L ++ PLS  I                        + PLL ++ P +   +++ +WL+ + +  YK++F          + +    D++ + +T   H +K++N+I+ M+   + +QS
Sbjct:   54 NTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIK--LYCNGDGEWLVP-IGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNET-SLMLEWTPPRDSGGRE------DLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFS---PQFASVNITTNQAAPSA--VSIMHQVSRTVDSITLSWSQPDQPNGVI--------------------LDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRY------------SGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVC----NR----RGFERADSEYTDKLQ--HYTSGHM-TPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHL-KLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI------------------------NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS 983          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Human
Match: EPHA4 (EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 345/993 (34.74%), Postives = 531/993 (53.47%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSE---------QLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSAL-LSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R+ A  + IEI FT+R C S P     C++T  L  YE+D+  D      +  + ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CV+ +E   +   P++ C   G+W +     C C  G+     +  C  C    YK+      C  CP +SYS   GA  C C+ G F   + +  + C  P  +P NL  N  +   + L W +               + + ++C  C   +          + +TP  + +  + V I  L +   Y F + +++ VS      + NP  ++ +++ T  A  S     LV  K   + S+ ++W      +  I+ YEV  ++   N    ++    ++  ++K          +P+ SY   VRAR+ + +G F    ++   + V  +    G + +   +S    ++++ +    F++                    +R++   +K    + +  + +Q        R Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI + +  L+R P         +S+ R   +S R N++++  S              P F    S+  WL  + +  YKDNF       L  +   ++ DL  + IT   H  K++++++AM+     +  
Sbjct:   69 TYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDN--DKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGHEERSGE--CQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNET-SVNLEWSSPQNTGGRQ------DISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKY----NPNPDQSVSVTVTTNQAAPSS--IALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIK--------GLNPLTSYVFHVRARTAAGYGDFSEPLEVT-TNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVI--------------------SRRRSKYSKAKQEADEEKHLNQ------GVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNP---------NSLKRTGTESSRPNTALLDPSS-------------PEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMHG 981          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Human
Match: EPHA4 (EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 345/993 (34.74%), Postives = 531/993 (53.47%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSE---------QLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSAL-LSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R+ A  + IEI FT+R C S P     C++T  L  YE+D+  D      +  + ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CV+ +E   +   P++ C   G+W +     C C  G+     +  C  C    YK+      C  CP +SYS   GA  C C+ G F   + +  + C  P  +P NL  N  +   + L W +               + + ++C  C   +          + +TP  + +  + V I  L +   Y F + +++ VS      + NP  ++ +++ T  A  S     LV  K   + S+ ++W      +  I+ YEV  ++   N    ++    ++  ++K          +P+ SY   VRAR+ + +G F    ++   + V  +    G + +   +S    ++++ +    F++                    +R++   +K    + +  + +Q        R Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI + +  L+R P         +S+ R   +S R N++++  S              P F    S+  WL  + +  YKDNF       L  +   ++ DL  + IT   H  K++++++AM+     +  
Sbjct:   69 TYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDN--DKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGHEERSGE--CQACKIGYYKALSTDATCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNET-SVNLEWSSPQNTGGRQ------DISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVSKY----NPNPDQSVSVTVTTNQAAPSS--IALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIK--------GLNPLTSYVFHVRARTAAGYGDFSEPLEVT-TNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVI--------------------SRRRSKYSKAKQEADEEKHLNQ------GVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNP---------NSLKRTGTESSRPNTALLDPSS-------------PEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQEDLARIGITAITHQNKILSSVQAMRTQMQQMHG 981          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Celegans
Match: vab-1 (Ephrin receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:O61460])

HSP 1 Score: 323.168 bits (827), Expect = 1.362e-92
Identity = 159/340 (46.76%), Postives = 207/340 (60.88%), Query Frame = 2
Query: 1997 YSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIK-----------------------YEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTL---QLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREI--EADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIP 2932
            Y  +H  S   + Y+DP+ YEDP   + EF  +I P  + I  VIG GEFG+VC G L K                       YE      VAIKTLKSG S K +  FL EA IMGQF H N+I+L G+VT  +P+MI+ +++  GSLD FLR    +   +   ++  ML GI SGMKYL++M YVHRDLAARN+L+D +L CK++DFGLSR +  E  + E  YTT GG IP+RWTAPEAI +R+FT SSDVWSFG+V+WEV S+GERPYW+W N+ V+  +  GYRLP P  CP  ++ +   CW  ER ERP F Q+  +    +  P  +   P
Sbjct:  654 YGGVHPNSGKYKTYVDPTTYEDPYQALIEFTFDISPNDVFITQVIGGGEFGDVCLGGLSKNSPAAAKWSVSNTTMGRGGGGGGYESEPYETVAIKTLKSGSSAKAKAEFLTEATIMGQFSHPNVIRLIGVVTSAEPVMIVAEYMANGSLDQFLRNTDQRGEKVHWEKITEMLYGIASGMKYLTDMGYVHRDLAARNVLLDMELRCKIADFGLSRGVRSEGSSVEPEYTTNGGKIPVRWTAPEAITHRKFTPSSDVWSFGVVIWEVCSFGERPYWDWTNQKVISEVMIGYRLPPPMDCPMGLYRIAQWCWKMERHERPTFTQLLATFHKYILQPTLIEHDP 993          

HSP 2 Score: 91.2781 bits (225), Expect = 3.513e-18
Identity = 122/492 (24.80%), Postives = 189/492 (38.41%), Query Frame = 2
Query:  332 QLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDI--ISPDI-TWTDM----RQDENIVN-VKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVIS-HDFRIRNVKGICVD-------GAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSL-DSKMV-CIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFPIKSSSDLIS--CAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPG-PDVSQSSVLIDALESGKTYKFSVTSMSSVS-HLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEV---IIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAW 1732
            Q  Y  C     +  NWL S FI    A  I IE+ F  R C +    + +C++T  + + +  +S   P S      T+++    S DI  W ++    R + N+        I+       IA  + G C  +  ++IYY  C   T     +   V    +  +  + G C+        G +LI L       C  TG   I     C C  GY+ + DS    C  CP NTYK  +G   C  CP  S S   A  C C  G F  ++  +LIS  C +P   P  L  N       +LSW+    +          ++ + + C    +   +  TPG   +S  SV I+ L     Y F V + + VS     FS  N   A++ I T+  ++ +   + +   A     + I+WS+   D +    EV   I+ K +    H            V   +  F    +P   Y+ +VR R    W
Sbjct:   77 QRAYVTCNYDMINPSNWLFSHFIEVKTARRIYIELLFNTRDCDAYLNPK-SCKETFSVYLKQFKTSR--PGS------TKIEKERFSEDIDNWKNIGRLARSNSNMTTETLGMEIDSDTKTIRIAFEEQGICLSLLNVKIYYRICDEFTDQLVYFRPQVTGPKETDMVRMNGSCIPNASKKIPGVDLIGL-------CMSTGS-GIKTSGECVCDSGYSQIADSNGARCESCPTNTYKP-KGQSLCKSCPSNSISSEAASSCRCLNGYF--RAEDELISMPCTQPPSRPIKLVANAITATSTRLSWNEPSSLGGRP------EIWYEVKCSGRGECGTVVMTPGDKKLSTRSVQINGLRPSSDYTFLVFAKNKVSAQFPEFSEKN---AVIDIRTRSEEEDVPPVSHLRVDASQSDGITIAWSVSDSDVSDFEVEVRPAIVKKRTFETRH------------VNMTYTTF-IGLNPETVYQFRVRIRDDLRW 526          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Celegans
Match: vab-1 (Ephrin receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:O61460])

HSP 1 Score: 317.005 bits (811), Expect = 1.655e-90
Identity = 159/345 (46.09%), Postives = 207/345 (60.00%), Query Frame = 2
Query: 1997 YSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIK-----------------------YEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTL---QLLGMLRGIVSGMKYLSEMRYVHR-----DLAARNILVDKDLCCKVSDFGLSREI--EADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIP 2932
            Y  +H  S   + Y+DP+ YEDP   + EF  +I P  + I  VIG GEFG+VC G L K                       YE      VAIKTLKSG S K +  FL EA IMGQF H N+I+L G+VT  +P+MI+ +++  GSLD FLR    +   +   ++  ML GI SGMKYL++M YVHR     DLAARN+L+D +L CK++DFGLSR +  E  + E  YTT GG IP+RWTAPEAI +R+FT SSDVWSFG+V+WEV S+GERPYW+W N+ V+  +  GYRLP P  CP  ++ +   CW  ER ERP F Q+  +    +  P  +   P
Sbjct:  654 YGGVHPNSGKYKTYVDPTTYEDPYQALIEFTFDISPNDVFITQVIGGGEFGDVCLGGLSKNSPAAAKWSVSNTTMGRGGGGGGYESEPYETVAIKTLKSGSSAKAKAEFLTEATIMGQFSHPNVIRLIGVVTSAEPVMIVAEYMANGSLDQFLRNTDQRGEKVHWEKITEMLYGIASGMKYLTDMGYVHRVSFLRDLAARNVLLDMELRCKIADFGLSRGVRSEGSSVEPEYTTNGGKIPVRWTAPEAITHRKFTPSSDVWSFGVVIWEVCSFGERPYWDWTNQKVISEVMIGYRLPPPMDCPMGLYRIAQWCWKMERHERPTFTQLLATFHKYILQPTLIEHDP 998          

HSP 2 Score: 91.2781 bits (225), Expect = 2.848e-18
Identity = 122/492 (24.80%), Postives = 189/492 (38.41%), Query Frame = 2
Query:  332 QLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDI--ISPDI-TWTDM----RQDENIVN-VKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVIS-HDFRIRNVKGICVD-------GAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSL-DSKMV-CIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFPIKSSSDLIS--CAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPG-PDVSQSSVLIDALESGKTYKFSVTSMSSVS-HLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEV---IIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAW 1732
            Q  Y  C     +  NWL S FI    A  I IE+ F  R C +    + +C++T  + + +  +S   P S      T+++    S DI  W ++    R + N+        I+       IA  + G C  +  ++IYY  C   T     +   V    +  +  + G C+        G +LI L       C  TG   I     C C  GY+ + DS    C  CP NTYK  +G   C  CP  S S   A  C C  G F  ++  +LIS  C +P   P  L  N       +LSW+    +          ++ + + C    +   +  TPG   +S  SV I+ L     Y F V + + VS     FS  N   A++ I T+  ++ +   + +   A     + I+WS+   D +    EV   I+ K +    H            V   +  F    +P   Y+ +VR R    W
Sbjct:   77 QRAYVTCNYDMINPSNWLFSHFIEVKTARRIYIELLFNTRDCDAYLNPK-SCKETFSVYLKQFKTSR--PGS------TKIEKERFSEDIDNWKNIGRLARSNSNMTTETLGMEIDSDTKTIRIAFEEQGICLSLLNVKIYYRICDEFTDQLVYFRPQVTGPKETDMVRMNGSCIPNASKKIPGVDLIGL-------CMSTGS-GIKTSGECVCDSGYSQIADSNGARCESCPTNTYKP-KGQSLCKSCPSNSISSEAASSCRCLNGYF--RAEDELISMPCTQPPSRPIKLVANAITATSTRLSWNEPSSLGGRP------EIWYEVKCSGRGECGTVVMTPGDKKLSTRSVQINGLRPSSDYTFLVFAKNKVSAQFPEFSEKN---AVIDIRTRSEEEDVPPVSHLRVDASQSDGITIAWSVSDSDVSDFEVEVRPAIVKKRTFETRH------------VNMTYTTF-IGLNPETVYQFRVRIRDDLRW 526          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Celegans
Match: src-2 (Tyrosine protein-kinase src-2 [Source:UniProtKB/Swiss-Prot;Acc:O45539])

HSP 1 Score: 222.246 bits (565), Expect = 2.322e-62
Identity = 114/304 (37.50%), Postives = 180/304 (59.21%), Query Frame = 2
Query: 1964 KTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAH--EIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKF 2869
            + F+T  D+  + Q  A      +    +  E P T    +    E+D   +++   IG G+FGEV  G+     +   +PVA+K LK+G ++    +FL EA IM +  H  ++ L  + T+ +PI+I+T+ ++  +L TFL+++  Q    QL+ +   + +GM YL EM ++HRDLAARNIL++  L  K++DFGL+R +  +N   A T  G   PI+WTAPEA NY RFT+ SDVWSFGI++ E++++G  PY    N +VLQ +++GYR+P P  CP  ++ +M  CW  +  +RP F
Sbjct:  189 RPFATLHDLIAHYQREADGLCVNLGAPCAKSEAPQTTTFTYDDQWEVDRRSVRLIRQIGAGQFGEVWEGR-----WNVNVPVAVKKLKAGTADP--TDFLAEAQIMKKLRHPKLLSLYAVCTRDEPILIVTELMQ-ENLLTFLQRRGRQCQMPQLVEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARILMKENEYEART--GARFPIKWTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCPAGCPVTLYDIMQQCWRSDPDKRPTF 482          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 201.06 bits (510), Expect = 7.077e-55
Identity = 107/284 (37.68%), Postives = 162/284 (57.04%), Query Frame = 2
Query: 2051 NYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKK-KYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISAL 2899
            + ED +++ +     I    I +   IG GEFG+V   +L  Y+ R+   VA+K  K         + L EA  M    H N++ L G+V     + +IT+++  G+L   LR + ++     QL+     I  GM YL   + VHRDLAARN+L+D DL  KVSDFGL+++  + + + A     G  PI+WTAPEA+ + +FT+ SDVWSFGI++WE+ S+G  PY   P +DV++ IE GYR+ AP+ CPP I  +M + W     +RP FGQ+   ++ +
Sbjct:  263 DLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDV---RLGTYKNRK---VALKVSKRH-GNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSA----SGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQRLTTI 535          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 201.06 bits (510), Expect = 7.077e-55
Identity = 107/284 (37.68%), Postives = 162/284 (57.04%), Query Frame = 2
Query: 2051 NYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKK-KYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISAL 2899
            + ED +++ +     I    I +   IG GEFG+V   +L  Y+ R+   VA+K  K         + L EA  M    H N++ L G+V     + +IT+++  G+L   LR + ++     QL+     I  GM YL   + VHRDLAARN+L+D DL  KVSDFGL+++  + + + A     G  PI+WTAPEA+ + +FT+ SDVWSFGI++WE+ S+G  PY   P +DV++ IE GYR+ AP+ CPP I  +M + W     +RP FGQ+   ++ +
Sbjct:  263 DLEDRTSVFRHAGLVISSNDIDVGDTIGHGEFGDV---RLGTYKNRK---VALKVSKRH-GNGMLDSLLDEAKFMVGLSHPNLVTLVGVVLDDVNVYMITEYMANGNLIDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKKANSQSHDSA----SGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQRLTTI 535          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089083)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 358/1002 (35.73%), Postives = 522/1002 (52.10%), Query Frame = 2
Query:  341 YGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRI-RNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVH----FRIICISCKDSEQLFFTPGPDV-SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSI-DTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQ-------NVKTPFYE---FP------FDKSPINS---------------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMN 3223
            Y +C +   + +NWL SPFI R  A  + IEI FT+R C   P   L+C++T  L+ YE D+++  P  W    Y  +  I+      +   D +I N +  SI   + G + A RD GAC  V  +++YY+ CP++T  FA ++      +  I     G CVD AE     + P  +C+  G+W I     C CK GY    +   C +CP  T+KS   + KC  CP  S  S  G+  C C  G +   +    + C  P  +P NL   F D+    +SW A    +S  S  NS   H    ++I C  C  S  + + P  D  +++ + +  LE   TY   + +++SVSH+  F   +  S+L+++ D   ++ SL    L + + +  ++             + + E ++  +  N     + N D+ L+       +    FYE   FP       +KS +N+               Y  +VR ++ + +G +  S  I  + L  +          + Y  S     I      G + ++I I    Y  ++ ++   +  KK+ N      LD A+          +R Y+DP  YEDP+  ++EFA EID   I IE +IG GEFG+VCRG+L I   + Q I VAIKTLK G SEK R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F TLQL+ MLRGI SGM YLS+M YVHRDLAARN+LV+  L CK++DFGLSREIE  N   AYTT+GG IP+RWTAPEAI +R+FTS+SDVWS+G+V+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP A++ LMLDCW  +R+ RP F  I  ++  L R P++L +  P   S G   +D  R  +  I                        S   WL+ + +  Y  +F + +LI    I + +   L  + IT   H +K+++
Sbjct:   96 YVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNAEPY---ETPTYLCKGDGKWTILTGG-CRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNIC--SPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQA-----------EIVFTTESVLLSTVFNLRILAITNKDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALNTKETKAHIVGLLENTEYGFQVRCKTNNGFGSY--SNMIYAQTLQSV---------GSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVY--FMRSKHQDDLDKKSTNH-LPLPLDYASNEVTTPLFGNSRSYVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIE--NASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFI------------------------STDLWLEHIKMSRYCHHFKEANLINAQQISRLTAQQLSDMGITLVGHQKKILH 1038          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089082)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 358/1002 (35.73%), Postives = 522/1002 (52.10%), Query Frame = 2
Query:  341 YGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRI-RNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVH----FRIICISCKDSEQLFFTPGPDV-SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSI-DTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQ-------NVKTPFYE---FP------FDKSPINS---------------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMN 3223
            Y +C +   + +NWL SPFI R  A  + IEI FT+R C   P   L+C++T  L+ YE D+++  P  W    Y  +  I+      +   D +I N +  SI   + G + A RD GAC  V  +++YY+ CP++T  FA ++      +  I     G CVD AE     + P  +C+  G+W I     C CK GY    +   C +CP  T+KS   + KC  CP  S  S  G+  C C  G +   +    + C  P  +P NL   F D+    +SW A    +S  S  NS   H    ++I C  C  S  + + P  D  +++ + +  LE   TY   + +++SVSH+  F   +  S+L+++ D   ++ SL    L + + +  ++             + + E ++  +  N     + N D+ L+       +    FYE   FP       +KS +N+               Y  +VR ++ + +G +  S  I  + L  +          + Y  S     I      G + ++I I    Y  ++ ++   +  KK+ N      LD A+          +R Y+DP  YEDP+  ++EFA EID   I IE +IG GEFG+VCRG+L I   + Q I VAIKTLK G SEK R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F TLQL+ MLRGI SGM YLS+M YVHRDLAARN+LV+  L CK++DFGLSREIE  N   AYTT+GG IP+RWTAPEAI +R+FTS+SDVWS+G+V+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP A++ LMLDCW  +R+ RP F  I  ++  L R P++L +  P   S G   +D  R  +  I                        S   WL+ + +  Y  +F + +LI    I + +   L  + IT   H +K+++
Sbjct:  129 YVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNAEPY---ETPTYLCKGDGKWTILTGG-CRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNIC--SPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQA-----------EIVFTTESVLLSTVFNLRILAITNKDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALNTKETKAHIVGLLENTEYGFQVRCKTNNGFGSY--SNMIYAQTLQSV---------GSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVY--FMRSKHQDDLDKKSTNH-LPLPLDYASNEVTTPLFGNSRSYVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIE--NASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFI------------------------STDLWLEHIKMSRYCHHFKEANLINAQQISRLTAQQLSDMGITLVGHQKKILH 1071          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089086)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 358/1002 (35.73%), Postives = 522/1002 (52.10%), Query Frame = 2
Query:  341 YGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRI-RNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVH----FRIICISCKDSEQLFFTPGPDV-SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSI-DTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQ-------NVKTPFYE---FP------FDKSPINS---------------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMN 3223
            Y +C +   + +NWL SPFI R  A  + IEI FT+R C   P   L+C++T  L+ YE D+++  P  W    Y  +  I+      +   D +I N +  SI   + G + A RD GAC  V  +++YY+ CP++T  FA ++      +  I     G CVD AE     + P  +C+  G+W I     C CK GY    +   C +CP  T+KS   + KC  CP  S  S  G+  C C  G +   +    + C  P  +P NL   F D+    +SW A    +S  S  NS   H    ++I C  C  S  + + P  D  +++ + +  LE   TY   + +++SVSH+  F   +  S+L+++ D   ++ SL    L + + +  ++             + + E ++  +  N     + N D+ L+       +    FYE   FP       +KS +N+               Y  +VR ++ + +G +  S  I  + L  +          + Y  S     I      G + ++I I    Y  ++ ++   +  KK+ N      LD A+          +R Y+DP  YEDP+  ++EFA EID   I IE +IG GEFG+VCRG+L I   + Q I VAIKTLK G SEK R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F TLQL+ MLRGI SGM YLS+M YVHRDLAARN+LV+  L CK++DFGLSREIE  N   AYTT+GG IP+RWTAPEAI +R+FTS+SDVWS+G+V+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP A++ LMLDCW  +R+ RP F  I  ++  L R P++L +  P   S G   +D  R  +  I                        S   WL+ + +  Y  +F + +LI    I + +   L  + IT   H +K+++
Sbjct:  129 YVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNAEPY---ETPTYLCKGDGKWTILTGG-CRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNIC--SPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQA-----------EIVFTTESVLLSTVFNLRILAITNKDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALNTKETKAHIVGLLENTEYGFQVRCKTNNGFGSY--SNMIYAQTLQSV---------GSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVY--FMRSKHQDDLDKKSTNH-LPLPLDYASNEVTTPLFGNSRSYVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIE--NASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFI------------------------STDLWLEHIKMSRYCHHFKEANLINAQQISRLTAQQLSDMGITLVGHQKKILH 1071          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089084)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 360/1018 (35.36%), Postives = 527/1018 (51.77%), Query Frame = 2
Query:  341 YGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRI-RNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVH----FRIICISCKDSEQLFFTPGPDV-SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSI-DTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQ-------NVKTPFYE---FP------FDKSPINS---------------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMAN-----------YSQIHAGSST-----TRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMN 3223
            Y +C +   + +NWL SPFI R  A  + IEI FT+R C   P   L+C++T  L+ YE D+++  P  W    Y  +  I+      +   D +I N +  SI   + G + A RD GAC  V  +++YY+ CP++T  FA ++      +  I     G CVD AE     + P  +C+  G+W I     C CK GY    +   C +CP  T+KS   + KC  CP  S  S  G+  C C  G +   +    + C  P  +P NL   F D+    +SW A    +S  S  NS   H    ++I C  C  S  + + P  D  +++ + +  LE   TY   + +++SVSH+  F   +  S+L+++ D   ++ SL    L + + +  ++             + + E ++  +  N     + N D+ L+       +    FYE   FP       +KS +N+               Y  +VR ++ + +G +  S  I  + L  +          + Y  S     I      G + ++I I    Y  ++ ++   +  KK+ N      LD A+             ++H   +T     +R Y+DP  YEDP+  ++EFA EID   I IE +IG GEFG+VCRG+L I   + Q I VAIKTLK G SEK R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F TLQL+ MLRGI SGM YLS+M YVHRDLAARN+LV+  L CK++DFGLSREIE  N   AYTT+GG IP+RWTAPEAI +R+FTS+SDVWS+G+V+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP A++ LMLDCW  +R+ RP F  I  ++  L R P++L +  P   S G   +D  R  +  I                        S   WL+ + +  Y  +F + +LI    I + +   L  + IT   H +K+++
Sbjct:  129 YVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNAEPY---ETPTYLCKGDGKWTILTGG-CRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNIC--SPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQA-----------EIVFTTESVLLSTVFNLRILAITNKDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALNTKETKAHIVGLLENTEYGFQVRCKTNNGFGSY--SNMIYAQTLQSV---------GSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVY--FMRSKHQDDLDKKSTNH-LPLPLDYASNEVNSMDTTPIVKKLHLNVTTPLFGNSRSYVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIE--NASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFI------------------------STDLWLEHIKMSRYCHHFKEANLINAQQISRLTAQQLSDMGITLVGHQKKILH 1087          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Fly
Match: Eph (gene:FBgn0025936 transcript:FBtr0089085)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 348/942 (36.94%), Postives = 502/942 (53.29%), Query Frame = 2
Query:  341 YGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRI-RNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVH----FRIICISCKDSEQLFFTPGPDV-SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSI-DTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQ-------NVKTPFYE---FP------FDKSPINS---------------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMAN-----------YSQIHAGSST-----TRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIIS 2995
            Y +C +   + +NWL SPFI R  A  + IEI FT+R C   P   L+C++T  L+ YE D+++  P  W    Y  +  I+      +   D +I N +  SI   + G + A RD GAC  V  +++YY+ CP++T  FA ++      +  I     G CVD AE     + P  +C+  G+W I     C CK GY    +   C +CP  T+KS   + KC  CP  S  S  G+  C C  G +   +    + C  P  +P NL   F D+    +SW A    +S  S  NS   H    ++I C  C  S  + + P  D  +++ + +  LE   TY   + +++SVSH+  F   +  S+L+++ D   ++ SL    L + + +  ++             + + E ++  +  N     + N D+ L+       +    FYE   FP       +KS +N+               Y  +VR ++ + +G +  S  I  + L  +          + Y  S     I      G + ++I I    Y  ++ ++   +  KK+ N      LD A+             ++H   +T     +R Y+DP  YEDP+  ++EFA EID   I IE +IG GEFG+VCRG+L I   + Q I VAIKTLK G SEK R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F TLQL+ MLRGI SGM YLS+M YVHRDLAARN+LV+  L CK++DFGLSREIE  N   AYTT+GG IP+RWTAPEAI +R+FTS+SDVWS+G+V+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP A++ LMLDCW  +R+ RP F  I  ++  L R P++L +  P   S G   +D  R  +  IS
Sbjct:  129 YVVCDVAYHNVNNWLWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFDAATREPPPWQTDSYRLIARIAAGEGRFNQNSDVDI-NTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAVTENFAHFNETPTGREITIIEKQNGTCVDNAEPY---ETPTYLCKGDGKWTILTGG-CRCKAGYEPNYTNKTCTECPLGTFKSPEVT-KCTPCPPNSNASKTGSPFCKCASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIYHSDIVYKIKCNIC--SPNVVYNPSTDTFNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSNESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQA-----------EIVFTTESVLLSTVFNLRILAITNKDADLEWDKPVQSDFPLEFYEVRWFPKVELDAINKSALNTKETKAHIVGLLENTEYGFQVRCKTNNGFGSY--SNMIYAQTLQSV---------GSVYDDSVQIRFIAGAIVTGVLFLVIFIIATVY--FMRSKHQDDLDKKSTNH-LPLPLDYASNEVNSMDTTPIVKKLHLNVTTPLFGNSRSYVDPHTYEDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDIDVAIKTLKPGSSEKARCDFLTEASIMGQFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDTFLRVNDGKFQTLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSREIE--NASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLTTRPSPESDGNHILDGQRGQNIFIS 1035          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Zebrafish
Match: epha4a (eph receptor A4a [Source:NCBI gene;Acc:64271])

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 373/1051 (35.49%), Postives = 561/1051 (53.38%), Query Frame = 2
Query:  185 ILISVFSIVNCRV--PNYVELLNTETSRWN-DWVKNSGKYDGWRSQNIPPNAQL---VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPR------RSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQ--------LFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSAL-LSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQ 3262
            I I  F++   RV  PN V LL++ T +    WV  S    GW   +I          Y +C +   S++NWLR+ +I R  A  + IEI FT+R C S P     C++T  L  YE  S++D      +  +T++D I+ D ++T +   + I+ + T   E R      R GF++A +D+GAC  +  +RI+Y  CP      A++       D   +  V+G CVD +E   +   P++ C   G+W +     C C PGY   + +  C  C    Y++      C  CP +SYS   G+  C C++G F  ++    + C +P  +P++L  N  +   + L W A               + + +IC  C    Q        + F+P    +  + V I+ L++   Y F + +++ VS      S  P  A+ +++ T  A  S   T  +  K   + ++ ++W      +  I+ YEV  ++   N    ++    S+   +K          SP+ SY   VRAR+ + +G F    +     +      DG          + + ++++SV G   IL+LI I +    R    RS  ++ K++ ++             +H G    RIY+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII+LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+G+LRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D  + AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP ++H LMLDCW  ER+ERPKF QI + +  L+R P         +S+ R   +  R N++++ E     F ST             S++ WL  +++  Y+DNF          +   ++ D+  + I+   H  K++N+ + M +    +Q
Sbjct:   14 IWIPTFALT-ARVYPPNEVTLLDSRTVQGELKWVA-SPTEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWIPRGGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYE--SNNDKERYIRENQFTKIDTIAADESFTQVDIGDRIMKLNT---EVRDVGILTRKGFYLAFQDVGACIALVSVRIFYKKCPLTVRNLAQFPDTTTGADTSSLVEVRGSCVDNSEEREV---PKMYCGADGEWLVP-IGNCLCNPGYE--EHEGTCQACKIGNYRALATDGSCSKCPLHSYSVREGSTSCACDKGFFRSETDPASMPCTQPPSAPQHLISNVNET-SVNLEWTAPASSGGRQ------DLAYNVICKRCSSDGQRCQPCGNGIHFSPQQLGLRTTRVSINDLQAHTNYTFEIWAVNGVSK----QSPGPEQAVSVTVTTNQAAPSPVTT--IQAKDITRHAVSLAWQQPERPNGVILEYEVKYYEKDQNERSYRIMKTSSRSAEIK--------GLSPLTSYVFHVRARTAAGYGEFSAPFEFMTNSVPSPIIGDG----------ANSTVLLVSVIG-SVILLLIFIGVFIISR---RRSKYSKAKQDSDEE----------RHLHPG---VRIYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGIGEFGEVCSGRL-KMPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIRLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGILRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEED-PDAAYTTRGGKIPIRWTAPEAITYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPVSLHQLMLDCWQKERAERPKFSQIVNMLDKLIRNP---------NSLKRTGGEIARPNTTLL-EPSSPEFTST-----------LGSVADWLQAINMERYRDNFTAAGYTTPEAVVHMTQEDMTRIGISTAAHQDKILNSAQGMLSQMQQMQ 980          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Zebrafish
Match: ephb2a (eph receptor B2a [Source:ZFIN;Acc:ZDB-GENE-070713-2])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 358/1002 (35.73%), Postives = 557/1002 (55.59%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADS--SSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLD-MANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEAL-ASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   +++NW+R+ +IRR  A  I +E+ F++R C S P+   +C++T  L  +E+DS  ++ V  +W +  + +VD I+ D +++ +     +  +N +  S  P  RSGF++A +D GAC  +  ++++Y  CP I    A +   L  +    + + +G CV   E + +  +  L C   G+W +     C CK G+ S+D+  +C  CP  ++K+S+G ++C+ CP  S  S  GA  CVC  G +   S    + C     +P+ +  +  ++  L+L WD                V + IIC SC           + + F P    +++  + I  L +   Y F + +++ VS    +S   P    ++I T  A  S    +++ Q ++   S+ +SWS   + +  I+ YE+  ++ +    +S +    +    ++            I  Y  +VRAR+ + +G F  S ++  + + +        +E N+ L  Q KL +II     G + ++  + L   C            ++  ++T S   D + +Y+  H  S   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L +   +++I VAIKTLKSG +EK+R +FL EA+IMGQF H NII LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL +M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTSSSDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKF QI +++  ++R P +L A+ PLS  +                     H    PLL +S P F   S++ +WLD + +  YK+NF    L     + + + +D++ + +T   H +K++N+++ M+   + +QS
Sbjct:   83 NTIRTYQVCNVFDANQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPKVPGSCKETFNLYYFESDSDTATKVYPAWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGACMSLIAVKVFYRKCPRIIRNGAIFQETLSGAESTSLVSARGTCVPNGEEVDVPIK--LYCNGDGEWLVP-IGRCVCKAGHESVDNGTMCKACPFGSFKASQGDQQCLQCPINSRTSSEGATSCVCRNGYYRTDSDPLQMPCTTVPSAPQRVISS-VNETSLRLEWDVPKESGGRE------DVVYNIICKSCGSGRGACTRCGDNVQFVPRQLGLTEPRIHISDLLAHTQYTFEIQAVNGVSDQSPYS---PQFTAVNITTNQAAPSA--VSIMHQVSRAVDSITLSWSQPDQPNGVILDYELQYYEKNAVESNSSLLRSQTNTAVIRG------LKSGTI--YVFQVRARTVAGFGRF--SGKMYFQTMTE--------EEYNSSL--QEKLPLIIGSAAAGVVFLIAVVVLIIVC-----------NRRGSDRTDSEYTDKLQHYTSGHM-SPGMKIYIDPFTYEDPNEAVREFAKEIDVTCVKIEQVIGAGEFGEVCSGNL-RLPGKREILVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNIIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLCDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSSSDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNTLDKMIRNPGSLKATTPLSSGV---------------------HL---PLLDRSTPDFSSFSTVDEWLDAIKMSQYKENFANEDLTTFEAVSQMTMDDILRVGVTLAGHQKKILNSVQMMRAQMNQIQS 1012          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Zebrafish
Match: epha4b (eph receptor A4b [Source:ZFIN;Acc:ZDB-GENE-030826-6])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 370/1033 (35.82%), Postives = 554/1033 (53.63%), Query Frame = 2
Query:  227 NYVELLNTETSRWNDWVKNSGKYDGWRS------QNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSW--NDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPR------RSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRI------ICISCKDSEQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCF-----YCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQ 3241
            N V LL+T  S   D    +   +GW        +N P  +   Y +C +   S++NWLR+  I R+ A  + IEI FT+R C S P     C++T  +  YE+++    P+ W   +  Y ++D I+ D ++T     + ++ + T   E R      + GF++A +D+GAC  +  +R++Y  CP      A++   V   D  +  V+G CV+ +E     + P++ C   G W +     C CKPG+   ++K  C  C   TYK+S     C  CP +S+S    A +C C +G +        ++C  P  +P N      D   + L W            + ++ +H R       IC  C  S  + F P    +S   VLI  L S   Y FSV +++ VS L    S  P   L++++   +    Q  N+++++ ++K S+ ++W      +  I+ YEVI ++ +    +  V      +  V+           P  +Y  +VRAR+   +G +    +I L+             E    +   N+  I++V   G I++LI +  CF     +C Y+  +   + +K          +   N      GS   R YI P  YEDP+  V++FA EID   I+IE VIG GEFGEVC G+L K   +++I VAIK+LK+G SEK+R +FL EA+IMGQF H NII+LEG+VT+ +P+MIIT+++E GSLDTFL+K   QF+ +QL+GM+RGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFGLSR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEV+SYGERPYW   N+DV+++I+ GYRLPAP  CP  +H LMLDCW   RSERPKFGQI +++  L+R P +L  +                NSS+  +     F+              S++ +WLD +++  YKDNF     + L  I   S  +L  +++T   H +K+++ ++++ 
Sbjct:   30 NEVTLLDT-MSALGDLGWEAYPAEGWEEISVMDERNTPMRS---YQVCNVMEASQNNWLRTRHIAREGAQRVYIEIKFTLRDCNSLPGVPGTCKETFNMYYYESNN----PNLWFIKESQYIKIDTIAADESFTQTDVGDRVMKLNT---EIRDINNLSKKGFYLAFQDVGACIALVSLRVFYKKCPLAVLNLAQFPDTVTGGDSALVEVRGSCVNDSEEF---EAPRMYCSGDGGWLVP-IGRCVCKPGFE--ENKDYCQACRPGTYKASSMDAYCSKCPPHSFSHQEKASECSCEKGFYRADMDPRSMACTRPPSAPENPISTLNDT-SVTLEWSPPRDSGGRG--DVTYSIHCRKCAGDGRICSPC--SNNVHFVPRQFGLSIPKVLITDLLSNTNYTFSVEAVNGVSDL----SPTPKQ-LVTVNITTS----QTVNVILKERKSKDSITLAWQGPDRPNGVIVEYEVIYYEKNQRDQNYTVLKTKGHMMTVE--------GLKPGTTYVFRVRARTDGGYGNY--GGEIELETS----------HEDMLAIGDPNQSTILAVSIAGGIVLLIFLVACFVVSGRHCGYIKAKQDPDEEK----------MQFQNGRVKLPGS---RTYIHPHTYEDPNQAVRDFAKEIDASTIRIERVIGAGEFGEVCSGRL-KLPSKREIYVAIKSLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTRCKPVMIITEYMENGSLDTFLKKHDGQFTVIQLVGMMRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVISYGERPYWEMSNQDVIKAIDEGYRLPAPMDCPVVLHQLMLDCWEKSRSERPKFGQIVNTLDKLIRNPNSLKELA---------------NSSVWEDPTTPEFSV-------------STVDEWLDAINMGQYKDNFANAGYVSLDSILYISMCELSKMDVTLVGHQKKILSAVQSLH 968          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Zebrafish
Match: epha4a (eph receptor A4a [Source:NCBI gene;Acc:64271])

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 371/1059 (35.03%), Postives = 559/1059 (52.79%), Query Frame = 2
Query:  185 ILISVFSIVNCRV--PNYVELLNTETSRWN-DWVKNSGKYDGWRSQNIPPNAQL---VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPR------RSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQ--------LFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSAL-LSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEAD--------NTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQ 3262
            I I  F++   RV  PN V LL++ T +    WV  S    GW   +I          Y +C +   S++NWLR+ +I R  A  + IEI FT+R C S P     C++T  L  YE  S++D      +  +T++D I+ D ++T +   + I+ + T   E R      R GF++A +D+GAC  +  +RI+Y  CP      A++       D   +  V+G CVD +E   +   P++ C   G+W +     C C PGY   + +  C  C    Y++      C  CP +SYS   G+  C C++G F  ++    + C +P  +P++L  N  +   + L W A               + + +IC  C    Q        + F+P    +  + V I+ L++   Y F + +++ VS      S  P  A+ +++ T  A  S   T  +  K   + ++ ++W      +  I+ YEV  ++   N    ++    S+   +K          SP+ SY   VRAR+ + +G F    +     +      DG          + + ++++SV G   IL+LI I +    R    RS  ++ K++ ++             +H G    RIY+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII+LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+G+LRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D           G Y ++GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP ++H LMLDCW  ER+ERPKF QI + +  L+R P         +S+ R   +  R N++++ E     F ST             S++ WL  +++  Y+DNF          +   ++ D+  + I+   H  K++N+ + M +    +Q
Sbjct:   14 IWIPTFALT-ARVYPPNEVTLLDSRTVQGELKWVA-SPTEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWIPRGGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYE--SNNDKERYIRENQFTKIDTIAADESFTQVDIGDRIMKLNT---EVRDVGILTRKGFYLAFQDVGACIALVSVRIFYKKCPLTVRNLAQFPDTTTGADTSSLVEVRGSCVDNSEEREV---PKMYCGADGEWLVP-IGNCLCNPGYE--EHEGTCQACKIGNYRALATDGSCSKCPLHSYSVREGSTSCACDKGFFRSETDPASMPCTQPPSAPQHLISNVNET-SVNLEWTAPASSGGRQ------DLAYNVICKRCSSDGQRCQPCGNGIHFSPQQLGLRTTRVSINDLQAHTNYTFEIWAVNGVSK----QSPGPEQAVSVTVTTNQAAPSPVTT--IQAKDITRHAVSLAWQQPERPNGVILEYEVKYYEKDQNERSYRIMKTSSRSAEIK--------GLSPLTSYVFHVRARTAAGYGEFSAPFEFMTNSVPSPIIGDG----------ANSTVLLVSVIG-SVILLLIFIGVFIISR---RRSKYSKAKQDSDEE----------RHLHPG---VRIYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGIGEFGEVCSGRL-KMPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIRLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGILRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEEDPDAAYTTREITGTYQSQGGKIPIRWTAPEAITYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPVSLHQLMLDCWQKERAERPKFSQIVNMLDKLIRNP---------NSLKRTGGEIARPNTTLL-EPSSPEFTST-----------LGSVADWLQAINMERYRDNFTAAGYTTPEAVVHMTQEDMTRIGISTAAHQDKILNSAQGMLSQMQQMQ 989          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Zebrafish
Match: ephb2b (eph receptor B2b [Source:ZFIN;Acc:ZDB-GENE-050522-415])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 357/1001 (35.66%), Postives = 551/1001 (55.04%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPS--SWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEAL-ASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   +++NW+R+ +IRR  A  I +E+ F++R C S P    +C++T  L  YE+DS +   +   W +  + +VD I+ D +++ +     +  +N +  S  P  R+GF++A +D G C  +  +R++Y  CP      A +   L  +    +   +G+C+  AE + +  +  L C   G+W +     C CK G+ ++++  VC  CP   +K+++G EKC+ CP  S  ++ GA  CVC  G +   S    + C     +P+N+  +  ++  L L W+                V + IIC SC           + + F P    +++S V I  L +   Y F + +++ VS    +S   P    ++I T  A  S    +++ Q ++   S+ +SWS   + +  I+ YE+  ++      +S +    +    ++           P   Y  +VRAR+ + +G +  S ++  + + +        +E NT  S Q KL +II     G + ++  + +   C    NR    R  +  +  ++  L   +Y+  H  S   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   ++++ VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI SGMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKF QI +++  ++R P +L A  PLS  +                     H    PLL +S P F   SS+  WLD + +  YKDNF   +      + + +  D++ + +T   H +K++N+++ M+   + +QS
Sbjct:   36 NTIRTYQVCNVFDANQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPRVPGSCKETFNLYYYESDSDTATKTFPPWMENPWIKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVRVFYRKCPRTIRNGAIFQETLSGAESTSLVAARGVCIPNAEEVDVPIK--LYCNGDGEWMVP-IGRCMCKAGHEAVENGTVCRACPSGFFKTAQGDEKCLQCPINSRTTNDGATNCVCRNGYYRTDSDPLEMPCTTVPSAPQNVISS-VNETSLMLEWNPPRETGGRD------DVVYNIICKSCGGGRGGCTRCGDNVQFIPRQLGLTESRVFISDLLAHTQYTFEIQAVNGVSDQSPYS---PQYTSVNITTNQAAPST--VSIMHQVSRTIDSITLSWSQPDQPNGVILDYELQYYEKDQTEHNSSMVKSQTNTAVIR--------GLKPGGIYVFQVRARTVAGFGRY--SGKMYFQTMTE--------EEYNT--SIQEKLPLIIGSAAAGLVFLIAVVVIIIVC----NR----RGFERADSEYTDKLQ--HYTSGHM-SPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGNL-KLPGKREMFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIASGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNNLDKMIRNPNSLKAMTPLSSGV---------------------HL---PLLDRSVPDFSSFSSVDDWLDAIKMGQYKDNFANGNFTSFDLVSQMTMEDILRVGVTLAGHQKKILNSVQMMRAQMNQIQS 965          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Xenopus
Match: epha4 (EPH receptor A4 [Source:NCBI gene;Acc:100216124])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 348/992 (35.08%), Postives = 529/992 (53.33%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKD--------SEQLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQ-KAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R  A  + +EI FT+R C S P     C++T  L  YE  S++D      +  Y ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CVD +E   +   P++ C   G+W +     C C  G+   +    C  C    YK+      C  CP +SY+   G+  C C+ G F   +    + C  P  +P+NL  N  +   + L W                 V + ++C  C             + ++P  + +  + V I  L++   Y F V +++ VS        NP        T   +Q+   T   +Q K   + S+ ++W      +  I+ YEV  ++   N    ++    S+  ++K          +P+ +Y   VRAR+ + +G F    +     +      +G          +   ++++SV G   +L++I I      R    RS  ++ K+  ++             ++ G  T   Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI   +  L+R P         +S+ R  +D+ R N++++  S              P +   +S+  WL  + +  YKDNF       L  +   +++DL  + I+ P H  K++++++ M+     +Q 
Sbjct:   51 TYQVCNVMESSQNNWLRTDWIPRSGAQRVYVEIKFTLRDCNSLPGVMGTCKETFNLYYYE--SNNDKERFIRETQYVKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGSDTSSLVEVRGSCVDNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGFEERNGG--CQACKVGYYKALSTDAACSKCPPHSYALREGSTSCTCDRGYFRADTDPASMPCTRPPSAPQNLISNVNET-SVNLEWSPPQNSGGRP------DVTYNLVCKRCGSDLTRCRPCGSGVHYSPQQNGLKTTKVSITDLQAHTNYTFEVWAINGVSK------QNPGQDQAVSVTVTTNQAAPSTVTQIQPKEITRHSVSLTWPEPERANGVILEYEVKYYEKDQNERSYRIVKTASRSADIK--------GLNPLTAYVFHVRARTAAGYGEFSGPFEFTTNTVPSPMIGEG----------ASPTVLLVSVAG-SIVLVVILIAAFVISR---RRSKYSKAKQEADEE----------KHLNQGVKT---YVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREIYVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVSMLDKLIRNP---------NSLKRTGLDNSRTNTALLDPSS-------------PEWSQVASVLDWLQAIKMERYKDNFTAAGYTSLEAVVHVNQDDLTRIGISSPSHQNKILSSVQGMRTQMQQMQG 962          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Xenopus
Match: epha4 (EPH receptor A4 [Source:NCBI gene;Acc:100216124])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 348/992 (35.08%), Postives = 529/992 (53.33%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKD--------SEQLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQ-KAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R  A  + +EI FT+R C S P     C++T  L  YE  S++D      +  Y ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CVD +E   +   P++ C   G+W +     C C  G+   +    C  C    YK+      C  CP +SY+   G+  C C+ G F   +    + C  P  +P+NL  N  +   + L W                 V + ++C  C             + ++P  + +  + V I  L++   Y F V +++ VS        NP        T   +Q+   T   +Q K   + S+ ++W      +  I+ YEV  ++   N    ++    S+  ++K          +P+ +Y   VRAR+ + +G F    +     +      +G          +   ++++SV G   +L++I I      R    RS  ++ K+  ++             ++ G  T   Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI   +  L+R P         +S+ R  +D+ R N++++  S              P +   +S+  WL  + +  YKDNF       L  +   +++DL  + I+ P H  K++++++ M+     +Q 
Sbjct:   41 TYQVCNVMESSQNNWLRTDWIPRSGAQRVYVEIKFTLRDCNSLPGVMGTCKETFNLYYYE--SNNDKERFIRETQYVKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGSDTSSLVEVRGSCVDNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGFEERNGG--CQACKVGYYKALSTDAACSKCPPHSYALREGSTSCTCDRGYFRADTDPASMPCTRPPSAPQNLISNVNET-SVNLEWSPPQNSGGRP------DVTYNLVCKRCGSDLTRCRPCGSGVHYSPQQNGLKTTKVSITDLQAHTNYTFEVWAINGVSK------QNPGQDQAVSVTVTTNQAAPSTVTQIQPKEITRHSVSLTWPEPERANGVILEYEVKYYEKDQNERSYRIVKTASRSADIK--------GLNPLTAYVFHVRARTAAGYGEFSGPFEFTTNTVPSPMIGEG----------ASPTVLLVSVAG-SIVLVVILIAAFVISR---RRSKYSKAKQEADEE----------KHLNQGVKT---YVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREIYVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVSMLDKLIRNP---------NSLKRTGLDNSRTNTALLDPSS-------------PEWSQVASVLDWLQAIKMERYKDNFTAAGYTSLEAVVHVNQDDLTRIGISSPSHQNKILSSVQGMRTQMQQMQG 952          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Xenopus
Match: epha4 (EPH receptor A4 [Source:NCBI gene;Acc:100216124])

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 348/992 (35.08%), Postives = 525/992 (52.92%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKD--------SEQLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQ-KAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R  A  + +EI FT+R C S P     C++T  L  YE  S++D      +  Y ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CVD +E   +   P++ C   G+W +     C C  G+   +    C  C    YK+      C  CP +SY+   G+  C C+ G F   +    + C  P  +P+NL  N  +   + L W                 V + ++C  C             + ++P  + +  + V I  L++   Y F V +++ VS        NP        T   +Q+   T   +Q K   + S+ ++W      +  I+ YEV  ++   N    ++    S+  ++K          +P+ +Y   VRAR+ + +G F    +     +      +G          +   ++++SV G   +L++I I      R    RS  ++ K+  ++             ++ G  T   Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI   +  L+R P +L    L +S                     +  N+  L  S P +   +S+  WL  + +  YKDNF       L  +   +++DL  + I+ P H  K++++++ M+     +Q 
Sbjct:   69 TYQVCNVMESSQNNWLRTDWIPRSGAQRVYVEIKFTLRDCNSLPGVMGTCKETFNLYYYE--SNNDKERFIRETQYVKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGSDTSSLVEVRGSCVDNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGFEERNGG--CQACKVGYYKALSTDAACSKCPPHSYALREGSTSCTCDRGYFRADTDPASMPCTRPPSAPQNLISNVNET-SVNLEWSPPQNSGGRP------DVTYNLVCKRCGSDLTRCRPCGSGVHYSPQQNGLKTTKVSITDLQAHTNYTFEVWAINGVSK------QNPGQDQAVSVTVTTNQAAPSTVTQIQPKEITRHSVSLTWPEPERANGVILEYEVKYYEKDQNERSYRIVKTASRSADIK--------GLNPLTAYVFHVRARTAAGYGEFSGPFEFTTNTVPSPMIGEG----------ASPTVLLVSVAG-SIVLVVILIAAFVISR---RRSKYSKAKQEADEE----------KHLNQGVKT---YVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREIYVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVSMLDKLIRNPNSLKRTGLDNS---------------------SRTNTALLDPSSPEWSQVASVLDWLQAIKMERYKDNFTAAGYTSLEAVVHVNQDDLTRIGISSPSHQNKILSSVQGMRTQMQQMQG 981          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Xenopus
Match: sik1 (salt inducible kinase 1 [Source:Xenbase;Acc:XB-GENE-6462410])

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 361/1030 (35.05%), Postives = 554/1030 (53.79%), Query Frame = 2
Query:  230 YVELLNTETSRWN-DWVKNSGKYDGWRS-----QNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSD--VPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVI-SHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADK-CVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCK---------DSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVF-GMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQ 3241
            Y+ L++T T+     W  N     GW       +N+  N    Y +C + G S++NWL + FI R  A  + +E+ FT+R C S P    +C++T  L  YE DS+ D  + + WN+  Y +VD I+ D +++ +     +  VN +  S  P  RSGF++A +D GAC  +  +R+++  CPS+   FA +   +  +    +   +G C+  AE + +  +  L C   G+W +     C CK GY   ++ +VC  CP   +K+++G   C  CP  S S   A   C+C  G +     +    C      PRN+  +  ++  + L W                 V + IIC  C+         D    F      ++ + V I  L +   Y F + +++ V+   N S   P    ++I T  A  S     ++ Q     +S+ +SW    + +  I+ YE+  ++   +  +S +    +   +++           P   Y ++VRAR+ + +G F  S ++  + L          ++  + L  Q  L+  S   G+ FI+ L+AI            S+   +K+  +K    S  + +YS    GS   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEV +G+L K   +++I VAIKTLK+G SEK+R +FL EA+IMGQF H NII+LEG+VTK++P+MIIT+F+E G+LD+FLR+   QF+ +QL+GMLRGI +GMKYLSEM YVHRDLAARNILV+ +L CKVSDFGLSR ++ D ++  YT+  GG IP+RWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RP+FG+I +++  ++R P +L ++    ++                        S PLL  S P     +S+  WL  + +  Y+D F+      L  + + +  DL+ + IT   H +K++N+I++M+
Sbjct:   17 YITLMDTRTATAELGWTANPSS--GWEEVSGYDENL--NTIRTYQVCNVFGPSQNNWLLTTFIPRRGAHRVYVEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSNIDNKISTFWNESPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRSGFYLAFQDYGACMSLLSVRVFFKKCPSVVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIK--LYCNGDGEWMVP-IGKCTCKAGYEP-ENHVVCKACPAAMFKANQGMGVCAPCPANSRSTSEASPICICRNGYYRADFDTPEAPCTSVPSGPRNVI-SIVNETAITLEWHPPRETGGRD------DVTYNIICKKCQSDRRGCSRCDDNVEFVPRQMGLTDTRVFISNLWAHTPYTFEIQAINGVT---NKSPFPPQHVSVNITTNQAAPSS--VPIMHQVKATMKSITLSWPQPEQPNGIILDYEIRYYEKDHHEFNSSLARSQTNTASIE--------GLRPGVVYVVQVRARTVAGYGKF--SSKMCFQTLTA--------EDYKSELREQLPLIAGSAAAGVVFIVSLVAI------------SIVCSRKRTYSKEAVYSDKLQHYS-TGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRL-KLPSKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFGEIVNTLDKMIRNPASLKTVATIPAV-----------------------PSQPLLDHSIPDITAFTSVDDWLSAIKMGQYRDIFLSSGFTSLQLVAQMTSEDLLRIGITLAGHQKKILNSIQSMR 971          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Xenopus
Match: sik1 (salt inducible kinase 1 [Source:Xenbase;Acc:XB-GENE-6462410])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 360/1027 (35.05%), Postives = 552/1027 (53.75%), Query Frame = 2
Query:  239 LLNTETSRWN-DWVKNSGKYDGWRS-----QNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSD--VPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVI-SHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADK-CVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCK---------DSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVF-GMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQ 3241
            L++T T+     W  N     GW       +N+  N    Y +C + G S++NWL + FI R  A  + +E+ FT+R C S P    +C++T  L  YE DS+ D  + + WN+  Y +VD I+ D +++ +     +  VN +  S  P  RSGF++A +D GAC  +  +R+++  CPS+   FA +   +  +    +   +G C+  AE + +  +  L C   G+W +     C CK GY   ++ +VC  CP   +K+++G   C  CP  S S   A   C+C  G +     +    C      PRN+  +  ++  + L W                 V + IIC  C+         D    F      ++ + V I  L +   Y F + +++ V+   N S   P    ++I T  A  S     ++ Q     +S+ +SW    + +  I+ YE+  ++   +  +S +    +   +++           P   Y ++VRAR+ + +G F  S ++  + L          ++  + L  Q  L+  S   G+ FI+ L+AI            S+   +K+  +K    S  + +YS    GS   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEV +G+L K   +++I VAIKTLK+G SEK+R +FL EA+IMGQF H NII+LEG+VTK++P+MIIT+F+E G+LD+FLR+   QF+ +QL+GMLRGI +GMKYLSEM YVHRDLAARNILV+ +L CKVSDFGLSR ++ D ++  YT+  GG IP+RWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RP+FG+I +++  ++R P +L ++    ++                        S PLL  S P     +S+  WL  + +  Y+D F+      L  + + +  DL+ + IT   H +K++N+I++M+
Sbjct:   26 LMDTRTATAELGWTANPSS--GWEEVSGYDENL--NTIRTYQVCNVFGPSQNNWLLTTFIPRRGAHRVYVEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSNIDNKISTFWNESPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRSGFYLAFQDYGACMSLLSVRVFFKKCPSVVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIK--LYCNGDGEWMVP-IGKCTCKAGYEP-ENHVVCKACPAAMFKANQGMGVCAPCPANSRSTSEASPICICRNGYYRADFDTPEAPCTSVPSGPRNVI-SIVNETAITLEWHPPRETGGRD------DVTYNIICKKCQSDRRGCSRCDDNVEFVPRQMGLTDTRVFISNLWAHTPYTFEIQAINGVT---NKSPFPPQHVSVNITTNQAAPSS--VPIMHQVKATMKSITLSWPQPEQPNGIILDYEIRYYEKDHHEFNSSLARSQTNTASIE--------GLRPGVVYVVQVRARTVAGYGKF--SSKMCFQTLTA--------EDYKSELREQLPLIAGSAAAGVVFIVSLVAI------------SIVCSRKRTYSKEAVYSDKLQHYS-TGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRL-KLPSKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFGEIVNTLDKMIRNPASLKTVATIPAV-----------------------PSQPLLDHSIPDITAFTSVDDWLSAIKMGQYRDIFLSSGFTSLQLVAQMTSEDLLRIGITLAGHQKKILNSIQSMR 977          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Mouse
Match: Epha4 (Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 345/992 (34.78%), Postives = 532/992 (53.63%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSE---------QLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R+ A  + IEI FT+R C S P     C++T  L  YE+D+  D      +  + ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CV+ +E   +   P++ C   G+W +     C C  G+   + +  C  C    YK+      C  CP +SYS   GA  C C+ G F   + +  + C  P  +P NL  N  +   + L W +               + + ++C  C   +          + +TP  + +  + V I  L +   Y F + +++ VS    ++ +   S  +++ T  A  S     LV  K   + S+ ++W      +  I+ YEV  ++   N    ++    ++  ++K          +P+ SY   VRAR+ + +G F    ++   + V  +    G + +   +S    ++++ +    F++                    +R++   +K    + +  + +Q        R Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI + +  L+R P         +S+ R   +S R N++++  S              P F    S+  WL  + +  YKDNF       L  +   S++DL  + IT   H  K++++++AM+     +  
Sbjct:   69 TYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDN--DKERFIRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGHEEQNGE--CQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNET-SVNLEWSSPQNTGGRQ------DISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSK---YNPSPDQSVSVTVTTNQAAPSS--IALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIK--------GLNPLTSYVFHVRARTAAGYGDFSEPLEVT-TNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVI--------------------SRRRSKYSKAKQEADEEKHLNQ------GVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNP---------NSLKRTGSESSRPNTALLDPSS-------------PEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAITHQNKILSSVQAMRTQMQQMHG 981          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Mouse
Match: Epha4 (Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 345/992 (34.78%), Postives = 532/992 (53.63%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSE---------QLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R+ A  + IEI FT+R C S P     C++T  L  YE+D+  D      +  + ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CV+ +E   +   P++ C   G+W +     C C  G+   + +  C  C    YK+      C  CP +SYS   GA  C C+ G F   + +  + C  P  +P NL  N  +   + L W +               + + ++C  C   +          + +TP  + +  + V I  L +   Y F + +++ VS    ++ +   S  +++ T  A  S     LV  K   + S+ ++W      +  I+ YEV  ++   N    ++    ++  ++K          +P+ SY   VRAR+ + +G F    ++   + V  +    G + +   +S    ++++ +    F++                    +R++   +K    + +  + +Q        R Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI + +  L+R P         +S+ R   +S R N++++  S              P F    S+  WL  + +  YKDNF       L  +   S++DL  + IT   H  K++++++AM+     +  
Sbjct:   69 TYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDN--DKERFIRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGHEEQNGE--CQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNET-SVNLEWSSPQNTGGRQ------DISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSK---YNPSPDQSVSVTVTTNQAAPSS--IALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIK--------GLNPLTSYVFHVRARTAAGYGDFSEPLEVT-TNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVI--------------------SRRRSKYSKAKQEADEEKHLNQ------GVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNP---------NSLKRTGSESSRPNTALLDPSS-------------PEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAITHQNKILSSVQAMRTQMQQMHG 981          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Mouse
Match: Epha4 (Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 345/992 (34.78%), Postives = 532/992 (53.63%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSE---------QLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R+ A  + IEI FT+R C S P     C++T  L  YE+D+  D      +  + ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CV+ +E   +   P++ C   G+W +     C C  G+   + +  C  C    YK+      C  CP +SYS   GA  C C+ G F   + +  + C  P  +P NL  N  +   + L W +               + + ++C  C   +          + +TP  + +  + V I  L +   Y F + +++ VS    ++ +   S  +++ T  A  S     LV  K   + S+ ++W      +  I+ YEV  ++   N    ++    ++  ++K          +P+ SY   VRAR+ + +G F    ++   + V  +    G + +   +S    ++++ +    F++                    +R++   +K    + +  + +Q        R Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI + +  L+R P         +S+ R   +S R N++++  S              P F    S+  WL  + +  YKDNF       L  +   S++DL  + IT   H  K++++++AM+     +  
Sbjct:   69 TYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDN--DKERFIRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGHEEQNGE--CQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNET-SVNLEWSSPQNTGGRQ------DISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSK---YNPSPDQSVSVTVTTNQAAPSS--IALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIK--------GLNPLTSYVFHVRARTAAGYGDFSEPLEVT-TNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVI--------------------SRRRSKYSKAKQEADEEKHLNQ------GVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNP---------NSLKRTGSESSRPNTALLDPSS-------------PEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAITHQNKILSSVQAMRTQMQQMHG 981          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Mouse
Match: Epha7 (Eph receptor A7 [Source:MGI Symbol;Acc:MGI:95276])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 362/1000 (36.20%), Postives = 540/1000 (54.00%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWT--DMRQDENIVNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVS---------QSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIIS-YEVIIH-KSSINAGHS--KVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAV 3280
             Y +C +   +++NWLR+ +I + +A  I +E+ FT+R C S P     C++T  L  YE D   D   +  + +Y ++D I+ D ++T  D+ + +  +N +   I P  + GF++A +D+GAC  +  +++YY  C SI    A +   V   +F  +  V+G CV  AE    E  P++ C   G+W +     C CK GY        C  C    YKSS    +C  CP +S+SD  G+ +C C +G +   S    ++C  P  +P+NL  N  ++  + L W                 V +RI+C  C   +      G ++           + V +  L +   Y F V +++ VS L   S +    A +SI T  A  S Q++ ++ ++   +RS+ +SW        +I+ YE+  + K      +S  K  +  + + N+K           P   Y  ++RA + + +G +  S ++   D+  L+   G + E+    S QN ++II+V  +   ++L+ +   F         +  R+    +K      D   Y   H     T+ YIDP  YEDP+  V +FA E+D   I+IE VIG GEFGEVC G+L K   ++ + VAIKTLK G +EK+R +FL EA+IMGQF H N++ LEG+VT+ +P+MI+ +F+E G+LD FLRK   QF+ +QL+GMLRGI +GM+YL++M YVHRDLAARNILV+ +L CKVSDFGLSR IE D+ E  YTT GG IP+RWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLPAP  CP  +H LMLDCW  +R+ERPKF QI   +  ++R P +L + PL      LS                      PLL QS P F    S+ +WL  + +  YKDNF       L  + + + +D++SL IT   H +K+M++I+ M+     L      V
Sbjct:   70 TYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDY--DTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIVENLAVFPDTVTGSEFSSLVEVRGTCVSSAEE-EAENSPRMHCSAEGEWLVP-IGKCICKAGYQQKGD--TCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNI-NQTTVSLEWSPPADNGGRN------DVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDL---SRSQRLFAAVSITTGQAAPS-QVSGVMKERVL-QRSVQLSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLK-----------PGTVYVFQIRAVTAAGYGNY--SPRL---DVATLEEASGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGF---------IIGRRHCGYSKADQEG-DEELY--FHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRL-KLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIE-DDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKDRAERPKFEQIVGILDKMIRNPSSLKT-PLGTCSRPLS----------------------PLLDQSTPDFTAFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIDDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV 998          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Mouse
Match: Ephb2 (Eph receptor B2 [Source:MGI Symbol;Acc:MGI:99611])

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 350/1014 (34.52%), Postives = 539/1014 (53.16%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEAD---SSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDV---------SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFD--KSPINS-----------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   S++NWLR+ FIRR  A  I +E+ F++R C S P    +C++T  L  YEAD   ++   P+ W +  + +VD I+ D +++ +     +  +N +  S  P  R+GF++A +D G C  +  +R++Y  CP I    A +   L  +    +   +G C+  AE + +  +  L C   G+W +     C CK G+ ++++  VC  CP  T+K+++G E C +CP  S  +  GA  CVC  G +        + C     +P+ +  +  +   L L W                 + + IIC SC          G +V         ++  + I  L +   Y F + +++ V+    FS   P  A ++I T  A  S    +++ Q ++   S+ +SWS   +   +I                    LD +LQ  +    E+     KSP N+           Y  +VRAR+ + +G +              K +   + E+    S + KL +I+     G + ++  + +   C         NR++         +  + +Y+  H  +   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   +++I VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKFGQI +++  ++R P +L ++ PLS  I                        + PLL ++ P +   +++ +WL+ + +  YK++F          + +    D++ + +T   H +K++N+I+ M+   + +QS
Sbjct:   54 NTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDLATKTFPN-WMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIK--LYCNGDGEWLVP-IGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNET-SLMLEWTPPRDSGGRE------DLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFS---PQFASVNITTNQAAPSA--VSIMHQVSRTVDSITLSWSQPDQPNGVI--------------------LDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRY------------SGKMYFQTMTEAEYQTSIKEKLPLIVGSSAAGLVFLIAVVVIAIVC---------NRRRGFERADSEYTDKLQHYTSGHM-TPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHL-KLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI------------------------NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS 984          
BLAST of Ephrin type-B receptor 2 vs. UniProt/SwissProt
Match: sp|Q07496|EPHA4_CHICK (Ephrin type-A receptor 4 OS=Gallus gallus OX=9031 GN=EPHA4 PE=1 SV=2)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 353/992 (35.58%), Postives = 534/992 (53.83%), Query Frame = 2
Query:  341 YGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSE---------QLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSS-ALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            Y +C +   S++NWLR+ +I R+ A  + IEI FT+R C S P     C++T  L  YE  S++D      +  + ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CV+ +E   +   P++ C   G+W +     C C  GY   + +  C  C    YK+      C  CP +SYS   G+  C C+ G F  ++ +  + C  P  +P+NL  N  +   + L W A               + + ++C  C   E          + F+P  + +  + V I  L +   Y F V +++ VS        NPS    +S+       +     L+  K   + S+ ++W      +  I+ YEV  ++   N    ++    S+  ++K          +P+ SY   VRAR+ + +G F    +     +      DG          +   ++++SV G   +L++I I      R    RS  ++ K+  ++             ++ G    R Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI + +  L+R P         +S+ R   +S R +++++  S              P F    S+S WL  + +  YKDNF       L  +   +++DL  + IT   H  K++++++AM++    +  
Sbjct:   70 YQVCNVMEPSQNNWLRTDWIPREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYE--SNNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGYEERNGE--CQACKIGYYKALSTDVACAKCPPHSYSIWEGSTSCTCDRGFFRAENDAASMPCTRPPSAPQNLISNVNET-SVNLEWSAPQNKGGRD------DISYNVVCKRCGAGEPSHCRSCGSGVHFSPQQNGLKTTKVSITDLLAHTNYTFEVWAVNGVSK------HNPSQDQAVSVTVTTNQAAPSPIALIQAKEITRHSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVKTASRNTDIK--------GLNPLTSYVFHVRARTAAGYGDFSGPFEFTTNTVPSPIIGDG----------TNPTVLLVSVAG-SVVLVVILIAAFVISR---RRSKYSKAKQEADEE----------KHLNQG---VRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNP---------NSLKRTGSESSRPSTALLDPSS-------------PEFSAVVSVSDWLQAIKMERYKDNFTAAGYTTLEAVVHMNQDDLARIGITAITHQNKILSSVQAMRSQMQQMHG 981          
BLAST of Ephrin type-B receptor 2 vs. UniProt/SwissProt
Match: sp|Q91845|EPA4A_XENLA (Ephrin type-A receptor 4-A OS=Xenopus laevis OX=8355 GN=epha4-a PE=2 SV=1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 349/992 (35.18%), Postives = 526/992 (53.02%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKD--------SEQLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQ-KAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R  A  + +EI FT+R C S P     C++T  L  YE  S++D      +  Y ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CVD +E   +   P++ C   G+W +     C C  G+   +    C  C    YK+      C  CP +SY+   G+  C C+ G F   +    + C  P  +P+NL  N  +   + L W                 V + ++C  C             + ++P  + +  + V I  L++   Y F V S++ VS        NP        T   +Q+   T   +Q K   + S+ ++W      +  I+ YEV  ++   N    ++    S+  ++K          +P+ +Y   VRAR+ + +G F    +     +      +G          +   ++++SV G   +L++I I      R    RS  ++ K+  ++             ++ G  T   Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+G+LRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI   +  L+R P +L    L +S                     +  N+T L  S P +   +S+  WL  + +  YKDNF       L  +   +++DL  + I+ P H  K++++++ M+     +Q 
Sbjct:   69 TYQVCNVMESSQNNWLRTDWIPRSGAQRVYVEIKFTLRDCNSLPGVMGTCKETFNLYYYE--SNNDKERFIRETQYVKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGSDTSSLVEVRGSCVDNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGFEEHNGG--CQACKVGYYKALSTDAACSKCPPHSYALREGSTSCTCDRGYFRADTDPASMPCTRPPSAPQNLISNVNET-SVNLEWSPPQNSGGRP------DVSYNLVCKRCGSDLTRCRPCGSGVHYSPQQNGLKTTKVSITDLQAHTNYTFEVWSINGVSK------QNPGQDQAVSVTVTTNQAAPSTVTQIQPKDITRHSVSLTWPEPERPNGVILEYEVKYYEKDQNERTYRIVKTTSRSADIK--------GLNPLTAYVFHVRARTAAGYGEFSGPFEFTTNTVPSPMIGEG----------ASPTVLLVSVAG-SIVLVVILIAAFVISR---RRSKYSKAKQEADEE----------KHLNQGVKT---YVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREIYVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGILRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVSMLDKLIRNPNSLKRTGLDNS---------------------SRTNTTLLDPSSPEWSQVASVLDWLQAIKMERYKDNFTAAGYTSLEAVVHVNQDDLTRIGISSPSHQNKILSSVQGMRTQMQQIQG 981          
BLAST of Ephrin type-B receptor 2 vs. UniProt/SwissProt
Match: sp|Q03137|EPHA4_MOUSE (Ephrin type-A receptor 4 OS=Mus musculus OX=10090 GN=Epha4 PE=1 SV=2)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 345/992 (34.78%), Postives = 532/992 (53.63%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSE---------QLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NWLR+ +I R+ A  + IEI FT+R C S P     C++T  L  YE+D+  D      +  + ++D I+ D ++T +   + I  +N +   + P  + GF++A +D+GAC  +  +R++Y  CP      A++   +   D   +  V+G CV+ +E   +   P++ C   G+W +     C C  G+   + +  C  C    YK+      C  CP +SYS   GA  C C+ G F   + +  + C  P  +P NL  N  +   + L W +               + + ++C  C   +          + +TP  + +  + V I  L +   Y F + +++ VS    ++ +   S  +++ T  A  S     LV  K   + S+ ++W      +  I+ YEV  ++   N    ++    ++  ++K          +P+ SY   VRAR+ + +G F    ++   + V  +    G + +   +S    ++++ +    F++                    +R++   +K    + +  + +Q        R Y+DP  YEDP+  V+EFA EID   I+IE VIG GEFGEVC G+L K   +++I VAIKTLK+G ++K+R +FL EA+IMGQF H NII LEG+VTK +P+MIIT+++E GSLD FLRK   +F+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFG+SR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+++IE GYRLP P  CP A+H LMLDCW  ERS+RPKFGQI + +  L+R P         +S+ R   +S R N++++  S              P F    S+  WL  + +  YKDNF       L  +   S++DL  + IT   H  K++++++AM+     +  
Sbjct:   69 TYQVCNVMEASQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDN--DKERFIRESQFGKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDV---PKMYCGADGEWLVP-IGNCLCNAGHEEQNGE--CQACKIGYYKALSTDASCAKCPPHSYSVWEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNET-SVNLEWSSPQNTGGRQ------DISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTRVSITDLLAHTNYTFEIWAVNGVSK---YNPSPDQSVSVTVTTNQAAPSS--IALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDIK--------GLNPLTSYVFHVRARTAAGYGDFSEPLEVT-TNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVI--------------------SRRRSKYSKAKQEADEEKHLNQ------GVRTYVDPFTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRL-KVPGKREICVAIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNP---------NSLKRTGSESSRPNTALLDPSS-------------PEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMSQDDLARIGITAITHQNKILSSVQAMRTQMQQMHG 981          
BLAST of Ephrin type-B receptor 2 vs. UniProt/SwissProt
Match: sp|P28693|EPHB2_CHICK (Ephrin type-B receptor 2 OS=Gallus gallus OX=9031 GN=EPHB2 PE=1 SV=3)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 350/1012 (34.58%), Postives = 547/1012 (54.05%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEAD--SSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHK---SSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAG--------SSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   S++NWLR+ +IRR  A  I +E+ F++R C S P    +C++T  L  YE+D  S++    +W +  + +VD I+ D +++ +     +  +N +  S  P  ++GF++A +D G C  +  +R++Y  CP +    A +   L  +    +   +G C+  AE + +  +  L C   G+W +     C C+PGY S+++  VC  CP  T+K+S+G E C++CP  S  +  GA  CVC  G +   +    + C     +P+ +  +  +   L L W                 + + IIC SC           + + F P    +++  + I  L +   Y F + +++ V+    FS   P  A ++I T  A  S    +++ Q ++   S+ +SWS   + +  I+ YE+  ++   S +N+   K       +QN+K               Y  +VRAR+ + +G +              K +   + E+    S Q KL +II     G + ++  + +   C     R  +    +  +K    +   + Y     G        +   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   +++I VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKFGQI +++  ++R P +L ++ PLS  +                        + PLL ++ P +   +++ +WLD + +  YK++F          + + +  D++ + +T   H +K++N+I+ M+   + +QS
Sbjct:   55 NTIRTYQVCNVFESSQNNWLRTKYIRRRGAHRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYYESDFDSATKTFPNWMENPWMKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSKNGFYLAFQDYGGCMSLIAVRVFYRKCPRVIQNGAVFQETLSGAESTSLVAARGTCISNAEEVDVPIK--LYCNGDGEWLVP-IGRCMCRPGYESVENGTVCRGCPSGTFKASQGDEGCVHCPINSRTTSEGATNCVCRNGYYRADADPVDMPCTTIPSAPQAVISSVNET-SLMLEWTPPRDSGGRE------DLVYNIICKSCGSGRGACTRCGDNVQFAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFS---PQFASVNITTNQAAPSA--VSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKNLSELNSTAVKSPTNTVTVQNLKAG-----------TIYVFQVRARTVAGYGRY------------SGKMYFQTMTEAEYQTSVQEKLPLIIGSSAAGLVFLIAVVVIIIVCN--RRRGFERADSEYTDKLQHYTSGHSTYRGPPPGLGVRLFVMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHL-KLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPNALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGV------------------------NLPLLDRTIPDYTSFNTVDEWLDAIKMSQYKESFASAGFTTFDIVSQMTVEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS 1001          
BLAST of Ephrin type-B receptor 2 vs. UniProt/SwissProt
Match: sp|P29323|EPHB2_HUMAN (Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 355/1013 (35.04%), Postives = 541/1013 (53.41%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEAD--SSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDV---------SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFD--KSPINS-----------YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASI-PLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   S++NWLR+ FIRR  A  I +E+ F++R C S P    +C++T  L  YEAD  S++    +W +  + +VD I+ D +++ +     +  +N +  S  P  RSGF++A +D G C  +  +R++Y  CP I    A +   L  +    +   +G C+  AE + +  +  L C   G+W +     C CK G+ ++++  VC  CP  T+K+++G E C +CP  S  +  GA  CVC  G +        + C     +P+ +  +  +   L L W                 + + IIC SC          G +V         ++  + I  L +   Y F + +++ V+    FS   P  A ++I T  A  S    +++ Q ++   S+ +SWS   +   +I                    LD +LQ  +    E+     KSP N+           Y  +VRAR+ + +G +              K +   + E+    S Q KL +II     G + ++  + +   C    NR    R  +  +  ++  L   +Y+  H  +   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   +++I VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKFGQI +++  ++R P +L ++ PLS  I                        + PLL ++ P +   +++ +WL+ + +  YK++F          + +    D++ + +T   H +K++N+I+ M+   + +QS
Sbjct:   54 NTIRTYQVCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIK--LYCNGDGEWLVP-IGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNET-SLMLEWTPPRDSGGRE------DLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFS---PQFASVNITTNQAAPSA--VSIMHQVSRTVDSITLSWSQPDQPNGVI--------------------LDYELQYYEKELSEYNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRY------------SGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVVIAIVC----NR----RGFERADSEYTDKLQ--HYTSGHM-TPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHL-KLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI------------------------NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS 983          
BLAST of Ephrin type-B receptor 2 vs. TrEMBL
Match: A0A5E4NPU6 (Uncharacterized protein OS=Cinara cedri OX=506608 GN=CINCED_3A019335 PE=3 SV=1)

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 389/1091 (35.66%), Postives = 569/1091 (52.15%), Query Frame = 2
Query:  143 IHSYGSIMCQLINAILISVFSIVNCRVPNYVELLNTETS---RWN-----------DWVKNS----GKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDF-RIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISW-----SLVSE---DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLV--------KLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQ--------IHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAV 3280
            +H Y S+    +   L++V  IV      +V LL+T T    RW             WV+ S     K   WRS          Y +C +   + +NW+ +PFI R  A  I IE+ FT+R C   P   L+C++T  L+ YE D  +  P  W    Y  V  I+      +   +E ++N +T +++  + G + A RD GAC  +  +++YY+ CP +   FA +S    + +  +I +  G CVD AE++     P  +C+  G+W++     C CK G+ +      C+ CP   YK   G +KC  CP +S + D G  +C CN G F        ++C +P  +P+NL  NF D+  + LSW+  + +           + +R+ C  C  S  +F +    ++++ + I  L    TYKF V + + VS+L   SS N     +++ T  A       N V         + +SW     S +     D A+  YEV  +     +  S     D  +  V T          P   Y  +VRA++   WG +  +       L+        + +  +G  D++  Y+  ++ + +  + G    ++++ + +           +++R     NK   +  D   Y             GS+T+R YIDP  YEDP+  V+EFA EID   I IE +IG GEFG+VCRGKL +      ++ VAIKTLK G S+K R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F  LQL+GMLRGI SGM+YLSEM YVHRDLAARN+LV+  L CK++DFGLSREIE+  TEGAYTT+GG IP+RWTAPEAI +R+FTS+SDVWSFGIV+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP  I+ LMLDCW  ER+ RP F  I  ++  L+RCPE L  I  + S+  LS D+                         P      S+++WL  + +  Y DNF +  ++ L  + + +  DL +L IT   H +K+MN+I+AM+  F    S  F V
Sbjct:    1 MHKYRSLTAAFL---LLTVACIVGPGQSEHVVLLDTTTEPSLRWTTYPYGPDANAAGWVEESYINFEKGINWRS----------YVVCDVTKLNVNNWVWTPFIERGLANLIYIEVKFTIRDCSLFPGYALSCKETFSLLYYEFDVVTREPPPWEPDSYKSVGRIAAGEGRFNA-NNEVVINTETKAVKVTKKGVYFAFRDQGACISIMAVKVYYIVCPDVVINFANFSATPTARELTQIEHATGKCVDNAEVVG--GTPTYLCKGDGKWYLPSGG-CKCKAGFEADMEAQACLICPPGKYKYGVGDDKCQPCPAHSKAPDQGMSECRCNTGYFRSPRDPKSVACTQPPTAPQNLTVNFVDQSTVTLSWNPPNFLGGRT------DIVYRVTCDMCGPS-VVFMSNNEVINETKITISGLSPVTTYKFHVWAENGVSNLT--SSENRQFVDIAVTTTEASVKSASVNNVRVMLVKASEIQLSWDPPMSSFMDSGDGDDAVEIYEVKFYPRGDESNASNKLTADRHV--VFTAL-------RPKTDYGFQVRAKTAHGWGEYSPTMYKTTGQLLGSGKNTHQQFQRKNGTKDDT-AYIGDEDNMEVRIIAGATVAVVVVLVVVIIMTVLF----LRSRSNDECNKKQPSDCDTLEYRNGEVTTPLFTQVGSTTSRSYIDPHTYEDPNQAVKEFAREIDASYITIEAIIGGGEFGDVCRGKLKVLGSPSVEVDVAIKTLKPGSSDKARNDFLTEASIMGQFEHPNVIFLQGVVTRSNPVMIITEYMENGSLDTFLRANDGKFQVLQLVGMLRGIASGMQYLSEMNYVHRDLAARNVLVNAQLVCKIADFGLSREIES-TTEGAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSFGIVVWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPETIYQLMLDCWQKERTHRPVFLSIVKTLDKLIRCPETLRRIAQNRSVNPLSSDA-------------------------PDMTQFGSVNEWLCSIKMARYLDNFEQAGIVSLKAVARLTVADLTALGITLVGHQKKIMNSIQAMRAQFSANLSEGFLV 1025          
BLAST of Ephrin type-B receptor 2 vs. TrEMBL
Match: A0A2S2PM87 (Ephrin type-A receptor 7 OS=Schizaphis graminum OX=13262 GN=EPHA7 PE=3 SV=1)

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 389/1092 (35.62%), Postives = 567/1092 (51.92%), Query Frame = 2
Query:  167 CQLINAILISVFSIVNCRVPNYVELLNTETS---RWN-----------DWVKNS----GKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDF-RIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDV-SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWS--LVS------EDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPF----------VVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQ--------------IHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAV 3280
            C L+   L+   +I++     +V LL+T T    RW             WV+ S     K   WRS          Y +C +   + +NW+ +PFI R  A  I IE+ FT+R C   P   L+C++T  L+ YE D ++  P  W    Y  V  I+      +   +E ++N +T +++  + G + A RD GAC  +  +++YY+ CP +   FA +S    + +  +I +  G CVD AE++     P  +C+  G+W++     C CK G+ +      CI CP   YK   G +KC  CP +S + D G  +C CN G +        + C +P  +P+NL  NF D+  + LSW+  + +           + +R+ C  C  S  + F P  +V + + + I  L    TYKF V + + VS+L   SS N     +++ T  A       N V         + +SW   + S      +DAA+  YEV  +     +  S     D  +  V T          P   Y  +VRA++   WG +          ++    N +  V+ K    GI +   Y+  ++ + +  + G    ++++ + +           +++R     NK   +  D   Y                   GS+T+R YIDP  YEDP+  V+EFA EID   I IE +IG GEFG+VCRGKL +      ++ VAIKTLK G S+K R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F  LQL+GMLRGI SGM+YLSEM YVHRDLAARN+LV+  L CK++DFGLSREIE+  TEGAYTT+GG IP+RWTAPEAI +R+FTS+SDVWSFGIV+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP  I+ LMLDCW  ER+ RP F  I  ++  L+RCP+ L  I  + S+  LS D+                         P      S+++WL  + +  Y DNF +  ++    + + +  DL +L IT   H +K+MN+I+AM+  F    S  F V
Sbjct:   31 CCLVAVFLLLAVAIISPGRTEHVVLLDTTTEPSLRWTTYPYGPDANAAGWVEESYINFEKGINWRS----------YVVCDVTKQNVNNWVWTPFIERGLANLIYIEVKFTIRDCSLFPGYALSCKETFSLLYYEFDVATREPPPWEPDSYKSVGRIAAGEGRFNA-NNEVVINTETKAVKVTKKGVYFAFRDQGACISIMAVKVYYIVCPEVVINFANFSATPTARELTQIEHATGKCVDNAEVVG-GGPPTYLCKGDGKWYLPSGG-CKCKAGFEADIEAQTCIICPPGKYKYGVGDDKCQPCPAHSKAPDQGMSECRCNTGYYRSPKDPKSVPCTQPPSAPQNLTVNFVDQSTVTLSWNPPNFLGGRT------DIVYRVTCDMCGPS--VVFMPNNEVFNDTKITISGLSPVTTYKFHVWAENGVSNLT--SSENRQFVDIAVTTTEASVKSASVNNVRVMLVKASEITLSWDPPMASFFDPGDDDAAVEVYEVKFYPRGDESNVSNKLTADRHM--VFTAL-------RPKTDYGFQVRAKTAHGWGEYSPTIYKTTGQLLGSGKNTQQQVQRK---NGIKDDTAYIGDEDNMEVRIIAGATVAVVVVLVVVIIMTVLF----LRSRSNDECNKKQPSDCDTLEYRNGEGLVVTYMTTPLFTQVGSTTSRSYIDPHTYEDPNQAVKEFAREIDASYITIEAIIGGGEFGDVCRGKLKVLGSPSVEVDVAIKTLKPGSSDKARNDFLTEASIMGQFEHPNVIFLQGVVTRSNPVMIITEYMENGSLDTFLRANDGKFQVLQLVGMLRGIASGMQYLSEMNYVHRDLAARNVLVNAQLVCKIADFGLSREIES-TTEGAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSFGIVVWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPETIYQLMLDCWQKERTHRPVFLSIVKTLDKLIRCPDTLRRIAQNRSVNPLSSDA-------------------------PDMTQFGSVNEWLCSIKMARYLDNFEQAGIVSPKEVARLTVADLTALGITLVGHQKKIMNSIQAMRAQFSANLSEGFLV 1057          
BLAST of Ephrin type-B receptor 2 vs. TrEMBL
Match: X1WQ64 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 GN=100166161 PE=3 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 385/1076 (35.78%), Postives = 560/1076 (52.04%), Query Frame = 2
Query:  167 CQLINAILISVFSIVNCRVPNYVELLNTETS---RWN-----------DWVKNS----GKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDF-RIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDV-SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWS--LVS------EDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQ--------IHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAV 3280
            C L    L+   +IV+     +V LL+T T    RW             WV+ S     K   WRS          Y +C +   + +NW+ +PFI R  A  I IE+ FT+R C   P   L+C++T  L+ YE D ++  P  W    Y  V  I+      +   +E ++N +T +++  + G + A RD GAC  +  +++YY+ CP +   FA +S    + +  +I +  G CVD AE++     P  +C+  G+W++     C CK G+ +      CI CP   YK   G +KC  CP +S + D G  +C CN G +        + C +P  +P+NL  NF D+  + LSW+  + +           + +R+ C  C  S  + F P  +V + + + I  L    TYKF V + + VS+L   SS N     +++ T  A       N V         + +SW   + S      +DAA+  YEV  +     +  S     D  +  V T          P   Y  +VRA++   WG +  +       L+            + Y+  ++ + +  + G    ++++ + +           +++R     NK   +  D   Y             GS+T+R YIDP  YEDP+  V+EFA EID   I IE +IG GEFG+VCRGKL +      ++ VAIKTLK G ++K R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F  LQL+GMLRGI SGM+YLSEM YVHRDLAARN+LV+  L CK++DFGLSREIE+  TEGAYTT+GG IP+RWTAPEAI +R+FTS+SDVWSFGIV+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP  I+ LMLDCW  ER+ RP F  I  ++  L+RCP+ L  I  + S+  LS D+                         P      S+++WL  + +  Y DNF +  ++    + + +  DL +L IT   H +K+MN+I+AM+  F    S  F V
Sbjct:   31 CCLTAVFLLLAVAIVSPGRAEHVVLLDTTTEPSLRWTTYPYGPDANAAGWVEESYINFEKGINWRS----------YVVCDVTKQNVNNWVWTPFIERGLANLIYIEVKFTIRDCSLFPGYALSCKETFSLLYYEFDVATREPPPWEPDSYKSVGRIAAGEGRFNA-NNEVVINTETKAVKVTKKGVYFAFRDQGACISIMAVKVYYIVCPEVVINFANFSATPTARELTQIEHATGKCVDNAEVVG-GGAPTYLCKGDGKWYLPSGG-CKCKAGFEADIEAQTCIICPPGKYKYGVGDDKCQPCPAHSKAPDQGMSECRCNTGYYRSPKDPKSVPCTQPPSAPQNLTVNFVDQSTVTLSWNPPNFLGGRT------DIVYRVTCDMCGPS--VLFMPNNEVFNDTKITISGLSPVTTYKFHVWAENGVSNLT--SSENRQFVDIAVTTTEASVKSASVNNVRVMLVKASEITLSWDPPMASFFDSGDDDAAVEVYEVKFYPRGDESNVSNKLTADRHM--VFTAL-------RPKTDYGFQVRAKTAHGWGEYSPTIYKTTGQLL-----------GSAYIGDEDNMEVRIIAGATVAVVVVLVVVIIMTVLF----LRSRSNDECNKKQPSDCDTLEYRNGEVTTPLFTQVGSTTSRSYIDPHTYEDPNQAVKEFAREIDASYITIEAIIGGGEFGDVCRGKLKVLGSPSVEVDVAIKTLKPGSTDKARNDFLTEASIMGQFEHPNVIFLQGVVTRSNPVMIITEYMENGSLDTFLRANDGKFQVLQLVGMLRGIASGMQYLSEMNYVHRDLAARNVLVNAQLVCKIADFGLSREIES-TTEGAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSFGIVVWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPETIYQLMLDCWQKERTHRPMFMSIVKTLDKLIRCPDTLRRIAQNRSVNPLSSDA-------------------------PDMTQFGSVNEWLCSIKMARYLDNFEQAGIVSPKAVARLTVADLTALGITLVGHQKKIMNSIQAMRAQFSANLSEGFLV 1033          
BLAST of Ephrin type-B receptor 2 vs. TrEMBL
Match: A0A5E4NRS4 (Uncharacterized protein OS=Cinara cedri OX=506608 GN=CINCED_3A019335 PE=3 SV=1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 390/1106 (35.26%), Postives = 573/1106 (51.81%), Query Frame = 2
Query:  143 IHSYGSIMCQLINAILISVFSIVNCRVPNYVELLNTETS---RWN-----------DWVKNS----GKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDF-RIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISW-----SLVSE---DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLV--------KLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPL-----------------------CFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAV 3280
            +H Y S+    +   L++V  IV      +V LL+T T    RW             WV+ S     K   WRS          Y +C +   + +NW+ +PFI R  A  I IE+ FT+R C   P   L+C++T  L+ YE D  +  P  W    Y  V  I+      +   +E ++N +T +++  + G + A RD GAC  +  +++YY+ CP +   FA +S    + +  +I +  G CVD AE++     P  +C+  G+W++     C CK G+ +      C+ CP   YK   G +KC  CP +S + D G  +C CN G F        ++C +P  +P+NL  NF D+  + LSW+  + +           + +R+ C  C  S  +F +    ++++ + I  L    TYKF V + + VS+L   SS N     +++ T  A       N V         + +SW     S +     D A+  YEV  +     +  S     D  +  V T          P   Y  +VRA++   WG +  +       L+        + +  +G  D++  Y+  ++ + +  + G    ++++ + +                       C    Y       N     +  T ++S+    ++Q+  GS+T+R YIDP  YEDP+  V+EFA EID   I IE +IG GEFG+VCRGKL +      ++ VAIKTLK G S+K R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F  LQL+GMLRGI SGM+YLSEM YVHRDLAARN+LV+  L CK++DFGLSREIE+  TEGAYTT+GG IP+RWTAPEAI +R+FTS+SDVWSFGIV+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP  I+ LMLDCW  ER+ RP F  I  ++  L+RCPE L  I  + S+  LS D+                         P      S+++WL  + +  Y DNF +  ++ L  + + +  DL +L IT   H +K+MN+I+AM+  F    S  F V
Sbjct:    1 MHKYRSLTAAFL---LLTVACIVGPGQSEHVVLLDTTTEPSLRWTTYPYGPDANAAGWVEESYINFEKGINWRS----------YVVCDVTKLNVNNWVWTPFIERGLANLIYIEVKFTIRDCSLFPGYALSCKETFSLLYYEFDVVTREPPPWEPDSYKSVGRIAAGEGRFNA-NNEVVINTETKAVKVTKKGVYFAFRDQGACISIMAVKVYYIVCPDVVINFANFSATPTARELTQIEHATGKCVDNAEVVG--GTPTYLCKGDGKWYLPSGG-CKCKAGFEADMEAQACLICPPGKYKYGVGDDKCQPCPAHSKAPDQGMSECRCNTGYFRSPRDPKSVACTQPPTAPQNLTVNFVDQSTVTLSWNPPNFLGGRT------DIVYRVTCDMCGPS-VVFMSNNEVINETKITISGLSPVTTYKFHVWAENGVSNLT--SSENRQFVDIAVTTTEASVKSASVNNVRVMLVKASEIQLSWDPPMSSFMDSGDGDDAVEIYEVKFYPRGDESNASNKLTADRHV--VFTAL-------RPKTDYGFQVRAKTAHGWGEYSPTMYKTTGQLLGSGKNTHQQFQRKNGTKDDT-AYIGDEDNMEVRIIAGATVAVVVVLVVVIIMTVLFLRSRSNDECNKKQPSDCDTLEYRNGEVHCNLDNPPIVATHTSSMTTPLFTQV--GSTTSRSYIDPHTYEDPNQAVKEFAREIDASYITIEAIIGGGEFGDVCRGKLKVLGSPSVEVDVAIKTLKPGSSDKARNDFLTEASIMGQFEHPNVIFLQGVVTRSNPVMIITEYMENGSLDTFLRANDGKFQVLQLVGMLRGIASGMQYLSEMNYVHRDLAARNVLVNAQLVCKIADFGLSREIES-TTEGAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSFGIVVWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPETIYQLMLDCWQKERTHRPVFLSIVKTLDKLIRCPETLRRIAQNRSVNPLSSDA-------------------------PDMTQFGSVNEWLCSIKMARYLDNFEQAGIVSLKAVARLTVADLTALGITLVGHQKKIMNSIQAMRAQFSANLSEGFLV 1042          
BLAST of Ephrin type-B receptor 2 vs. TrEMBL
Match: A0A5E4NHY8 (Fibronectin type III,Protein kinase, ATP binding site,Ephrin receptor ligand binding domain,Ephrin receptor OS=Cinara cedri OX=506608 GN=CINCED_3A019335 PE=3 SV=1)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 390/1111 (35.10%), Postives = 573/1111 (51.58%), Query Frame = 2
Query:  143 IHSYGSIMCQLINAILISVFSIVNCRVPNYVELLNTETS---RWN-----------DWVKNS----GKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDF-RIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISW-----SLVSE---DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLV--------KLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPL-----------------------CFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKL-IKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-----GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAV 3280
            +H Y S+    +   L++V  IV      +V LL+T T    RW             WV+ S     K   WRS          Y +C +   + +NW+ +PFI R  A  I IE+ FT+R C   P   L+C++T  L+ YE D  +  P  W    Y  V  I+      +   +E ++N +T +++  + G + A RD GAC  +  +++YY+ CP +   FA +S    + +  +I +  G CVD AE++     P  +C+  G+W++     C CK G+ +      C+ CP   YK   G +KC  CP +S + D G  +C CN G F        ++C +P  +P+NL  NF D+  + LSW+  + +           + +R+ C  C  S  +F +    ++++ + I  L    TYKF V + + VS+L   SS N     +++ T  A       N V         + +SW     S +     D A+  YEV  +     +  S     D  +  V T          P   Y  +VRA++   WG +  +       L+        + +  +G  D++  Y+  ++ + +  + G    ++++ + +                       C    Y       N     +  T ++S+    ++Q+  GS+T+R YIDP  YEDP+  V+EFA EID   I IE +IG GEFG+VCRGKL +      ++ VAIKTLK G S+K R +FL EA+IMGQF H N+I L+G+VT++ P+MIIT+++E GSLDTFLR    +F  LQL+GMLRGI SGM+YLSEM YVHRDLAARN+LV+  L CK++DFGLSREIE+  TEGAYTT+     GG IP+RWTAPEAI +R+FTS+SDVWSFGIV+WEVMSYGERPYWNW N+DV++SIE GYRLPAP  CP  I+ LMLDCW  ER+ RP F  I  ++  L+RCPE L  I  + S+  LS D+                         P      S+++WL  + +  Y DNF +  ++ L  + + +  DL +L IT   H +K+MN+I+AM+  F    S  F V
Sbjct:    1 MHKYRSLTAAFL---LLTVACIVGPGQSEHVVLLDTTTEPSLRWTTYPYGPDANAAGWVEESYINFEKGINWRS----------YVVCDVTKLNVNNWVWTPFIERGLANLIYIEVKFTIRDCSLFPGYALSCKETFSLLYYEFDVVTREPPPWEPDSYKSVGRIAAGEGRFNA-NNEVVINTETKAVKVTKKGVYFAFRDQGACISIMAVKVYYIVCPDVVINFANFSATPTARELTQIEHATGKCVDNAEVVG--GTPTYLCKGDGKWYLPSGG-CKCKAGFEADMEAQACLICPPGKYKYGVGDDKCQPCPAHSKAPDQGMSECRCNTGYFRSPRDPKSVACTQPPTAPQNLTVNFVDQSTVTLSWNPPNFLGGRT------DIVYRVTCDMCGPS-VVFMSNNEVINETKITISGLSPVTTYKFHVWAENGVSNLT--SSENRQFVDIAVTTTEASVKSASVNNVRVMLVKASEIQLSWDPPMSSFMDSGDGDDAVEIYEVKFYPRGDESNASNKLTADRHV--VFTAL-------RPKTDYGFQVRAKTAHGWGEYSPTMYKTTGQLLGSGKNTHQQFQRKNGTKDDT-AYIGDEDNMEVRIIAGATVAVVVVLVVVIIMTVLFLRSRSNDECNKKQPSDCDTLEYRNGEVHCNLDNPPIVATHTSSMTTPLFTQV--GSTTSRSYIDPHTYEDPNQAVKEFAREIDASYITIEAIIGGGEFGDVCRGKLKVLGSPSVEVDVAIKTLKPGSSDKARNDFLTEASIMGQFEHPNVIFLQGVVTRSNPVMIITEYMENGSLDTFLRANDGKFQVLQLVGMLRGIASGMQYLSEMNYVHRDLAARNVLVNAQLVCKIADFGLSREIES-TTEGAYTTRFSNFQGGKIPVRWTAPEAIAFRKFTSASDVWSFGIVVWEVMSYGERPYWNWSNQDVIKSIEKGYRLPAPMDCPETIYQLMLDCWQKERTHRPVFLSIVKTLDKLIRCPETLRRIAQNRSVNPLSSDA-------------------------PDMTQFGSVNEWLCSIKMARYLDNFEQAGIVSLKAVARLTVADLTALGITLVGHQKKIMNSIQAMRAQFSANLSEGFLV 1047          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Cavefish
Match: ephb2a (EPH receptor B2 [Source:NCBI gene;Acc:103031596])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 359/1002 (35.83%), Postives = 552/1002 (55.09%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADS--SSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLD-MANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEAL-ASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   S++NW+R+ +IRR  A  I +E+ F++R C S P    +C++T  L  +EADS  ++ V  +W +  + +VD I+ D +++ +     +  +N +  S  P  R+GF++A +D GAC  +  +R+YY  CP +    A +   L  +    +   +G C+   E + +  +  L C   G+W +     C CK G+ + ++  +C  CP   +K S+G ++C+ CP  S  ++ GA  CVC  G +   S    + C     +P+ +  +  +   L+L W                 V + IIC SC           + + F P    +++  V I  L +   Y F + +++ VS    +S   P  A ++I T  A  S+   +++ Q ++   S+ +SWS   + +  I+ YE+  ++ ++   +S V    +    V+            I  Y  +VRAR+ + +G F  S ++  + + +        +E N+ L  Q KL +II     GF+ ++  I L   C            ++  ++T S   D + +Y+  H  S   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L +   +++I VAIKTLKSG +EK+R +FL EA+IMGQF H NII LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL +M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTSSSDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKF QI +++  ++R P +L A+ PLS  +                     H    PLL +S P F   + + +WLD + +  YK+NF    +     + + +  D++ + +T   H +K+ N+++ M+   + +QS
Sbjct:   67 NTIRTYQVCNVFDSSQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYFEADSDTATKVYPAWMENPWIKVDTIAADESFSQVDLGGRVMKINREVRSFGPVSRNGFYLAFQDYGACMSLIAVRVYYRKCPRVVRNGAVFPETLSGAESTSLVAARGTCIPNGEEVDVPIK--LYCNGDGEWLVP-IGRCMCKAGHEAAENGTICRACPSGFFKPSQGDQQCLQCPMNSRTTNEGATNCVCRNGYYRTDSDPVQMPCTTMPSAPQRVISSVNET-SLRLVWSPPRESGGRE------DVVYNIICKSCGSGRGACTRCGDNVQFVPRQLGLTEPQVHISDLLAHTQYTFEIQAVNGVSDQSPYS---PQFAAVNITTNQAAPSV--VSIMHQVSRAIDSITLSWSQPDQPNGVILDYELQYYEKNLAELNSSVLRSQTNTAVVRG------LKSGTI--YVFQVRARTVAGFGRF--SGKMYFQTMTE--------EEYNSSL--QEKLPLIIGSAAAGFVFLVAVIVLVIVC-----------NRRGSDRTDSEYTDKLQHYTSGHM-SPGMKIYIDPFTYEDPNEAVREFAKEIDMSCVKIEQVIGAGEFGEVCSGNL-RLPGKREILVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNIIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLCDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSSSDVWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPNALHQLMLDCWQKDRNNRPKFSQIVNTLDKMIRNPNSLKATTPLSSGM---------------------HL---PLLDRSTPDFSSFNCVDEWLDAIKMGQYKENFANEGMTSFDAVSQMTMEDILRVGVTLAGHQKKIFNSVQMMRAQMNQIQS 996          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Cavefish
Match: ek1 (eph-like kinase 1 [Source:NCBI gene;Acc:30311])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 344/1002 (34.33%), Postives = 537/1002 (53.59%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVP-SSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPR------RSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRII--------------CISCKDSEQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVS-EDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCF-----YCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDT 3256
             Y +C++   +++NWLR+  I+R+ A  + +EI FT+R C S P     C++T  +  +E++S++  P     +  Y ++D I+ D ++T     + ++ + T   E R      + G ++A +D+GAC  +  +R++Y  CP      AR+   V   D  +  V+G CV+ AE +   + P++ C   G W +     C CKPG+  +D   +C  C    YK+S     C+ CP +SYS    A +CVC  G +  ++    ++C  P  +P N      +   + L W            + ++ VH R                C+ C       F P    ++   VL+  L+    Y FS+ +++ VS L    S +P   L+S++   +    Q  +++V++ + + S+ ++W      D  ++ YEV  ++ +    +  V    S    V+           P  +Y  +VRAR+   +G +    +I L+             E    +   N+  I++V   G +++LI +  CF     +C Y+  +     +K               + ++    S  R YI P  YEDP+  V++FA EI+   I+IE VIG GEFGEVC G+L +   +++I VAIK+LK+G +E++R +FL EA+IMGQF H NII+LEG+VT+ +P+MIIT+++E GSLDTFL+K   QF+ +QL+GMLRGI +GM+YLSEM YVHRDLAARNILV+ +L CKVSDFGLSR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEV+SYGERPYW   N+DV+++I+ GYRLPAP  CP  +H LMLDCW   RS+RPKFGQI  S+  L+R P  L  +                NS+I  +         P+     +    S++  WLD + +  YK++F     + L  +   S ++L  + +    H +K++++I+++Q    T
Sbjct:   32 TYQVCSVMEANQNNWLRTGLIQREGAQRVYVEIKFTLRDCNSLPGVPGTCKETFNVYYHESNSATPPPLRHIRESQYVKIDTIAADESFTQTDVGDRVMKLNT---EVRDISGLNKRGIYLAFQDLGACIALVSVRVFYKRCPLAVLNLARFGDTVTGGDSALVEVRGSCVEDAEEL---EAPRMFCSADGGWLVP-IGRCVCKPGFEEVDG--LCQPCRSGFYKASAMDAYCVKCPPHSYSHQDKASECVCERGFYRAETDPRSMACTRPPSAPGNPISTVNETA-VTLEWSPPRDSGGRG--DVTYSVHCRKCSGEVAPGASGAGERCVPCGSGPH--FNPRQFGLAHPRVLVTELQPRTNYTFSIEALNGVSDL----SPSPRH-LVSVNVTTS----QTVSVIVKERKGRDSITLAWQAPEPSDGTVVEYEVTYYEKNQRDQNYTVLKTKSNSMTVE--------GLKPGTTYVFRVRARTDGGYGNY--GGEIELETS----------HEDMLAVGDPNQQTILAVSIAGGVVLLILLVACFVVSGRHCGYIKAKQDPEEEKMQFQ-----------HGRVQLPGS--RTYIHPHTYEDPNQAVRDFAKEIEVSNIRIERVIGAGEFGEVCSGRL-RLPSKREIHVAIKSLKAGYTEQQRRDFLSEASIMGQFDHPNIIRLEGVVTRCKPVMIITEYMENGSLDTFLKKHDGQFTVIQLVGMLRGIAAGMQYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVISYGERPYWEMSNQDVIKAIDEGYRLPAPMDCPVVLHQLMLDCWEKNRSDRPKFGQIVSSLDRLIRNPGCLKQLA---------------NSAIWED---------PVTPDPAV----STVEDWLDSIKMSQYKEHFSNAGYVTLDSVMYVSVSELGKMGVALTGHQKKILSSIQSLQTQQGT 947          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Cavefish
Match: ephb1 (ephrin type-B receptor 1 [Source:NCBI gene;Acc:103025121])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 351/1005 (34.93%), Postives = 554/1005 (55.12%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADS--SSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVI-SHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADK-CVCNEGLFPIKSSSDL--ISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCK---------DSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFG-MGFILMLIAIPL-CFYCRYLTNRSMKNRKKKNVNKTFSTSL--DMAN-YSQIHA----GSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCP---EALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQ 3241
            N    Y +C +   S++NWL + FI+R  A  + +E+ FT+R C S P    +C++T  L  YE+D   ++   + W +  Y +VD I+ D +++ +     +  VN +  S  P  ++GF++A +D GAC  +  +R++Y  CPS+   FA +   +  +    +   +G+C+  +E + +  +  L C   G+W +     C CK G+   D+  +C  CP  T+KSS+G+E C+ CP  S S   A   CVC  G +  ++  DL    C      PRN+  +  ++  + L W                 V + I+C  C+         D    F      ++ + V+I  L +   Y F + +++ V++   + + +     +SID      +  +  ++ Q +   RS+ +SW    + +  I+ YE+  ++  +   +S +    +    V +              Y ++VRAR+ + +G +  S ++  + L          ++  + L  Q  L+  S    + FI+ L+AI + C   R  +  ++ + K ++ +     SL  D++N +S +      GS   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEV +G+L K   +++I VAIKTLK+G SEK+R +FL EA+IMGQF H NII+LEG+VTK++P+MI+T+F+E G+LD+FLR+   QF+ +QL+GM+RGI +GMKYLSEM YVHRDLAARNILV+ +L CKVSDFGLSR ++ D ++  YT+  GG IP+RWT+PEAI +R+FTS+SDVWS+GIVMWEVMS+GERPYW+  N+DV+ +IE  YRLPAP  CP A+H LMLDCW  +R+ RP+F  I +++  L+R P   +A+ASIP                             S PLL +S P F   SS+  WL  L +  Y+DN +      L  + + +  DL+ + IT   H +K++++I++MQ
Sbjct:   54 NTIRTYQVCNVFESSQNNWLLTTFIQRRAAQRVYVEMRFTVRDCSSIPRVPGSCKETFNLYYYESDQVIATKGTAFWMEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKNGFYLAFQDYGACMSLLSVRVFYKKCPSVVQNFAVFPETMTGAESTSLVIARGMCIPNSEEVDVPIK--LYCNGDGEWMVP-IGSCTCKAGFEP-DNGNICRACPPGTFKSSQGTELCLQCPPNSRSTSEASTICVCRNGYY--RADGDLPDTPCTSVPSGPRNVI-SIVNETSVILEWHPPRETGGRE------DVVYNIVCKKCRADRRSCSHCDDNVDFVPRQLGLTDNRVVISNLWAHTLYTFEIQAVNGVTNKSPYPAQH-----VSIDITTNQAAPSMVPIMHQVSSTMRSITLSWPQPEQPNGIILDYELRYYEKDLTEANSTILRSQTNTARVDS--------LRTGTMYVVQVRARTVAGFGKY--SSKMCFQTLTD--------EDYKSELREQLPLIAGSAAAAVVFIVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGTELSLRPDLSNCHSSMGCPTLPGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSTVKIEEVIGAGEFGEVYKGRL-KLPGKREIYVAIKTLKAGYSEKQRRDFLAEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGALDSFLRQNDGQFTVIQLVGMMRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQEDTSDPTYTSSLGGKIPVRWTSPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPAPMDCPTALHQLMLDCWQKDRNARPRFTDIVNTLDKLIRNPTSLKAIASIP--------------------------SIPSQPLLDRSIPDFNTFSSVEDWLSALKMSQYRDNVLNSGFTSLQLVAQMTSEDLLRIGITLAGHQKKILSSIQSMQ 995          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Cavefish
Match: epha6 (ephrin type-A receptor 6-like [Source:NCBI gene;Acc:103046442])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 363/1059 (34.28%), Postives = 547/1059 (51.65%), Query Frame = 2
Query:  176 INAILISVFSIVNCRVPNYVELLNTETSRWNDWVKNSGKYDGWRS------QNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPD--ITWTDMRQDENIVNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADK-CVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQ--------LFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFI----LMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALAS-IPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASF 3274
            I   L+   ++ +   PN V LL+T T+   +    +   +GW +      QN P +    + +C +   +++NWLRS +I R  A  + +E+ FT+R C S P     C++T  L+  EA+      + ++   Y ++D I+ D   T TD+      +N +   + P  R GF++A +D+GAC  +  +R+YY  CPS     A +   V   D   +  V+G CV+ AE       P+L C   G W +     C C  G+   D   +C+ C    YK+  G+ KC  CP +S+S   A   C C +G +         +C  P   PRNL  N  +   L L WD                + + ++C  C    Q        + F P P  +++ S+ +    +   Y F + +++ VS +     A    A ++I T+ A  SL    +V +   ++ S+ +SW    +  AAI+ YE+  ++            L       K P       K P   Y   VRAR+ + +  +    +           F  G DE +  +S Q ++++I    +G      ++ + + +   C++     +K+  K+              Y   H      + Y+DP  YEDPS  V +FA EIDP +I+IE VIG GEFGEVC G+L +   +++IPVAIKTLK G +E++R +FL EA+IMGQF + NII+LEG+VTK++P+MI+ +++E GSLD+FLRK    F+ +QL+GMLRGI SGM YLS++ YVHRDLAARNILVD +L CKVSDFGLSR +E D+ E AYTT GG IPIRWTAPEAI YR+F+S+SDVWS+GIVMWEVMSYGERPYW   N+DV+ SIE GYRLPAP  CP A+H LML CW  ERS+RP+F  +   +  L+R P +L + +   HS+     D                      +   P+F    SI  WLD + +  YK+NF+      L  I   S +D+  + ++   H ++++++I+ ++     +Q + F
Sbjct:   10 IALALVGTVALTDPGHPNQVVLLDT-TAVLGELGWTTYPVNGWDAITEMDEQNRPIH---TFQVCHVMEPNQNNWLRSNWISRQAAQKVYVELRFTLRDCNSIPWVSGTCKETFNLLYLEAEEPHGPDARFHPADYAKIDTIAADESFTQTDLGDRVLRLNTEIREVGPMARKGFYLAFQDVGACIALVSVRVYYKKCPSTLRNLAAFPDTVPRVDSSSLVEVRGACVENAEE---RDTPKLYCGADGDWLVP-LGRCVCSIGHEENDG--LCLACRAGFYKAFAGNIKCSKCPPHSFSHSEASALCHCEKGFYRASKDPPTTACTRPPSPPRNLVYNINET-TLLLEWDPPTDTGGRK------DMTYNVVCRRCGGPGQPCDPCDSDVRFVPRPVGLTRPSLAVQDFMANANYTFQIEALNGVSGM---GRAARQVANITISTEQAGPSL--VGVVRKDWASQSSIALSWQEADQPHAAILDYEIKYYEKEQE-------QLSYSSTRTKVPSAIVTGLK-PSTVYAFHVRARTAAGYSSYSPKFE-----------FSTG-DEDSEEVSDQGQVLVIVTAAVGGFSLLVILTLFLLITGRCQWYIKSKLKSEDKRRTQ-----------YQNGHVPFPGIKTYVDPDTYEDPSQAVHDFAKEIDPSRIRIERVIGAGEFGEVCGGRL-RTPGKKEIPVAIKTLKGGYTERQRRDFLREASIMGQFDNPNIIRLEGVVTKSRPVMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMMYLSDIGYVHRDLAARNILVDDNLVCKVSDFGLSRVLE-DDPEAAYTTTGGKIPIRWTAPEAIQYRKFSSASDVWSYGIVMWEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMGCPVALHQLMLHCWQKERSQRPRFHDVVTFLDKLIRNPSSLLTLVEDVHSLPESPED----------------------MPDYPLF---ISIGDWLDSIKMSQYKNNFIAAGYTTLDSISSMSIDDVRRIGVSLIGHQRRIVSSIQTLRLQLLHIQQSGF 988          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Cavefish
Match: ephb1 (ephrin type-B receptor 1 [Source:NCBI gene;Acc:103025121])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 344/996 (34.54%), Postives = 539/996 (54.12%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADS--SSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVI-SHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADK-CVCNEGLFPIKSSSDL--ISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCK---------DSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCP---EALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQ 3241
            N    Y +C +   S++NWL + FI+R  A  + +E+ FT+R C S P    +C++T  L  YE+D   ++   + W +  Y +VD I+ D +++ +     +  VN +  S  P  ++GF++A +D GAC  +  +R++Y  CPS+   FA +   +  +    +   +G+C+  +E + +  +  L C   G+W +     C CK G+   D+  +C  CP  T+KSS+G+E C+ CP  S S   A   CVC  G +  ++  DL    C      PRN+  +  ++  + L W                 V + I+C  C+         D    F      ++ + V+I  L +   Y F + +++ V++   + + +     +SID      +  +  ++ Q +   RS+ +SW    + +  I+ YE+  ++  +   +S +    +    V +              Y ++VRAR+ + +G +  S ++  + L   K +   + E    ++      ++      FI+ L+AI +   C+      + N        T               GS   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEV +G+L K   +++I VAIKTLK+G SEK+R +FL EA+IMGQF H NII+LEG+VTK++P+MI+T+F+E G+LD+FLR+   QF+ +QL+GM+RGI +GMKYLSEM YVHRDLAARNILV+ +L CKVSDFGLSR ++ D ++  YT+  GG IP+RWT+PEAI +R+FTS+SDVWS+GIVMWEVMS+GERPYW+  N+DV+ +IE  YRLPAP  CP A+H LMLDCW  +R+ RP+F  I +++  L+R P   +A+ASIP                             S PLL +S P F   SS+  WL  L +  Y+DN +      L  + + +  DL+ + IT   H +K++++I++MQ
Sbjct:   44 NTIRTYQVCNVFESSQNNWLLTTFIQRRAAQRVYVEMRFTVRDCSSIPRVPGSCKETFNLYYYESDQVIATKGTAFWMEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLSKNGFYLAFQDYGACMSLLSVRVFYKKCPSVVQNFAVFPETMTGAESTSLVIARGMCIPNSEEVDVPIK--LYCNGDGEWMVP-IGSCTCKAGFEP-DNGNICRACPPGTFKSSQGTELCLQCPPNSRSTSEASTICVCRNGYY--RADGDLPDTPCTSVPSGPRNVI-SIVNETSVILEWHPPRETGGRE------DVVYNIVCKKCRADRRSCSHCDDNVDFVPRQLGLTDNRVVISNLWAHTLYTFEIQAVNGVTNKSPYPAQH-----VSIDITTNQAAPSMVPIMHQVSSTMRSITLSWPQPEQPNGIILDYELRYYEKDLTEANSTILRSQTNTARVDS--------LRTGTMYVVQVRARTVAGFGKY--SSKMCFQTLTDGKTYRSELREQLPLIAGSAAAAVV------FIVSLVAISIV--CKLSLRPDLSNCHSSMGCPTL-------------PGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSTVKIEEVIGAGEFGEVYKGRL-KLPGKREIYVAIKTLKAGYSEKQRRDFLAEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGALDSFLRQNDGQFTVIQLVGMMRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQEDTSDPTYTSSLGGKIPVRWTSPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPAPMDCPTALHQLMLDCWQKDRNARPRFTDIVNTLDKLIRNPTSLKAIASIP--------------------------SIPSQPLLDRSIPDFNTFSSVEDWLSALKMSQYRDNVLNSGFTSLQLVAQMTSEDLLRIGITLAGHQKKILSSIQSMQ 963          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009834.1 (pep scaffold:Pmarinus_7.0:GL476739:7877:63472:1 gene:ENSPMAG00000008809.1 transcript:ENSPMAT00000009834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 368/1016 (36.22%), Postives = 546/1016 (53.74%), Query Frame = 2
Query:  272 WVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIE---PRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQK-AQNKRSLFISWSLVSE-DAAIISYEV-IIHKSSINAGHSKVFNLDSQLQN---VKTPFYEFPFDKSPINS-YRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFY----CRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQ 3241
            W + SG  D    QN+P      Y +C +   +++NWLR+ +IRRD A    +E+ FT+R C S P     C++T  L++ E DS  D      + +Y+++D I+ D ++T +   + ++ + T   E     R GFF+A +D+GAC  +  +R+YY  CP++    A +   V   D   +  V+G CV  A        P++ C   G+W +     C C+PGY ++ S  +C  CP   YK + G E+C  CP +SYS      +C C  G +  +S +  ++C  P  + RN+  +  +   + L W                 V +R++C +C           + + F P  + ++   V I  L +   Y F + +++ VS L   S A P +  +S+ T   +Q+     LVVQK  + + SL +SWS   + +  I+ YE+   HK             DS+ QN   VK              + Y  +VRAR+ + +G +              + F     +++       ++ I+       IL+LI    CF     CR+     + + +K              N+   H      + Y+DP  YEDP+  V EFA EI    I I+ V+G GEFGEV  G +++   + + PVAIKTLK+G SEK+R +FL EA+IMGQF H +II+LEG+VTKT P+MIIT+++E GSLD+FLRK+  QFS  QL+GMLRGI +G+KYLS+M Y+HRDLAARN+LVD  L CKVSDFGLSR +E D+ +  YTT G  IPIRWTAPEAI + +FT++SDVWSFGI+MWEVMSYGERPYWN  N+DV+QSIE GYRLP+P  CPPA+H LMLDCW  ER+ERP  GQI   +  LL+ P +L ++P SHS           N+ +          S PLL Q+ P +    ++S+WLD + +  Y+DNF+      L  +   + +D+  + +T   H +K++N+I+ M+
Sbjct:   23 WEEISGIGD----QNMPDR---FYQVCNVMKQNQNNWLRTHWIRRDGAQRAYVELKFTLRDCNSIPGVSRTCKETFNLLVRETDS--DEEPELQEGLYSKIDTIAADESFTHVDVGDRVLKLNTEVREIGLLSRKGFFMAFQDVGACVALVSVRVYYKKCPAVVRELASFPDTVTGTDSSSLVEVRGSCVRNA---VASGDPRMHCSTDGEWLVP-IGQCVCRPGYEAIGS--ICKACPLGYYKEAAGDERCSLCPAHSYSTRETPARCFCEAGYYKAESDAVSMACTRPPSAARNVISSVNETSVI-LEWSPPQDSG------GRGDVSYRLVCQTCGGGRSPCAPCGDSVRFLPRREGLAVPGVTIAHLLAHTNYTFRIEALNGVSRL---SPAPPKAVSVSLTT---NQAAPSEILVVQKEGETRDSLTLSWSEPQQPNGIILEYELSCCHK-------------DSKEQNCTLVKASARGATVSGLRAGAVYTFRVRARTAAGFGAY------------STRVFYS-TSQASPLTGEMKEITILGACVSMVILLLIFFIACFISGGRCRHTKGGHVPDEEK-------------LNFWSGHIKLRRIKTYVDPHTYEDPAQAVHEFAKEITVSCISIQRVVGAGEFGEVYSG-VLRVPGQAEAPVAIKTLKAGYSEKQRRDFLSEASIMGQFEHPSIIRLEGVVTKTTPVMIITEYMENGSLDSFLRKQDGQFSVGQLVGMLRGIAAGVKYLSDMNYIHRDLAARNVLVDSKLVCKVSDFGLSRGLE-DDPQAVYTTHGSKIPIRWTAPEAIAFHKFTTASDVWSFGILMWEVMSYGERPYWNMTNQDVIQSIEEGYRLPSPMDCPPALHQLMLDCWQKERTERPNSGQILVYLDKLLQNPASL-NVP-SHS-----------NAQV----------SDPLLGQAVPGYTTVRTVSEWLDAIHMARYRDNFLAAGYTSLEAVRHMTLSDIHRIGVTLVGHQKKILNSIQVMR 946          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Sea Lamprey
Match: EPHB2 (EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 357/1000 (35.70%), Postives = 536/1000 (53.60%), Query Frame = 2
Query:  326 NAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADS--SSDVPSSWNDRIYTRVDIISPDITWT--DMRQDENIVNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHF----RIICISCKDSEQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTY---LSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSST--TRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
            N    Y +C +   +++NWLR+ FI R  A  + +E+ FT+R C S P    +C++T  L  YE D   ++     W +  Y +VD I+PD +++  D+      +N +  S  P  ++GF++A +D G C  +  +R+++  CP +   FA +   L       +   +G C+  AE +++  +  L C   G+W +     C CKPGY     +  C  CP  T+K  +G  +C  CP  S  S  G   CVC  G F   S    + C     +PR +  +  +   + L W A         +  +         R +C  C  +E + F P    + Q+ VL+  L +   Y F V +++ VS     S   P S  ++I T  A  S     ++ Q   +  S+ +SW    + +  I+ YE+  ++ S +  ++    + SQ    +    +      P   Y  +VRAR+ S +G +  S ++  + L           E  +Y   L  Q  L+  S       ++ + +    YCR    RS      +  +K            Q H G ST   ++YIDP  YEDP+  ++EFA EID   + IE VIG GEFGEVCRG+L +   ++++ VAIKTLKS  +EK+R +FL EA+IMGQF H NII+LEG+VTK++P+MI+T+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYLS+M YVHRDLAARNILV+ +L CKVSDFGLSR +E D T+  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ ++E  YRLPAP  CP A+H LMLDCW   R++RPKFGQI  ++  ++R P +L ++                 S + S        S PLL ++ P F   +S+ +WLD + +  YKDNF          + + +  D++ + +T   H +K++N+I+ M+   + +Q+
Sbjct:   12 NTIRTYQVCNVFEANQNNWLRTKFIERKGAQRVYVEMKFTVRDCSSIPNVPGSCKETFNLYYYETDGDVATKTKPFWMENPYIKVDTIAPDESFSQVDLGGRMMKINNELRSFGPLSKNGFYLAFQDFGGCMSLISVRVFFRKCPPVVQSFAAFPETLTGPESTSLVIARGSCILNAEEVNVPIK--LYCNGDGEWMVP-IGGCTCKPGYEPSGGRSTCNACPLGTFKPQQGEHECQQCPPGSRMSSVGGTSCVCRNGHFRAPSDPPDMPCTSTPSAPRGVMSSVNET-SVVLEWSAPLDSGRRSDLAYNVLCRLCRKDRQVCTRC--NEAVRFEPRQLGLRQTRVLVSELMAHTPYTFEVQAVNGVSEQ---SPYPPQSVAVNITTNQAAPSS--VPIIHQVTSSVTSITLSWPQPEQPNGIILDYELRYYEKSQDERNASF--MRSQTNTARVDGLQ------PGTIYVFQVRARTVSGFGRY--SGKMYFQTL-----------EEGSYPERLKEQLPLIAGSAAATIVFIVAVVVIAIVYCR---KRSYGRPDPEYTDK----------LQQYHTGHSTPGMKMYIDPFTYEDPNEAIREFAREIDISCVTIEQVIGSGEFGEVCRGRL-RMPGKREMYVAIKTLKSAYTEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLENDPTDPTYTSGMGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNEDVINAVEQDYRLPAPMDCPAALHQLMLDCWQKSRNDRPKFGQIVSTLDKMIRNPASLKAM-----------------SCVTSAP------SLPLLDRTMPDFTSFASVDEWLDAIKMGRYKDNFANTGFSSFDLVSRMTAEDILRIGVTLAGHQKKILNSIQMMRAQMNQIQA 942          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010247.1 (pep scaffold:Pmarinus_7.0:GL476398:264473:324965:1 gene:ENSPMAG00000009246.1 transcript:ENSPMAT00000010247.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 354/1006 (35.19%), Postives = 540/1006 (53.68%), Query Frame = 2
Query:  299 GWRSQNIPPNAQL---VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITW--TDMRQDENIVNVKTYSIEPRR-SGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFR-IRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISW-SLVSEDAAIISYEVIIHK-----SSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSE-PIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQN 3244
            GW    I  N       + +C + G +++NWLR+ +I RD A  + +EI FT+R C S       C++T  L  YEADS +++    +D  + +V  I+ D+ +  TD+      +N +   + P    GF++A +D+GAC  +  +R+YY  CP++    A +   V   D   +  V+G CV  A        P++ C   G+W +     C C+PGY +   +  C +C    +K   G E C  CP +SY+    + +CVC    +  +       C  P  + RN+  +  +   + L W                 V +R++C +C           + + F P  + ++   V I  L +   Y F + +++ VS L   S A P +  +S+ T  A  S ++ +L   +   K ++ +SW + V  +  I+ YEV  ++     +S N  H+KV +  + ++ ++           P   Y  +VRAR+ + +G           D V++   + G       L+    L+I S   +  +L+++A+    Y R   +R++  R  +        +       ++H    T R Y+DP  YEDP+  VQ+FA EI+P  I IE VIG GE G+VCRG+L +   + + PVAIKTLK+G SEK+R +FL EA+IMGQF H +II+LEG+VTK++P+MIIT+++E GSLD FLR    QFS  QL+GMLRGI +GMKYLS+M Y+HRDLAARN+LV+  L CKVSDFGLSR +E D+ +  YTT GG IPIRWTAPEAI +R+FTS+SDVWSFG++MWEVMSYGERPYW+  N+DV+QSIE GYRLP P  CPPA+H LMLDCW  ER+ERP F QI   +  LL+ P +L      H++     +                  S PLL+ + P +    S+ +WLD + +  YK+NF    L+    + + +  DL  + +T   H +++M +I+ +++
Sbjct:   53 GWEELTIMLNQTTPVQTFQVCNM-GSNQNNWLRTRWIARDPAQRVYVEIKFTLRDCGSMAGVASTCKETFNLYYYEADSGAEI----DDGKFAKVGTIASDMIFDKTDVIDRVLKLNTEVRELPPLSWPGFYLAFQDVGACVALVSVRVYYKKCPAVVRELASFPDTVTGTDSSPLVEVRGSCVPNA---VASGDPRMHCSTDGEWLVP-IGQCVCRPGYEAAGHE--CRECGTGYFKVLAGEENCTPCPNHSYTTSETSTECVCESDFYRAEGDGPASPCTRPPSAARNVISSVNETSVI-LEWSPPQDSG------GRGDVSYRLVCQTCGGGRSPCAPCGDSVRFLPRREGLAVPGVTIAHLLAHTNYTFRIEALNGVSRL---SPAPPKAVSVSLTTNQAAPS-KIDSLNADRP-TKDTVQLSWPAPVKPNGVILDYEVKYYEVGQRDTSYNILHTKVPS--ASIEGLR-----------PDLVYGFEVRARTAAGYG--------KPSDPVEIDTSEDGFVTHPGALT--QVLVIASCVFVAVVLIVLAL---VYVRRRRSRNIAARGDEEEQFPIKPN-------EVHL--RTKRNYVDPFTYEDPNKAVQDFAREIEPSWIIIEKVIGSGESGDVCRGRL-RVPGQAEAPVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPSIIRLEGVVTKSKPVMIITEYMENGSLDGFLRGNDGQFSVGQLVGMLRGIAAGMKYLSDMNYIHRDLAARNVLVNSKLVCKVSDFGLSRGLE-DDPQAVYTTHGGKIPIRWTAPEAIAFRKFTSASDVWSFGVLMWEVMSYGERPYWDMNNQDVIQSIEEGYRLPEPMDCPPALHQLMLDCWQKERTERPNFAQILAYLDKLLQNPASL------HAVAHPGSERL----------------SNPLLERKAPEYTMFCSVGEWLDDIKMGRYKENFTNAGLVSWPAVAQMTPEDLQKVNVTLAGHQKRIMTSIQTLRS 976          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007292.1 (pep scaffold:Pmarinus_7.0:GL476471:161062:207122:1 gene:ENSPMAG00000006520.1 transcript:ENSPMAT00000007292.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 368/1047 (35.15%), Postives = 555/1047 (53.01%), Query Frame = 2
Query:  188 LISVFSIVNCRVPNYVELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLV---YGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIE-PRRS--GFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISH-DFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDP-GADKCVCNEGLFPIKSSSDLIS--CAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGPD-VSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHK-----SSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDL--VKLKAFDGGIDE-SNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSE-PIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQ 3241
            LI+  S    R+   V LL+T T+ +      +    GW    I  N   +   Y +C +   +++NWLR+ +I RD A  + +EI FT+R C S       C++T  L  YEADS S   ++ ++ ++ +V  I+ D  + ++   + ++ + T   E P  S  GF++A +D+GAC  +   R+YY  CP++    AR+   V +     +  V+G CV  A   +    P++ C   G+W +     C C  GY +  S+  C  C    YK++ G + C  CP  S++    +  C C  G +  ++ +D +S  C  P  + RN+  +  +   + L W                 V +R++C +C           + + F P  + ++   V I  L +   Y F + +++ VS L   S A P +  +S+ T  A  S ++ +L  +  Q K  + +SW    + +  I+ YE+  ++     +S N  H+KV +  + ++ ++               Y  +VRAR+ + +G      +IN      V L    GG  E SNT   +   +  + +       ++     CF+                     S + D   Y ++       R Y+DP  YEDP+  VQEFA EI+P  I IE VIG GE GEVCRG+L +   + + PVAIKTLK+G SEK+R +FL EA+IMGQF H +II+LEG+VTK++P+MIIT+F+E GSLD FLR    QF+  QL+GMLRGI +GMKYLS+M Y+HRDLAARN+LVD  L CKVSDFGLSR +E D+ +  YTT GG IPIRWTAPEAI +R+FTS+SDVWSFG++MWEVMSYGERPYW+  N+DV+Q+IE GYRLPAP  CPPA+H LMLDCW  ER+ERP F QI   +  LL+ P +L      H+  + SV+                  S PLL+ + P +    S+ +WLD + +  YK+NF    L+    + + + +DL  L +T   H +++M +I+ ++
Sbjct:   17 LITTNSCRTGRLIFTVNLLDT-TNIFGQLGWEATPTTGWEEMAIQINQTALIQAYQVCNVVKPNQNNWLRTRWIARDPAQRVYVEIKFTLRDCGSMAGVASTCKETFNLYYYEADSGSS--ANMDESLFAKVGTIAADSNFDNVDVKDRVLKLNTEVRELPPLSWPGFYLAFQDVGACVALVSARVYYKKCPAVVRDLARFPDTVANALSSPLVEVRGSCVPNAVAAT---DPRMHCSTDGEWLVP-IGLCVCHAGYEAAGSQ--CRACGLGYYKNTTGGQPCDLCPPESFTTRLASTHCGCKAGYY--RAEADPVSSPCTRPPSAARNVISSVNETSVI-LEWSPPQDSG------GRGDVSYRLVCQTCGGGRSPCAPCGDSVRFLPRREGLAVPGVTIAHLLAHTNYTFRIEALNGVSRL---SPAPPKAVSVSLTTNQAAPS-KIRSLWYE-MQTKDHVKLSWFQPDQPNGIILDYEIKYYEKGQRDTSYNILHTKVPS--ASIEGLRAKIV-----------YGFEVRARTAAGFGKPSDPVEINTDQYRKVTLVVCSGGFTEHSNTTRVAVIVVCAVILLAFIVFTVVCIRRSCFFL------------------LPSIAGDENVYMKLKF--PNRRNYVDPFTYEDPNKAVQEFAREIEPSWITIEKVIGSGESGEVCRGRL-RVPGQAEAPVAIKTLKAGYSEKQRRDFLSEASIMGQFEHPSIIRLEGVVTKSKPVMIITEFMENGSLDAFLRGNDGQFNVGQLVGMLRGIAAGMKYLSDMNYIHRDLAARNVLVDSKLVCKVSDFGLSRGLE-DDPQAVYTTHGGKIPIRWTAPEAIAFRKFTSASDVWSFGVLMWEVMSYGERPYWDMNNQDVIQAIEEGYRLPAPMDCPPALHQLMLDCWQKERTERPNFAQILAYLDKLLQNPASL------HATSQSSVEL-----------------SNPLLERKAPEYTMFCSVGEWLDDIKMGRYKENFTNAGLVSWPAVAQMTPDDLQRLGVTLAGHQKRIMTSIQTLR 982          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002245.1 (pep scaffold:Pmarinus_7.0:GL476603:2572:131951:1 gene:ENSPMAG00000001992.1 transcript:ENSPMAT00000002245.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 509.22 bits (1310), Expect = 4.744e-163
Identity = 343/1020 (33.63%), Postives = 517/1020 (50.69%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHD-FRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSD-PGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQL-------------------------FFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDK-SPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCF-----YCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIF-HSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQ-SEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAV 3280
             Y +C +   S++NWLR+ +I    A  I IE+ FT+R C S P     C++T  L  YE+DS S      N   + ++D I+ D ++T +     I  +N +   + P  + GF +A +D+GAC  +  +R+YY  CP      A +   V   D   +  V+G CVD +   + ++ P++ C   G+W +     C C PGY  +     C  C    YK   G + C  CP +S S   G+  C C+E  +  K+    ++C     SP     +  D  Q  L W A               +++ + C  C  +E L                         F      V++  V +  L +   Y F V + + VS L   + A P SA + +   PA     L   V Q   +K ++ +SWS     ++ I+ YE+           S+    +     VK+ +     +   P   Y  +VR R+ + +G +  SK  + +     +  D   D       SQ+ ++ +SV   G I++LI +  CF     YC Y       ++ K+N ++      D  ++     G    ++YIDP  YEDP   V EFA EID   I+IE V+G GEFGEVCRG+L +   + +  VAIKTLK+G +E++R +FL EA+IMGQF H NII+LEG++TK+ P+MI+T+++E GSLD+FLRK   QF+++QL+GMLRGI +GMKYLS+M YVHRDLAARNILV+ +L CKVSDFGLSR +E D+ E AYT KGG IP+RWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+D+ +  + G + P PK+       L +      R  +  + ++  + ++A++R                 S  SYR          +      P L+ S P+F    S+  WLD + +  YKDNF      +L  + + S +D++ + IT   H +K++N+I+ M+     +Q +   V
Sbjct:   16 TYQVCHVMEPSQNNWLRTNWISCGGAQRIYIELKFTLRDCSSIPGVAGTCKETFNLHYYESDSDSSAHVDENQ--FFKIDTIAADESFTQVDLGGRIMKLNTEVRDVGPLAKKGFHLAFQDVGACIALVSVRVYYKRCPRTVRGLAVFPDTVTGADSSSLIEVRGACVDNS---AEKEAPRMFCSADGEWLVP-IGRCVCGPGYEEV-VVGACRACGIGFYKEIAGEQMCSKCPPHSLSHRAGSYDCECDESYYRAKADPKSMACTRSTWSPSEGLTSVKDPTQT-LEWSAPSDTGGRRV------LNYSVACRVCAPAEPLPASGDDGSSGAAGSPRCLPCGAEVRFAPRQSGVTERRVTVTGLAAHTNYTFEVRATNGVSEL---TRAPPQSASIRLTMNPAAPGQILD--VRQNRISKDAIALSWSEPKHPNSVILDYEITF---------SEKEQTEISYTTVKSKWNTITINGLKPSTIYTFQVRTRTTAGYGQY--SKPFHFQ--TSNEPLDISSD------PSQSTIVWLSV-ATGIIVVLIIV--CFLLKGRYCGY-------SKAKQNCDE------DKQHFQVKLPG---LKMYIDPFTYEDPCEAVHEFAREIDVSYIKIEGVVGAGEFGEVCRGRL-RLPGKGEASVAIKTLKAGYTEEQRRDFLCEASIMGQFDHPNIIRLEGVITKSIPVMIVTEYMENGSLDSFLRKNDGQFTSIQLVGMLRGIAAGMKYLSDMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLE-DDPEAAYTAKGGRIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDITRVYDEGEKAPPPKKNDTTFRCLHVSIDQKHRERQRNYCRVGSNEVNAMVR-----------------SERSYRGGGG------EGAMPQNPFLEHSVPLFIAFRSVGDWLDVIKMGRYKDNFAVAGFNHLESVAQMSLDDVIRIGITLVGHQKKILNSIQIMRAQMVQMQDSGVQV 953          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 95.1301 bits (235), Expect = 3.362e-20
Identity = 67/259 (25.87%), Postives = 121/259 (46.72%), Query Frame = 2
Query: 2114 QIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSI 2890
             ++ VIG G +G V +   I     Q   VAIK +    +++E  + + E +++    H+NI++  G + K+  + I+ ++   GSL   + +     S  +    +   + G+KYL     +HRD+ A NIL+  D   K++DFG+S  + +     A T  G L    W APE +  R  ++ SD+WS G  + E+++    PY N  + ++  ++E+    P      P    L   C+     +RP   Q+   +
Sbjct:   26 HLKQVIGRGSYGVVYKA--INKHTDQ--VVAIKEVVYE-NDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNS----SALTLAGTL---NWMAPEILGNRGASTLSDIWSLGATVVEMLTKNP-PYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLS-KCFVKNMYKRPTADQLLKHV 270          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 87.8113 bits (216), Expect = 6.748e-18
Identity = 59/235 (25.11%), Postives = 119/235 (50.64%), Query Frame = 2
Query: 2126 VIGEGEFG------EVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRR-FTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPP 2809
            +IG+G FG       V  G+++  + + ++P      ++  S  E +    E + +    H NI+Q  G   K     +  +++  GS+ + +R    +F    +  +   ++ G+ YL     +HRD+ A N+L+D+D  CK+SDFG+SR+ +   +    T +G +    W APE ++ ++ +++  D+WS G ++ E+ + G+RP+ N      L+ + + +++   K  PP
Sbjct: 1180 MIGKGSFGAVYLCLNVTTGEMMAVK-QVEVPKYSSQNEAILSTVEALR--SEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYG-RFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGTVF---WMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSN------LEVVAAMFKIGKSKSAPP 1400          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 81.6481 bits (200), Expect = 1.257e-16
Identity = 67/240 (27.92%), Postives = 114/240 (47.50%), Query Frame = 2
Query: 2111 IQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEK----ERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIH 2818
             QI   +G G FG V    LI+  +  +   A+KTLK     K    E  N   E  ++    H  II++ G    +Q + ++  +IE G L + LRK + +F           +   ++YL     ++RDL   NIL+DK+   K++DFG ++ +     +  YT  G      + APE ++ + +  S D WSFG++++E+++ G  P++N       ++I     L A  + PP  H
Sbjct:   88 FQILRTLGTGSFGRV---HLIRSNHNGRF-YALKTLKKHTIVKLKQVEHTN--DERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQ-RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV----PDVTYTLCGT---PDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLA-GYTPFYNSNTMKTYENI-----LNAELKFPPFFH 307          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Yeast
Match: KIN4 (Serine/threonine protein kinase; inhibits the mitotic exit network (MEN) when the spindle position checkpoint is activated; localized asymmetrically to mother cell cortex, spindle pole body and bud neck; KIN4 has a paralog, FRK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005759])

HSP 1 Score: 80.1073 bits (196), Expect = 1.199e-15
Identity = 60/208 (28.85%), Postives = 107/208 (51.44%), Query Frame = 2
Query: 2117 IETVIGEGEFGEVCRGKLIKYEYRQKIP--VAIKTLKSGCSEKE---RMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKY--QFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPE-AINYRRFTS-SSDVWSFGIVMWEVMS 2713
            I + +GEGEFG+V  G   K     ++P  VAIK ++    +K+    +    E   +    H NII LE ++  ++ I I+ +F+  G    ++++K+   + S  +L   L   +SG+ Y+     VHRDL   N+L+DK     ++DFG   E   DN E   T+ G      + APE  ++ + + +  +DVWS G++++ +++
Sbjct:   48 IGSTLGEGEFGKVKLG-WTKASSSNEVPKQVAIKLIRRDTIKKDADKEIKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQL---ISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDN-ELMKTSCGSPC---YAAPELVVSTKAYEARKADVWSCGVILYAMLA 247          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 78.1814 bits (191), Expect = 3.775e-15
Identity = 53/189 (28.04%), Postives = 93/189 (49.21%), Query Frame = 2
Query: 2201 VAIKTLKSGCSEKERMNFLM-EAAIMGQFCHSNIIQ-LEGIVTKTQPIMIITQFIEFGSL----DTFLRKKKYQFSTL----QLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWN 2737
            VAIK ++   SE+ +   +M E  +M      NI+  LE  +   + + +I +++E G L    D   R    + S+     Q+  +++    G+K+L   + +HRD+ + NIL++     K++DFG   E+    ++ A           W APE +N + +    DVWS GI++ E++  GE PY N
Sbjct:  403 VAIKQIR--LSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPY----WMAPEIVNQKGYDEKVDVWSLGIMLIEMIE-GEPPYLN 584          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 378.637 bits (971), Expect = 1.686e-120
Identity = 189/415 (45.54%), Postives = 260/415 (62.65%), Query Frame = 2
Query: 2000 SQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQN 3244
            S++   +   R+YIDPSNY DP   ++ FA E+D   +++E VIG GEFG+V +G L K      IPVAIKTLK G + K R +FL EA++MGQFC  N+I LEG+V+KT P+MI+T+F+  GSLD FL+K   + S +QL+GM RGI SGMKYLSEM +VHRDLAARNILV + L CKV+DFGLSRE+E    + AY T GG IP+RWTAPEAI YR+F++SSDVWS+GI++WE  S+ ERPYW+W N +V+  +E+GYRLP P  CP  IH +ML+CW  +R++RP F  I   + +L+R PE L                 + N S+I         S P +    I    +++ +WL  + +  Y ++F +     L  I +    DL  L +    H  K+  +I  ++ 
Sbjct:   21 SEVDLPTCGQRVYIDPSNYNDPEEALRNFAKELDKRWLKLEKVIGGGEFGDVYKGTL-KRPGENTIPVAIKTLKQGSTSKNRGDFLSEASVMGQFCDPNVIFLEGVVSKTHPLMIVTEFMSNGSLDNFLKKMDSKLSLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVTETLVCKVADFGLSRELE----DSAYETSGGKIPVRWTAPEAIKYRKFSTSSDVWSYGILLWETFSFAERPYWDWSNFEVMDRVETGYRLPPPMSCPKVIHQIMLECWDADRTKRPSFALIVKQLDSLIRSPEKL-----------------KDNQSVI--------QSKPNIDYSEI----TTVEEWLGSIKMGQYTEHFKQAGYRDLQTIAESEEPDLDGLGVKLIGHKNKIRKSIREVKG 401          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 371.703 bits (953), Expect = 3.649e-118
Identity = 181/419 (43.20%), Postives = 262/419 (62.53%), Query Frame = 2
Query: 2033 IYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIE--ADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAVL 3283
            +YIDPSNY DP   +   A EI+ + +++E +IG GEF +V RG L   +  Q+  VA+K LK G S K R +F +EA+IMGQF H N+I L+G++T+T+P+MIIT+F+E GSLD FL+    + +TLQL+G+ RG+ +GM YLSEM ++HRDLAARNILV  +L  KVSDFGLSRE++   +N +  Y T+GG IP+RWTAPEAI YR+F+S+SDVWS+GI++WE+MS+GERPYW W N  V+  +E GYRLPAP +CP  IH LMLDCW  E++ RPKF  I      ++R P+ +                   +    S  +   F++T +   +       S+ +WL+ +++  Y D FV    + +  I     +DL+ + I    H  K+  +I+ +      L++   A+L
Sbjct:    1 MYIDPSNYGDPMEALMSVAKEINKDDLKLEIIIGGGEFADVYRGVLTNEDKTQE-KVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRFDEVIRSPDKM------------------NDEFTGSRIRYVEFSATNMSMVK-------SVEEWLENINMGRYADAFVSSGYVDIDRIRHLEDDDLLKMGINLIGHRNKIRKSIKHINQ---KLETGELAIL 390          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Nematostella
Match: EDO28980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4Y3])

HSP 1 Score: 322.013 bits (824), Expect = 1.184e-100
Identity = 153/350 (43.71%), Postives = 222/350 (63.43%), Query Frame = 2
Query: 2225 GCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIE--ADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSA 3268
            G S K R +F +EA+IMGQF H N+I L+G++T+T+P+MIIT+F+E GSLD FL+    + +TLQL+G+ RG+ +GM YLSEM ++HRDLAARNILV  +L  KVSDFGLSRE++   +N +  Y T+GG IP+RWTAPEAI YR+F+S+SDVWS+GI++WE+MS+GERPYW W N  V+  +E GYRLPAP +CP  IH LMLDCW  E++ RPKF  I   +  ++R P+ +                   +    S  +   F++T +   +       S+ +WL+ +++  Y D FV    + + HI     +DL+ + I    H  K+  +I+ +    +T + A
Sbjct:    1 GSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRLDEVIRSPDKM------------------NDEFAGSRIRYVEFSATNMSMVK-------SVEEWLENINMGRYADAFVGSGYVDIDHIRHLEDDDLLKIGINLIGHRNKIRKSIKHINQKLETGELA 325          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Nematostella
Match: EDO33731 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD2])

HSP 1 Score: 317.005 bits (811), Expect = 7.695e-100
Identity = 144/257 (56.03%), Postives = 194/257 (75.49%), Query Frame = 2
Query: 2030 RIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIE--ADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAP 2794
            R+YIDPSNY DP   +   A EI+ + +++E +IG GEF +V RG L   +  Q+  VA+K LK G S K R +F +EA+IMGQF H N+I L+G++T+T+P+MIIT+F+E GSLD FL+    + +TLQL+G+ RG+ +GM YLSEM ++HRDLAARNILV  +L  KVSDFGLSRE++   +N +  Y T+GG IP+RWTAPEAI YR+F+S+SDVWS+GI++WE+MS+GERPYW W N  V+  +E GYRLPAP
Sbjct:    3 RMYIDPSNYGDPMEALMSVAMEINKDDLKLEIIIGGGEFADVYRGVLTNEDKTQE-KVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAP 258          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Nematostella
Match: EDO33732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD3])

HSP 1 Score: 316.235 bits (809), Expect = 1.397e-99
Identity = 144/257 (56.03%), Postives = 194/257 (75.49%), Query Frame = 2
Query: 2030 RIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIE--ADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAP 2794
            R+YIDPSNY DP   +   A EI+ + +++E VIG GEF +V RG L   +  Q+  VA+K LK G S K R +F +EA+IMGQF H N+I L+G++T+T+P+MIIT+F+E GSL+ FL+    + +TLQL+G+ RG+ +GM YLSEM ++HRDLAARNILV  +L  KVSDFGLSRE++   +N +  Y T+GG IP+RWTAPEAI YR+F+S+SDVWS+GI++WE+MS+GERPYW W N  V+  +E GYRLPAP
Sbjct:    1 RMYIDPSNYGDPMEALMSVAKEINKDDLKLEIVIGGGEFADVYRGVLTNEDKTQE-KVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLENFLKSNDGRLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAP 256          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Medaka
Match: epha4b (ephrin type-A receptor 3 [Source:NCBI gene;Acc:101168573])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 353/1002 (35.23%), Postives = 542/1002 (54.09%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSW--NDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPR------RSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQ--------LFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCF-----YCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPE---SSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQ 3262
             Y +C +   +++NWLR+  I R+ A  I IEI FT+R C S P     C++T  +  YE+++     + W   +  Y ++D I+ D ++T +   + ++ + T   E R      + GF++A +D+GAC  +  +R++Y  CP      A++   +   D  +  V G+CV+ +E     + P++ C   G W +     C CKPG+   ++K VC  C   TYK+S     C  CP +S S    AD+C+C +G +  +S    ++C  P  +P N      ++  + L W +               + + I C  C    +        + F P    +S ++VLI  L+   TY F + S + VS L   S     + ++++ T       Q  ++V+++ ++K S+ ++W      + AI+ YEVI ++ +    +  V    S +  V            P  +Y  +VRAR+   +G +    ++       L   D           +Q+ ++++S+   G I++ + +  CF     +C Y+  +   + +K               +         +R YI P  YEDP+  V++FA EID   I+IE VIG GEFGEVC G+L + + +++I VAIK+LK+G S+K+R +FL EA+IMGQF H NII+LEG+VTK +P+MIIT+F+E GSLDTFL+K   QF+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFGLSR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEV+SYGERPYW   N+DV+++I+ GYRLPAP  CP  +H LMLDCW   RS+RPKFGQI   +  L+R P +L  +  S                              L+ SE    PE   S++ +WLD + +  YK+NF     + L  I   S ++LV + +T   H +K++++++++Q     +Q
Sbjct:   73 TYQVCNVMEANQNNWLRTRHISREGAQRIYIEIKFTLRDCNSLPGVPGTCKETFNMYYYESNNV----NLWFIKESQYVKIDTIAADESFTQVDVGDRVMKLNT---EVRDISNLSKKGFYLAFQDLGACIALVSVRVFYKKCPLTVLNLAQFPDTITGGDTALVEVHGMCVNASEEF---EPPKMYCSADGGWLVP-IGRCVCKPGFE--ENKDVCQPCRPGTYKASATDAFCTKCPPHSSSPQEQADECICEKGFYRAESDPRSMACTRPPSAPENPIST-ANETCVTLEWSSPRDTG------GRGDITYSIQCKKCFGEAKKCTPCGSSVHFVPRQFGLSSNTVLITELQPDSTYSFIIESQNGVSDL---SPIPRGTVVINVTTS------QTVSVVLKERRSKDSVTLAWQGPERPNGAIVEYEVIYYEKNQREQNYTVLKTRSNMMTVD--------GLKPGTTYVFRVRARTDGGYGSYGGEIELETSHEDVLAIGD----------PNQSTILVVSI--TGGIVVFVFLVTCFVVSSRHCGYIKAKQDPDEEK-------------MQFQHGRVKLPGSRTYIHPHTYEDPNQAVRDFAKEIDASNIRIERVIGGGEFGEVCSGRL-RVQGKREIYVAIKSLKAGYSDKQRRDFLSEASIMGQFDHPNIIRLEGVVTKCKPVMIITEFMENGSLDTFLKKHDGQFTIIQLVGMLRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVVSYGERPYWEMSNQDVIKAIDEGYRLPAPMDCPVVLHQLMLDCWEKSRSDRPKFGQIVTILDKLIRNPASLRELAKS------------------------------LVCSEDPSSPEFSVSTVDEWLDAIKMGQYKENFSSSGYVSLDSILYISVSELVKMGVTLAGHQKKILSSVQSLQTQGTHIQ 980          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Medaka
Match: ephb2a (ephrin type-B receptor 2-like [Source:NCBI gene;Acc:101156311])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 353/1001 (35.26%), Postives = 547/1001 (54.65%), Query Frame = 2
Query:  338 VYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADS--SSDVPSSWNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDV---------SQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQ---LQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMI-ISVFGMGFILML-IAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLD-MANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQS 3265
             Y +C +   S++NW+R+ +IRR  A  I + + F++R C S P    +C++T  L  YE+DS  ++     W +  + +VD I+ D +++ +     I  +N +  S  P  RSGF++A +D GAC  +  +R++Y  CP +    A +   L  +    +   +G+CV   E + +  +  L C   G+W +     C CK GY +L++  VC  C    +KS++G ++C  CP  S +   GA  C+C    +   S    + C     +P+N+  +  ++  L+L W+                V + IIC SC     L    G +V         + + V I  L +   Y F + +++ VS    +S   P  A ++I T  A  S    +++ Q ++   ++ +SWS   + +  I+ YE+  ++ +    +S +    +    +QN+K           P + Y  +VRAR+ + +G F  S ++  + +          +E N+ +  +  L+I  S  G+ FI+ + + I +C             R ++N ++  S   D + +Y+  H  S   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L +   +++I VAIKTLK+G +E++R +FL EA+IMGQF H NII LEG+VTK+ P+MIIT+F+E GSLD+FLR+   QF+ +QL+GMLRGI +GMKYL +M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTSSSD WS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKF QI  ++  ++R P +L                     ++  +S   H    PLL +S P F    S+  WLD + +  YK+NF          + + +  D++ + +T   H +K++N+I++M+   + + S
Sbjct:   55 TYQVCNVFDNSQNNWIRTKYIRRRGAQRIHVLMKFSVRDCSSIPNVPGSCKETFNLYYYESDSDVATKTFPPWMENPWVKVDTIAADESFSHVDLGGRIMKINSEVRSFGPVSRSGFYLAFQDYGACMSLIAVRVFYRKCPRVVQNGAVFPETLSGAESTSLVAARGVCVPNGEEVDVPIK--LYCNGDGEWMVP-IGRCMCKAGYEALENGTVCKACLSGFFKSAQGDDRCRQCPINSRTIHEGATNCICRNSYYRTDSDPPQMPCTTIPSTPQNVI-SIVNETSLRLEWNPPQESGGRD------DVVYNIICKSCGSGRGLCTRCGDNVQFVPRQLGLTNTQVYISDLLAHTQYTFEIQAVNGVSDQSPYS---PQYASVNITTNQAAPSA--VSIIHQVSRTPNTITLSWSQPDQPNGVILDYELQYYEKNQAEWNSSLIRSQTNTAVVQNLK-----------PGSIYVFQVRARTVAGFGRF--SGKMYFQTMTD--------EEYNSTIQEKLPLIIGSSAAGVVFIIAITVVITVC-------------RGRRNSDRPESEYADKLQHYTSGHKVSPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGNL-RQPGKREILVAIKTLKAGYTERQRRDFLSEASIMGQFDHPNIIHLEGVVTKSSPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLCDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSSSDCWSYGIVMWEVMSYGERPYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVANLDKMIRNPSSL--------------------KAMTPQSSSVHL---PLLDRSTPDFSSFGSVDDWLDAIKMGQYKENFSSEGFTSFDVVSQMAMEDILRVGVTLAGHQKKILNSIQSMRAQLNQITS 982          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Medaka
Match: ephb2b (ephrin type-B receptor 2 [Source:NCBI gene;Acc:101165974])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 365/1022 (35.71%), Postives = 562/1022 (54.99%), Query Frame = 2
Query:  266 NDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSS--WNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEAL-ASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSA 3268
            N W + SG YD    +N+  N    Y +C +   +++NW+R+ +IRR  A  I +E+ F++R C S P    +C++T  L  YE+DS +   +S  W +  + +VD I+ D +++ +     +  +N +  S  P  ++GF++A +D G C  +  +R++Y  CP I    A +   L  +    +   +G+C+  AE + +  +  L C   G+W +     C CK G  ++++  VC  CP   +KS++G + C+ CP  S  +  GA  CVC  G +   S    + C     +P+ +  +  ++  + L W +               V + IIC SC           + + F P    +++S V I  L +   Y F V +++ VS    +S   P  A ++I T  A  S    +++ Q +++  S+ +SWS   + +  I+ YE+  ++  ++  ++    + SQ   V     +      P + Y  +VRAR+ + +G +  S ++  + + +        +E NT  S Q KL +II     G + ++  + +   C         NR++         +  + +Y+  H  +   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   ++++ VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLDTFLR+   QF+ +QL+GMLRGI SGMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKF QI +++  ++R P  L A  PLS  +                     H    PLL +S P F   SS+ +WLD + +  YKDNF          + + +  D++ + +T   H +K++N+I+ M+   + +QS 
Sbjct:   37 NSWEEVSG-YD----ENM--NTIRTYQVCNVFDSNQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYYESDSDTANRNSPPWMENPWIKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSKNGFYLAFQDYGGCMSLIAVRVFYRKCPRIITNGALFQETLSGAESTSLVAARGVCIPNAEEVDVPIK--LYCNGDGEWMVP-IGRCMCKAGNEAVENGTVCRACPSGFFKSTQGDQLCLQCPINSRTTSEGAINCVCRNGYYRTDSDPLQMPCTTVPSAPQAVISS-VNETSVMLEWMSPRDSGGRE------DVVYNIICKSCGGGRGGCTRCGDNVQFVPRQLGLTESRVYISDLLAHTQYTFEVQAVNGVSDQSPYS---PQYASVNITTNQAAPST--VSIMHQVSRSVDSITLSWSQPDQPNGVILDYELQYYEKDLSEHNAST--IRSQTNTVVIRGLK------PGSIYVFQVRARTVAGFGRY--SGKLYFQTMTE--------EEYNT--SIQEKLPLIIGSAAAGLVFLIALVVIIIVC---------NRRRGFDRHDSEYTDKLQHYTSGHM-TPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGNL-KLPGKREMFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDTFLRQNDGQFTVIQLVGMLRGIASGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNNLDKMIRNPNTLKAMTPLSSGV---------------------HL---PLLDRSIPDFSTFSSVDEWLDAIKMGQYKDNFANSDFSTFDVVSQMTMEDILRVGVTLAGHQKKILNSIQTMRAQMNQIQSV 981          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Medaka
Match: ephb2b (ephrin type-B receptor 2 [Source:NCBI gene;Acc:101165974])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 366/1022 (35.81%), Postives = 564/1022 (55.19%), Query Frame = 2
Query:  266 NDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSS--WNDRIYTRVDIISPDITWTDMRQDENI--VNVKTYSIEP-RRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSR-LVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYS-YSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDS--------EQLFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKL-MIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEAL-ASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLL-QSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSA 3268
            N W + SG YD    +N+  N    Y +C +   +++NW+R+ +IRR  A  I +E+ F++R C S P    +C++T  L  YE+DS +   +S  W +  + +VD I+ D +++ +     +  +N +  S  P  ++GF++A +D G C  +  +R++Y  CP I    A +   L  +    +   +G+C+  AE + +  +  L C   G+W +     C CK G  ++++  VC  CP   +KS++G + C+ CP  S  +  GA  CVC  G +   S    + C     +P+ +  +  ++  + L W +               V + IIC SC           + + F P    +++S V I  L +   Y F V +++ VS    +S   P  A ++I T  A  S    +++ Q +++  S+ +SWS   + +  I+ YE+  ++  ++  ++    + SQ   V     +      P + Y  +VRAR+ + +G +  S ++  + + +        +E NT  S Q KL +II     G + ++  + +   C         NR+  + + +  T   + +Y+  H  +   +IYIDP  YEDP+  V+EFA EID   ++IE VIG GEFGEVC G L K   ++++ VAIKTLKSG +EK+R +FL EA+IMGQF H N+I LEG+VTK+ P+MIIT+F+E GSLDTFLR+   QF+ +QL+GMLRGI SGMKYL++M YVHRDLAARNILV+ +L CKVSDFGLSR +E D ++  YT+  GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEVMSYGERPYW+  N+DV+ +IE  YRLP P  CP A+H LMLDCW  +R+ RPKF QI +++  ++R P  L A  PLS  +                     H    PLL +S P F   SS+ +WLD + +  YKDNF          + + +  D++ + +T   H +K++N+I+ M+   + +QS 
Sbjct:   43 NSWEEVSG-YD----ENM--NTIRTYQVCNVFDSNQNNWVRTKYIRRRGAQRIHVEMKFSVRDCSSIPNVPGSCKETFNLYYYESDSDTANRNSPPWMENPWIKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSKNGFYLAFQDYGGCMSLIAVRVFYRKCPRIITNGALFQETLSGAESTSLVAARGVCIPNAEEVDVPIK--LYCNGDGEWMVP-IGRCMCKAGNEAVENGTVCRACPSGFFKSTQGDQLCLQCPINSRTTSEGAINCVCRNGYYRTDSDPLQMPCTTVPSAPQAVISS-VNETSVMLEWMSPRDSGGRE------DVVYNIICKSCGGGRGGCTRCGDNVQFVPRQLGLTESRVYISDLLAHTQYTFEVQAVNGVSDQSPYS---PQYASVNITTNQAAPST--VSIMHQVSRSVDSITLSWSQPDQPNGVILDYELQYYEKDLSEHNAST--IRSQTNTVVIRGLK------PGSIYVFQVRARTVAGFGRY--SGKLYFQTMTE--------EEYNT--SIQEKLPLIIGSAAAGLVFLIALVVIIIVC---------NRRGFDRHDSEYTD-KLQHYTSGHM-TPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGNL-KLPGKREMFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSSPVMIITEFMENGSLDTFLRQNDGQFTVIQLVGMLRGIASGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNNRPKFSQIVNNLDKMIRNPNTLKAMTPLSSGV---------------------HL---PLLDRSIPDFSTFSSVDEWLDAIKMGQYKDNFANSDFSTFDVVSQMTMEDILRVGVTLAGHQKKILNSIQTMRAQMNQIQSV 986          
BLAST of Ephrin type-B receptor 2 vs. Ensembl Medaka
Match: epha4b (ephrin type-A receptor 3 [Source:NCBI gene;Acc:101168573])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 357/1018 (35.07%), Postives = 548/1018 (53.83%), Query Frame = 2
Query:  341 YGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSW--NDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPR------RSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYS-DPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQ--------LFFTPGP-DVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSE-DAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTF---STSLDMANYS----------------QIHAGS---STTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPE---SSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQ 3262
            Y +C +   +++NWLR+  I R+ A  I IEI FT+R C S P     C++T  +  YE+++ +     W   +  Y ++D I+ D ++T +   + ++ + T   E R      + GF++A +D+GAC  +  +R++Y  CP      A++   +   D  +  V G+CV+ +E     + P++ C   G W +     C CKPG+   ++K VC  C   TYK+S     C  CP +S S    AD+C+C +G +  +S    ++C  P  +P N      ++  + L W +               + + I C  C    +        + F P    +S ++VLI  L+   TY F + S + VS L   S     + ++++ T       Q  ++V+++ ++K S+ ++W      + AI+ YEVI ++ +    +  V    S +  V            P  +Y  +VRAR+   +G +    ++       L   D           +Q+ ++++S+   G I++ + +  CF    + + S+  R    V+ +    + SL +  +                 Q   G      +R YI P  YEDP+  V++FA EID   I+IE VIG GEFGEVC G+L + + +++I VAIK+LK+G S+K+R +FL EA+IMGQF H NII+LEG+VTK +P+MIIT+F+E GSLDTFL+K   QF+ +QL+GMLRGI SGMKYLS+M YVHRDLAARNILV+ +L CKVSDFGLSR +E D+ E AYTT+GG IPIRWTAPEAI YR+FTS+SDVWS+GIVMWEV+SYGERPYW   N+DV+++I+ GYRLPAP  CP  +H LMLDCW   RS+RPKFGQI   +  L+R P +L  +  S                              L+ SE    PE   S++ +WLD + +  YK+NF     + L  I   S ++LV + +T   H +K++++++++Q     +Q
Sbjct:   74 YQVCNVMEANQNNWLRTRHISREGAQRIYIEIKFTLRDCNSLPGVPGTCKETFNMYYYESNNVN----LWFIKESQYVKIDTIAADESFTQVDVGDRVMKLNT---EVRDISNLSKKGFYLAFQDLGACIALVSVRVFYKKCPLTVLNLAQFPDTITGGDTALVEVHGMCVNASEEF---EPPKMYCSADGGWLVP-IGRCVCKPGFE--ENKDVCQPCRPGTYKASATDAFCTKCPPHSSSPQEQADECICEKGFYRAESDPRSMACTRPPSAPENPIST-ANETCVTLEWSSPRDTG------GRGDITYSIQCKKCFGEAKKCTPCGSSVHFVPRQFGLSSNTVLITELQPDSTYSFIIESQNGVSDL---SPIPRGTVVINVTTS------QTVSVVLKERRSKDSVTLAWQGPERPNGAIVEYEVIYYEKNQREQNYTVLKTRSNMMTVD--------GLKPGTTYVFRVRARTDGGYGSYGGEIELETSHEDVLAIGD----------PNQSTILVVSI--TGGIVVFVFLVTCF----VVSSSLGVRPPSIVDVSLPLLAPSLHLIAFRHCGYIKAKQDPDEEKMQFQHGRVKLPGSRTYIHPHTYEDPNQAVRDFAKEIDASNIRIERVIGGGEFGEVCSGRL-RVQGKREIYVAIKSLKAGYSDKQRRDFLSEASIMGQFDHPNIIRLEGVVTKCKPVMIITEFMENGSLDTFLKKHDGQFTIIQLVGMLRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLE-DDPEAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVVSYGERPYWEMSNQDVIKAIDEGYRLPAPMDCPVVLHQLMLDCWEKSRSDRPKFGQIVTILDKLIRNPASLRELAKS------------------------------LVCSEDPSSPEFSVSTVDEWLDAIKMGQYKENFSSSGYVSLDSILYISVSELVKMGVTLAGHQKKILSSVQSLQTQGTHIQ 1006          
BLAST of Ephrin type-B receptor 2 vs. Planmine SMEST
Match: SMESG000008191.1 (SMESG000008191.1)

HSP 1 Score: 2127.06 bits (5510), Expect = 0.000e+0
Identity = 1036/1040 (99.62%), Postives = 1037/1040 (99.71%), Query Frame = 2
Query:  164 MCQLINAILISVFSIVNCRVPNYVELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAVL 3283
            MCQLINAILISVFSIVNCRVPNYVELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTD+RQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDASHIID SISIENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKI IETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLL MLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAVL
Sbjct:    1 MCQLINAILISVFSIVNCRVPNYVELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDVRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDASHIIDPSISIENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKIHIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLVMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAHFNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFSRNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAVL 1040          
BLAST of Ephrin type-B receptor 2 vs. Planmine SMEST
Match: SMESG000077240.1 (SMESG000077240.1)

HSP 1 Score: 614.379 bits (1583), Expect = 0.000e+0
Identity = 356/931 (38.24%), Postives = 535/931 (57.47%), Query Frame = 2
Query:  197 VFSIVNCRVPNYVELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQR--LNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLI--CQPTGQWHISDFM-FCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVS-HLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQ----NVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSK---------------QINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFG--MGFILMLIAIPLCFYC-RYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRI-YIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISAL 2899
            +  ++N      V LLNT  S WN+W KN+  Y+GWR QN+PPNA  VYG+C +   S ++WLRSPFI RD  +S+ I++SFTMR CK+ P+ +   +CE+T  L+ YE+DS  +    +N+R +  +  IS +  W    + ENI+N+   SI  RR G  IA ++ G+C M+K + +YY+AC      F  + R     +   RNV G CV+G  +       Q++  CQ  G W   +    C C  G    DSK  CIKC +N YK  +GSEKCI CP+ +YS  G+  C+CN+G + I +    ++C +P   PRN+  + +D+ ++ L+W +   I+SS ++ ++   ++ I CI+C +  +L F P     ++ V++      + Y F V+S++ VS ++ N    + SS+ +S+ TKP +   +L    +Q   NK  + +SW+  +    I+ YE +         ++ +FN DS       N    F     D   +  +  KVR R+   WG F  +K               +I L + V   +F   I +  T++ +  K +++ + G  +   ++LI I L  YC R     +M  +K KN  K  +TS     YS  ++  + T   Y +P+ YED S  + +F  EIDP+ +   T+IG+GEFG V +G L   E  +KI VA+K LK G SEKER +FL+EA+ MGQF + N+++LEG++T +   MIIT+F+  GSL TFLR KK + +T+QLL ML  + +GMKYLS + ++HRDLAARNIL+D++L CKV+DFGLSRE+   + +  YT K  G +PI+WTAPEAI Y +F+ +SDVWSFG+V WEV+SYGE+PYW W N +V+ +I+SGYRLP P  CPP +H LML CW     +RP F  I + I  +
Sbjct:   10 IMDLINLFYCEKVLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIE-NIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIIAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGG-VRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWSSPFYIESSEAVSDNIS-YYLIECINCPN--KLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQ--TNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTD---LIYFVAKVRPRNYKGWGQFSETKSIARKKNELKMKIPTKIRLTNFVTTASF-STITDIKTFIINPEKDVVMMILGSILLVAVLLIIIILVTYCIRRQMMFNMYRQKFKN-EKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKI-VAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSNSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKWTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 927          
BLAST of Ephrin type-B receptor 2 vs. Planmine SMEST
Match: SMESG000077240.1 (SMESG000077240.1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 355/919 (38.63%), Postives = 531/919 (57.78%), Query Frame = 2
Query:  233 VELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPEQR--LNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLI--CQPTGQWHISDFM-FCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVS-HLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQ----NVKTPFYEFPFDKSPINSYRIKVRARSKSAWGPFVVSK---------------QINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFG--MGFILMLIAIPLCFYC-RYLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGSSTTRI-YIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSREIEADNTEGAYTTK-GGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISAL 2899
            V LLNT  S WN+W KN+  Y+GWR QN+PPNA  VYG+C +   S ++WLRSPFI RD  +S+ I++SFTMR CK+ P+ +   +CE+T  L+ YE+DS  +    +N+R +  +  IS +  W    + ENI+N+   SI  RR G  IA ++ G+C M+K + +YY+AC      F  + R     +   RNV G CV+G  +       Q++  CQ  G W   +    C C  G    DSK  CIKC +N YK  +GSEKCI CP+ +YS  G+  C+CN+G + I +    ++C +P   PRN+  + +D+ ++ L+W +   I+SS ++ ++   ++ I CI+C +  +L F P     ++ V++      + Y F V+S++ VS ++ N    + SS+ +S+ TKP +   +L    +Q   NK  + +SW+  +    I+ YE +         ++ +FN DS       N    F     D   +  +  KVR R+   WG F  +K               +I L + V   +F   I +  T++ +  K +++ + G  +   ++LI I L  YC R     +M  +K KN  K  +TS     YS  ++  + T   Y +P+ YED S  + +F  EIDP+ +   T+IG+GEFG V +G L   E  +KI VA+K LK G SEKER +FL+EA+ MGQF + N+++LEG++T +   MIIT+F+  GSL TFLR KK + +T+QLL ML  + +GMKYLS + ++HRDLAARNIL+D++L CKV+DFGLSRE+   + +  YT K  G +PI+WTAPEAI Y +F+ +SDVWSFG+V WEV+SYGE+PYW W N +V+ +I+SGYRLP P  CPP +H LML CW     +RP F  I + I  +
Sbjct:   12 VLLLNTSISGWNNWKKNTKTYEGWRIQNLPPNADEVYGVCEVDHPSANSWLRSPFISRDKGISLHIKVSFTMRECKNYPDPKSLRHCEETFTLLKYESDSPIE-NIHYNERTFAIIGTISSNNKWETKDRTENILNIYETSISVRRLGVIIAFQNTGSCVMIKEVVVYYLACQEKMSNFIYFPRTAAGFESYNRNVVGKCVEGG-VRKHNSDEQIVNYCQANGLWKDDNVKEVCECGSGMEGNDSKTSCIKCSNNFYKLLQGSEKCIPCPQNTYSFTGSASCICNQGYYEIPNMKQKLTCKKPPDKPRNILMDSSDQARIILTWSSPFYIESSEAVSDNIS-YYLIECINCPN--KLVFLPSSKTKETKVIVLGSLPSREYDFKVSSVNDVSQYVTNPFDMDQSSSKISLLTKPLENIEKLKLKSIQ--TNKHGIVLSWNQPTSPTDIVEYECVSFGFRDYFKNTDLFNADSIFHVFTTNTSCSFINLMTD---LIYFVAKVRPRNYKGWGQFSETKSIARKKNELKMKIPTKIRLTNFVTTASF-STITDIKTFIINPEKDVVMMILGSILLVAVLLIIIILVTYCIRRQMMFNMYRQKFKN-EKFEATSPTQIIYSSAYSLPNQTYTKYQNPNTYEDISVALHDFTKEIDPKWLTTSTIIGQGEFGHVYQGVLFVPEDERKI-VAVKVLKDGASEKERNDFLVEASTMGQFMNENVLKLEGVMTGSNSYMIITEFMVNGSLLTFLRIKKNELTTIQLLKMLSNVANGMKYLSSIGFIHRDLAARNILLDENLVCKVADFGLSRELSDKDADDIYTNKPDGKLPIKWTAPEAILYGKFSHASDVWSFGVVCWEVLSYGEKPYWQWSNHEVIDAIQSGYRLPPPVNCPPIMHNLMLHCWNLNSDKRPTFPHISYEIEQI 917          
BLAST of Ephrin type-B receptor 2 vs. Planmine SMEST
Match: SMESG000018920.1 (SMESG000018920.1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.526e-130
Identity = 291/932 (31.22%), Postives = 454/932 (48.71%), Query Frame = 2
Query:  221 VPNYVELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPE-QRLN-CEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGA--ELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFP----IKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYR---------IKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCR------------------YLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGS-STTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSD--FGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALL 2902
             P  + LL+T    W  W  NSGKY GWR+QN PP+   VYGLC +     DNWL SP I   +A SI IE  FTMR+C++ P+  +L  CEDT++L+ YE +   +  ++ N+R++ +V ++ P   W+    +++ +N    SI  +                  L+R+ Y+ACPSI + F  +SR V   DF + NV G CV GA  ++   ++     CQ  G WH    + CHC PG+T+      CI C   T+KS  G  +C YCPKYS S+ G   C C +  F      K   D+I C     +P++L+ + TD  ++ L+W+      +S S ++    ++ + C  C   E+L F PG +V+ +SV I  L  G++Y FSVTS++S+S+       NPS + + +    ++   Q  N V    Q   +  ISW+       +  Y V I     N   S      S+        Y++ + + P   Y+          +V+ +S + W  F  S  I    +    +F+    + N            SVF   +I  L  I LC                      Y + +   NRK K+++   +T    ++Y+ I A S S  R Y   S++++ +  VQ+  +EI PE + ++T+   G+F +V  G  IK   R  + + +   K    ++ R   L +   + QF H N+I + G  T + P M+I +F E G L  FL+K +   + LQLL  LR I  GM YLSE +++H+ L+  N+ +++ L CK+S      S + E D              + W APE +    +++SSDVW++G+ MWEV+SYGE+PYW+W  + V + I  GYRLP PK C   +HLLML CW  + + RP F  +  S+  L+
Sbjct:   11 TPENIVLLDTMKDDWRGWKTNSGKYSGWRTQNTPPDGDKVYGLCMVHRADNDNWLYSPIIPTGEANSIIIETYFTMRNCRNYPDPNKLKICEDTIHLLAYETNDLQE-STNQNNRLFKQVAVLFPQNKWSKDNSEQSAMNSHKKSIPVK-----------------GLVRVLYLACPSIVNSFTEFSRTVSKQDFDLVNVVGKCVKGAVQKVGQADQLQSRFCQSNGLWHDMGTVNCHCGPGFTATADWKSCIPCASGTFKSIAGPIRCSYCPKYSQSESGQSSCTCEKDYFKKIIHAKEVPDMI-CLRLPNAPKDLRADITDGSKVILTWE---FPSTSDSNDHDSIEYYHVFCYQCL-FERLQFIPGINVTGTSVTILGLNFGQSYVFSVTSVASISNYSRNIHPNPSQSSVRLFLPKSNP--QRLNPVKITKQTNGTFLISWTEPDTINPVEMYLVQIG----NVIMSNATGYQSR--------YQYIYTRRPHCLYKPILRSTDIYARVKYKSNNIWSEF--SPDILSNIIFPENSFNENTSKVNR-----------SVFP--WIPNLDVIFLCVTSVVITVIIVSVVIILIQKYVYASLKRTNNRKLKDLSLVENTK---SSYASITASSPSRGRSYFYLSSFDNLTPTVQKSLNEIQPELVIMKTLSRSGKFFDVYSGS-IKQPRRLAMNITLYVFKIELQDEIRTKMLEDCINISQFQHENLINILGFCTVSSPKMVILEFTENGCLHDFLKKNEELINMLQLLEFLRNIACGMHYLSERKFIHKKLSTHNVFINESLVCKISICLLSWSEDPEVDIGCKFIDENKCYDAVSWMAPEILRENTYSTSSDVWAYGVTMWEVLSYGEKPYWDWTVEYVSKVILEGYRLPPPKNCHQNLHLLMLTCWVLDPTLRPSFLTLLRSLDQLI 886          
BLAST of Ephrin type-B receptor 2 vs. Planmine SMEST
Match: SMESG000018920.1 (SMESG000018920.1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.736e-130
Identity = 291/932 (31.22%), Postives = 454/932 (48.71%), Query Frame = 2
Query:  221 VPNYVELLNTETSRWNDWVKNSGKYDGWRSQNIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKSRPE-QRLN-CEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMRQDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLFARYSRLVISHDFRIRNVKGICVDGA--ELISLEKRPQLICQPTGQWHISDFMFCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKCVCNEGLFP----IKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDAXXXXXXXXXXENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYKFSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKRSLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYEFPFDKSPINSYR---------IKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDESNTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCR------------------YLTNRSMKNRKKKNVNKTFSTSLDMANYSQIHAGS-STTRIYIDPSNYEDPSTIVQEFAHEIDPEKIQIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLMEAAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFSTLQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSD--FGLSREIEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMSYGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERPKFGQIFHSISALL 2902
             P  + LL+T    W  W  NSGKY GWR+QN PP+   VYGLC +     DNWL SP I   +A SI IE  FTMR+C++ P+  +L  CEDT++L+ YE +   +  ++ N+R++ +V ++ P   W+    +++ +N    SI  +                  L+R+ Y+ACPSI + F  +SR V   DF + NV G CV GA  ++   ++     CQ  G WH    + CHC PG+T+      CI C   T+KS  G  +C YCPKYS S+ G   C C +  F      K   D+I C     +P++L+ + TD  ++ L+W+      +S S ++    ++ + C  C   E+L F PG +V+ +SV I  L  G++Y FSVTS++S+S+       NPS + + +    ++   Q  N V    Q   +  ISW+       +  Y V I     N   S      S+        Y++ + + P   Y+          +V+ +S + W  F  S  I    +    +F+    + N            SVF   +I  L  I LC                      Y + +   NRK K+++   +T    ++Y+ I A S S  R Y   S++++ +  VQ+  +EI PE + ++T+   G+F +V  G  IK   R  + + +   K    ++ R   L +   + QF H N+I + G  T + P M+I +F E G L  FL+K +   + LQLL  LR I  GM YLSE +++H+ L+  N+ +++ L CK+S      S + E D              + W APE +    +++SSDVW++G+ MWEV+SYGE+PYW+W  + V + I  GYRLP PK C   +HLLML CW  + + RP F  +  S+  L+
Sbjct:   11 TPENIVLLDTMKDDWRGWKTNSGKYSGWRTQNTPPDGDKVYGLCMVHRADNDNWLYSPIIPTGEANSIIIETYFTMRNCRNYPDPNKLKICEDTIHLLAYETNDLQE-STNQNNRLFKQVAVLFPQNKWSKDNSEQSAMNSHKKSIPVK-----------------GLVRVLYLACPSIVNSFTEFSRTVSKQDFDLVNVVGKCVKGAVQKVGQADQLQSRFCQSNGLWHDMGTVNCHCGPGFTATADWKSCIPCASGTFKSIAGPIRCSYCPKYSQSESGQSSCTCEKDYFKKIIHAKEVPDMI-CLRLPNAPKDLRADITDGSKVILTWE---FPSTSDSNDHDSIEYYHVFCYQCL-FERLQFIPGINVTGTSVTILGLNFGQSYVFSVTSVASISNYSRNIHPNPSQSSVRLFLPKSNP--QRLNPVKITKQTNGTFLISWTEPDTINPVEMYLVQIG----NVIMSNATGYQSR--------YQYIYTRRPHCLYKPILRSTDIYARVKYKSNNIWSEF--SPDILSNIIFPENSFNENTSKVNR-----------SVFP--WIPNLDVIFLCVTSVVITVIIVSVVIILIQKYVYASLKRTNNRKLKDLSLVENTK---SSYASITASSPSRGRSYFYLSSFDNLTPTVQKSLNEIQPELVIMKTLSRSGKFFDVYSGS-IKQPRRLAMNITLYVFKIELQDEIRTKMLEDCINISQFQHENLINILGFCTVSSPKMVILEFTENGCLHDFLKKNEELINMLQLLEFLRNIACGMHYLSERKFIHKKLSTHNVFINESLVCKISICLLSWSEDPEVDIGCKFIDENKCYDAVSWMAPEILRENTYSTSSDVWAYGVTMWEVLSYGEKPYWDWTVEYVSKVILEGYRLPPPKNCHQNLHLLMLTCWVLDPTLRPSFLTLLRSLDQLI 886          
The following BLAST results are available for this feature:
BLAST of Ephrin type-B receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPHB20.000e+034.95EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393][more]
EPHB20.000e+035.14EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393][more]
EPHB20.000e+035.04EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393][more]
EPHA40.000e+034.74EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388][more]
EPHA40.000e+034.74EPH receptor A4 [Source:HGNC Symbol;Acc:HGNC:3388][more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-11.362e-9246.76Ephrin receptor 1 [Source:UniProtKB/Swiss-Prot;Ac... [more]
vab-11.655e-9046.09Ephrin receptor 1 [Source:UniProtKB/Swiss-Prot;Ac... [more]
src-22.322e-6237.50Tyrosine protein-kinase src-2 [Source:UniProtKB/S... [more]
csk-17.077e-5537.68Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-17.077e-5537.68Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eph0.000e+035.73gene:FBgn0025936 transcript:FBtr0089083[more]
Eph0.000e+035.73gene:FBgn0025936 transcript:FBtr0089082[more]
Eph0.000e+035.73gene:FBgn0025936 transcript:FBtr0089086[more]
Eph0.000e+035.36gene:FBgn0025936 transcript:FBtr0089084[more]
Eph0.000e+036.94gene:FBgn0025936 transcript:FBtr0089085[more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epha4a0.000e+035.49eph receptor A4a [Source:NCBI gene;Acc:64271][more]
ephb2a0.000e+035.73eph receptor B2a [Source:ZFIN;Acc:ZDB-GENE-070713-... [more]
epha4b0.000e+035.82eph receptor A4b [Source:ZFIN;Acc:ZDB-GENE-030826-... [more]
epha4a0.000e+035.03eph receptor A4a [Source:NCBI gene;Acc:64271][more]
ephb2b0.000e+035.66eph receptor B2b [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epha40.000e+035.08EPH receptor A4 [Source:NCBI gene;Acc:100216124][more]
epha40.000e+035.08EPH receptor A4 [Source:NCBI gene;Acc:100216124][more]
epha40.000e+035.08EPH receptor A4 [Source:NCBI gene;Acc:100216124][more]
sik10.000e+035.05salt inducible kinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
sik10.000e+035.05salt inducible kinase 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epha40.000e+034.78Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277][more]
Epha40.000e+034.78Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277][more]
Epha40.000e+034.78Eph receptor A4 [Source:MGI Symbol;Acc:MGI:98277][more]
Epha70.000e+036.20Eph receptor A7 [Source:MGI Symbol;Acc:MGI:95276][more]
Ephb20.000e+034.52Eph receptor B2 [Source:MGI Symbol;Acc:MGI:99611][more]
back to top
BLAST of Ephrin type-B receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07496|EPHA4_CHICK0.000e+035.58Ephrin type-A receptor 4 OS=Gallus gallus OX=9031 ... [more]
sp|Q91845|EPA4A_XENLA0.000e+035.18Ephrin type-A receptor 4-A OS=Xenopus laevis OX=83... [more]
sp|Q03137|EPHA4_MOUSE0.000e+034.78Ephrin type-A receptor 4 OS=Mus musculus OX=10090 ... [more]
sp|P28693|EPHB2_CHICK0.000e+034.58Ephrin type-B receptor 2 OS=Gallus gallus OX=9031 ... [more]
sp|P29323|EPHB2_HUMAN0.000e+035.04Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4NPU60.000e+035.66Uncharacterized protein OS=Cinara cedri OX=506608 ... [more]
A0A2S2PM870.000e+035.62Ephrin type-A receptor 7 OS=Schizaphis graminum OX... [more]
X1WQ640.000e+035.78Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A5E4NRS40.000e+035.26Uncharacterized protein OS=Cinara cedri OX=506608 ... [more]
A0A5E4NHY80.000e+035.10Fibronectin type III,Protein kinase, ATP binding s... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ephb2a0.000e+035.83EPH receptor B2 [Source:NCBI gene;Acc:103031596][more]
ek10.000e+034.33eph-like kinase 1 [Source:NCBI gene;Acc:30311][more]
ephb10.000e+034.93ephrin type-B receptor 1 [Source:NCBI gene;Acc:103... [more]
epha60.000e+034.28ephrin type-A receptor 6-like [Source:NCBI gene;Ac... [more]
ephb10.000e+034.54ephrin type-B receptor 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009834.10.000e+036.22pep scaffold:Pmarinus_7.0:GL476739:7877:63472:1 ge... [more]
EPHB20.000e+035.70EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393][more]
ENSPMAT00000010247.10.000e+035.19pep scaffold:Pmarinus_7.0:GL476398:264473:324965:1... [more]
ENSPMAT00000007292.10.000e+035.15pep scaffold:Pmarinus_7.0:GL476471:161062:207122:1... [more]
ENSPMAT00000002245.14.744e-16333.63pep scaffold:Pmarinus_7.0:GL476603:2572:131951:1 g... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC153.362e-2025.87Protein kinase of the Mitotic Exit Network; locali... [more]
BCK16.748e-1825.11MAPKKK acting in the protein kinase C signaling pa... [more]
TPK31.257e-1627.92cAMP-dependent protein kinase catalytic subunit; p... [more]
KIN41.199e-1528.85Serine/threonine protein kinase; inhibits the mito... [more]
SKM13.775e-1528.04Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO409941.686e-12045.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337363.649e-11843.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289801.184e-10043.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337317.695e-10056.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337321.397e-9956.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epha4b0.000e+035.23ephrin type-A receptor 3 [Source:NCBI gene;Acc:101... [more]
ephb2a0.000e+035.26ephrin type-B receptor 2-like [Source:NCBI gene;Ac... [more]
ephb2b0.000e+035.71ephrin type-B receptor 2 [Source:NCBI gene;Acc:101... [more]
ephb2b0.000e+035.81ephrin type-B receptor 2 [Source:NCBI gene;Acc:101... [more]
epha4b0.000e+035.07ephrin type-A receptor 3 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Ephrin type-B receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008191.10.000e+099.62SMESG000008191.1[more]
SMESG000077240.10.000e+038.24SMESG000077240.1[more]
SMESG000077240.10.000e+038.63SMESG000077240.1[more]
SMESG000018920.13.526e-13031.22SMESG000018920.1[more]
SMESG000018920.13.736e-13031.22SMESG000018920.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017565 ID=SMED30017565|Name=Ephrin type-B receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3625bp
TTAGATTTCTAGAAAACATTCCACCTTCATGCATGATTGTTTTCATTTGA
CTTCATCTCGTCAACCAATCACAATGCGATCAATCCACCAATAAGAATCG
ATTAAATAATTCTCTTAATCTACTTCGATTGATTTCTCAGGGATTCACAG
TTACGGTAGCATTATGTGCCAACTGATCAATGCTATTTTGATCTCGGTTT
TCTCAATTGTTAATTGCAGAGTTCCTAATTATGTTGAACTATTGAACACA
GAAACAAGCAGATGGAATGATTGGGTAAAAAATTCTGGGAAATACGATGG
ATGGCGCAGTCAGAATATTCCCCCAAACGCACAATTAGTGTATGGACTGT
GCGCTCTGCAAGGAGGCAGTCGTGATAACTGGCTCCGTAGTCCATTCATA
AGACGAGATGATGCTCTTAGTATCAAAATTGAGATCTCTTTCACAATGCG
CTCTTGTAAATCTCGACCAGAACAACGACTTAATTGTGAAGATACTCTTT
ATTTGATGATTTATGAAGCCGATAGTTCCTCTGATGTGCCCAGTTCATGG
AACGATAGGATTTATACAAGAGTTGACATCATTTCTCCCGATATCACATG
GACTGATATGAGACAGGACGAAAATATTGTCAACGTCAAAACATATTCCA
TTGAACCGCGTCGTTCTGGATTTTTCATAGCTTTACGAGACATTGGAGCA
TGCGCTATGGTGAAACTCATTCGCATTTATTATGTTGCTTGCCCCTCGAT
TACCCATTTGTTCGCAAGATATTCACGATTAGTTATCAGTCACGATTTCC
GTATCCGTAACGTGAAAGGAATTTGCGTTGATGGAGCGGAATTAATTAGT
TTAGAAAAAAGACCACAACTGATATGCCAACCGACAGGCCAATGGCATAT
TTCAGATTTCATGTTTTGTCATTGTAAGCCTGGATATACTTCATTGGATA
GTAAAATGGTGTGCATCAAGTGCCCTCATAATACTTATAAATCTTCAAGA
GGTTCGGAAAAATGTATCTATTGTCCCAAATATTCTTATAGTGATCCAGG
AGCAGACAAGTGTGTTTGCAATGAAGGATTATTTCCAATTAAATCTTCGT
CAGATTTAATATCTTGCGCGGAACCATTATTGAGTCCAAGAAATCTAAAG
GGAAATTTCACCGATAAAGGACAGTTGCAATTGTCATGGGACGCCTCCCA
TATAATTGACTCGTCAATTAGTATCGAGAATTCCTTCAAAGTTCATTTCA
GAATTATTTGTATATCTTGTAAAGATTCGGAACAATTATTTTTCACTCCT
GGTCCAGATGTCAGTCAGTCATCAGTATTGATTGATGCCTTGGAATCAGG
GAAAACTTATAAATTTTCTGTCACGTCAATGAGTTCTGTAAGTCACTTGA
TGAATTTTTCAAGTGCTAATCCAAGCTCTGCTCTCCTATCAATTGACACA
AAACCGGCAGACCAATCCCTTCAACTGACAAATTTAGTAGTACAAAAAGC
TCAAAACAAGCGTTCATTATTCATATCATGGTCTCTGGTGTCAGAAGATG
CAGCAATTATTTCATATGAAGTTATTATACATAAATCCTCCATAAACGCC
GGCCATTCAAAGGTTTTTAATCTCGATTCTCAATTGCAAAATGTTAAAAC
TCCTTTTTATGAGTTCCCGTTTGACAAAAGCCCAATTAATTCATATCGCA
TTAAAGTAAGAGCAAGATCTAAATCAGCTTGGGGGCCATTTGTTGTCTCA
AAACAAATTAACTTAAAAGACCTAGTAAAACTGAAAGCATTTGATGGAGG
CATTGATGAGTCTAATACTTATCTATCAAGCCAAAACAAGCTAATGATAA
TTTCGGTATTCGGAATGGGTTTCATACTGATGCTAATAGCGATTCCTCTC
TGTTTCTATTGCAGATATTTAACAAATCGGTCTATGAAAAATCGAAAGAA
AAAAAACGTCAACAAAACTTTTTCCACTTCTTTAGACATGGCCAATTATA
GTCAGATTCATGCCGGATCTAGCACGACCCGGATCTACATTGATCCTTCG
AATTATGAAGATCCTAGCACAATCGTTCAGGAATTTGCGCATGAGATTGA
CCCCGAGAAGATTCAAATCGAAACGGTTATTGGTGAAGGAGAGTTTGGGG
AAGTGTGCAGAGGGAAATTAATAAAATATGAGTATCGGCAAAAAATTCCA
GTTGCTATTAAAACTTTGAAATCTGGATGTTCGGAGAAAGAAAGAATGAA
TTTTTTGATGGAGGCGGCCATTATGGGTCAATTTTGTCATTCCAACATTA
TCCAGTTGGAGGGAATCGTAACAAAAACCCAGCCGATTATGATAATAACA
CAATTTATAGAATTCGGTTCTTTAGACACATTTTTGAGAAAAAAGAAATA
TCAATTTTCCACCTTGCAGCTACTAGGCATGCTAAGAGGAATCGTTTCGG
GAATGAAGTATCTTTCAGAGATGCGCTATGTGCATCGGGATTTGGCAGCT
AGAAATATTCTCGTGGATAAAGATCTTTGTTGCAAAGTTTCAGATTTTGG
CTTATCTCGAGAAATTGAGGCTGATAACACTGAAGGTGCTTATACTACTA
AAGGTGGATTGATACCAATCAGGTGGACCGCTCCAGAAGCGATTAACTAC
CGTCGGTTTACTTCATCAAGCGACGTGTGGAGTTTTGGAATTGTTATGTG
GGAAGTAATGTCTTATGGGGAAAGGCCTTATTGGAATTGGCCAAACAAGG
ATGTTCTTCAGTCTATTGAATCAGGTTACAGACTTCCAGCTCCTAAACGA
TGTCCTCCAGCAATACACCTTTTAATGCTCGATTGTTGGACTTATGAAAG
GTCAGAAAGACCAAAATTTGGGCAAATTTTTCATTCTATCAGTGCTCTTC
TAAGATGTCCTGAAGCTTTGGCTTCTATACCTCTCTCACATTCTATTGGA
AGGCTGTCAGTAGACTCATATCGACGAAATTCATCCATTATTTCTGAATC
AAAAAAAGCACATTTCAACAGCACACCTTTGCTACAATCGGAACCGATAT
TCGGTCCGGAAAGTTCCATTTCCCAATGGCTTGATTGCCTCGATCTACCA
TGTTATAAAGACAATTTTGTAAAGCATCATTTGATTTATTTGTGTCACAT
ATGTAAATTTTCCCGGAACGATTTAGTTTCACTTGAAATAACCGATCCAG
AACACCTTCAGAAGTTAATGAACAACATTGAGGCTATGCAAAACTATTTC
GACACTTTACAATCTGCTTCTTTTGCCGTGCTGTAAAACTATCACATATC
TCACCAAACCGAAATTAATAATCATAGAAATTAATTTGTTTTATCAAACG
AGTTTTAAATGCTTTTTAAACAATTCAGTAGTCAAATATTTATTCTTTGA
CTTATATATCAGTAAATATCCGAAAAAATGATGTTTCATTAAAAATGGGC
ATTTGTCACAATTGTAAACTCTCGCTGGAATTTTTTGTTTTTTTCCTGTT
TGTTTGTTTGTTTAAAACGATGGCAGTTCAAACAAAACAAGATGAAATTA
CCAATTGTCCGAAATGTTAATAATAAACCGAATTCAAATCAATTATCTTT
TTAAATAGATTGTTGTTTCATGGAC
back to top

protein sequence of SMED30017565-orf-1

>SMED30017565-orf-1 ID=SMED30017565-orf-1|Name=SMED30017565-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1041bp
MCQLINAILISVFSIVNCRVPNYVELLNTETSRWNDWVKNSGKYDGWRSQ
NIPPNAQLVYGLCALQGGSRDNWLRSPFIRRDDALSIKIEISFTMRSCKS
RPEQRLNCEDTLYLMIYEADSSSDVPSSWNDRIYTRVDIISPDITWTDMR
QDENIVNVKTYSIEPRRSGFFIALRDIGACAMVKLIRIYYVACPSITHLF
ARYSRLVISHDFRIRNVKGICVDGAELISLEKRPQLICQPTGQWHISDFM
FCHCKPGYTSLDSKMVCIKCPHNTYKSSRGSEKCIYCPKYSYSDPGADKC
VCNEGLFPIKSSSDLISCAEPLLSPRNLKGNFTDKGQLQLSWDASHIIDS
SISIENSFKVHFRIICISCKDSEQLFFTPGPDVSQSSVLIDALESGKTYK
FSVTSMSSVSHLMNFSSANPSSALLSIDTKPADQSLQLTNLVVQKAQNKR
SLFISWSLVSEDAAIISYEVIIHKSSINAGHSKVFNLDSQLQNVKTPFYE
FPFDKSPINSYRIKVRARSKSAWGPFVVSKQINLKDLVKLKAFDGGIDES
NTYLSSQNKLMIISVFGMGFILMLIAIPLCFYCRYLTNRSMKNRKKKNVN
KTFSTSLDMANYSQIHAGSSTTRIYIDPSNYEDPSTIVQEFAHEIDPEKI
QIETVIGEGEFGEVCRGKLIKYEYRQKIPVAIKTLKSGCSEKERMNFLME
AAIMGQFCHSNIIQLEGIVTKTQPIMIITQFIEFGSLDTFLRKKKYQFST
LQLLGMLRGIVSGMKYLSEMRYVHRDLAARNILVDKDLCCKVSDFGLSRE
IEADNTEGAYTTKGGLIPIRWTAPEAINYRRFTSSSDVWSFGIVMWEVMS
YGERPYWNWPNKDVLQSIESGYRLPAPKRCPPAIHLLMLDCWTYERSERP
KFGQIFHSISALLRCPEALASIPLSHSIGRLSVDSYRRNSSIISESKKAH
FNSTPLLQSEPIFGPESSISQWLDCLDLPCYKDNFVKHHLIYLCHICKFS
RNDLVSLEITDPEHLQKLMNNIEAMQNYFDTLQSASFAVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005515protein binding
GO:0005003ephrin receptor activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR013809ENTH
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR011641Tyr-kin_ephrin_A/B_rcpt-like
IPR020635Tyr_kinase_cat_dom
IPR001660SAM
IPR001090Ephrin_rcpt_lig-bd_dom
IPR013761SAM/pointed_sf
IPR008979Galactose-bd-like_sf
IPR027936Eph_TM
IPR016257Tyr_kinase_ephrin_rcpt
IPR013783Ig-like_fold
IPR017441Protein_kinase_ATP_BS
IPR008266Tyr_kinase_AS
IPR003961FN3_dom
IPR000719Prot_kinase_dom
IPR009030Growth_fac_rcpt_cys_sf
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0048013ephrin receptor signaling pathway
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1015..1035
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 734..921
e-value: 1.8E-54
score: 186.0
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 617..731
e-value: 8.2E-35
score: 121.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.1770coord: 197..249
e-value: 3.7E-5
score: 25.8
NoneNo IPR availableGENE3DG3DSA:2.10.50.10coord: 256..321
e-value: 5.5E-9
score: 37.8
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 44..932
NoneNo IPR availablePANTHERPTHR24416:SF306EPHRIN TYPE-A RECEPTOR 2coord: 44..932
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.615
NoneNo IPR availableTMHMMTMhelixcoord: 564..586
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 836..858
score: 59.03
coord: 766..784
score: 67.88
coord: 729..742
score: 40.38
coord: 880..902
score: 44.48
coord: 817..827
score: 65.07
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 651..907
e-value: 6.8E-92
score: 307.4
IPR001660Sterile alpha motif domainSMARTSM00454SAM_4coord: 961..1028
e-value: 1.4E-9
score: 47.8
IPR001660Sterile alpha motif domainPFAMPF07647SAM_2coord: 968..1026
e-value: 2.7E-10
score: 40.2
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 964..1028
score: 11.876
IPR011641Tyrosine-protein kinase ephrin type A/B receptor-likeSMARTSM01411GCC2_GCC3_2coord: 257..300
e-value: 6.5E-5
score: 32.3
IPR011641Tyrosine-protein kinase ephrin type A/B receptor-likePFAMPF07699Ephrin_rec_likecoord: 257..293
e-value: 5.1E-7
score: 29.3
IPR001090Ephrin receptor ligand binding domainSMARTSM00615ephcoord: 23..193
e-value: 2.0E-20
score: 83.9
IPR001090Ephrin receptor ligand binding domainPFAMPF01404Ephrin_lbdcoord: 26..193
e-value: 1.9E-33
score: 116.0
IPR001090Ephrin receptor ligand binding domainPROSITEPS51550EPH_LBDcoord: 22..198
score: 35.017
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 650..909
e-value: 2.0E-121
score: 419.3
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 21..196
e-value: 3.6E-35
score: 123.2
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 31..191
IPR016257Ephrin receptor type-A /type-BPIRSFPIRSF000666TyrPK_ephrin_receptorcoord: 1..1037
e-value: 3.8E-262
score: 870.0
IPR027936Ephrin receptor, transmembrane domainPFAMPF14575EphA2_TMcoord: 563..647
e-value: 1.2E-13
score: 51.7
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 966..1031
e-value: 3.6E-11
score: 45.0
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 965..1029
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 772..784
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 656..683
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 650..913
score: 36.57
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 324..432
score: 10.967
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 437..537
score: 6.935
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 325..526
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 237..318
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 639..932