GCR139

Overview
NameGCR139
Smed IDSMED30017559
Length (bp)1458
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017559

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30017559h1SMcG0004087 GCR139smed_ncbi_20240424PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR139 vs. TrEMBL
Match: A0A193KUF3 (GCR139 OS=Schmidtea mediterranea OX=79327 GN=gcr139 PE=2 SV=1)

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 448/448 (100.00%), Postives = 448/448 (100.00%), Query Frame = 1
Query:   40 MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQAEPSAVDVEVKLQK 1383
            MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQAEPSAVDVEVKLQK
Sbjct:    1 MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQAEPSAVDVEVKLQK 448          
BLAST of GCR139 vs. TrEMBL
Match: A0A193KUU2 (GCR137 OS=Schmidtea mediterranea OX=79327 GN=gcr137 PE=2 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 5.121e-138
Identity = 197/344 (57.27%), Postives = 260/344 (75.58%), Query Frame = 1
Query:  310 VFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQ 1341
            +F+ V++++NLL+TGI +NF SKGLPWLGF G YIEYASPL CK S+F Q FLNC  IN+L CE +GRLI + S GAHSP    +IY L  A+  SF  C P+I LYNL++PDGRYDC+ DP WP   I+W AIHR+++CDGL+Q + IL  N   +  LLK R TI  I     ESNIVSDTLKQ+ RLL+N  RD+ +VVIHST +  LF ++S VSY +++V+++D+ DNTTV+G L+NYKWT++ED + FL+ L ISC+MWLY+FIIP FR++IR  IK++++ N +VLR+ D+FMLTDNEM E+P+ W+KSQ++L NLD VL+ER+ QLEGALK    Q
Sbjct:    1 MFYVVINSINLLFTGIAVNFLSKGLPWLGFTGIYIEYASPLSCKLSRFLQTFLNCSLINILLCEVIGRLIYLLSYGAHSPDLNFIIYILAGALFSSFFLCFPMIILYNLQKPDGRYDCIPDPEWPYVFIRWHAIHRMIFCDGLMQSLIILVLNGFIVFQLLKFRWTIASIQSFFTESNIVSDTLKQVIRLLNNNARDSILVVIHSTFVVLLFFVRSIVSYVVHKVIFIDFLDNTTVDGALLNYKWTAVEDFLTFLHILFISCYMWLYFFIIPTFRTYIRKSIKRISRKNQTVLRIADLFMLTDNEMAESPEVWKKSQDHLGNLDSVLFERVHQLEGALKYNSNQ 344          
BLAST of GCR139 vs. TrEMBL
Match: A0A193KUN9 (GCR128 OS=Schmidtea mediterranea OX=79327 GN=gcr128 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 4.984e-70
Identity = 149/428 (34.81%), Postives = 232/428 (54.21%), Query Frame = 1
Query:   34 HSMDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEG 1317
            HS+ +D F+        +++FY+ EMY +CA+ +L         YC+NFI IGG  AL++IP VW G  GN+ L  A    I+     EI+ V F++V+T+ L++  +L +F SKG+PWLGF G Y+ Y S L CK   F  +FL+  S+N+L  E+  R +++K +G    + + VI+ + V +  SF+Q +P+  +++L   DGRYDC +D  +P  I+QW  IH  L+C+GL Q + I F N  +      L  TI  I     E  + S  L +I   L     D    ++H+T+ A +  +K+  S +I+   +  Y DNTTV GV+  Y   ++  I   L++L  S H WLY+F    FR  I+  I      +  +  V+D FM     MG++  +  K ++ L+  + VLYERIR  +G
Sbjct:    6 HSVSEDDFSH-------IQYFYNSEMYLECADWALEKRNNTAIQYCNNFIFIGGCFALMSIPIVWCGILGNLTLGLAFAKYIKGIGNHEIFVVAFAIVETLALIFI-VLFDFLSKGVPWLGFTGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREFVIFGVLVIIIFSFIQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFM-----MGDSVKKTAKMED-LKMHNLVLYERIRNFDG 419          
BLAST of GCR139 vs. TrEMBL
Match: A0A3P7P5P6 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS9227 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 9.451e-57
Identity = 119/402 (29.60%), Postives = 207/402 (51.49%), Query Frame = 1
Query:  181 ISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQ-AEPSAVDVEVKLQK 1383
            +++GG+ ALL +PTV  G  G + L +A   ++ RSARQ I+  +  V     L+Y GI   F +KGL WLG++  ++EY+    CK S+F + F++    N+L+ +A+ R + IK++             LC  +   FV   P   + N+   DGRY C  DP W ++ + W  +H  L+ +G  Q + +LF        + KL  TI+Y+    K    +++T+ Q+T LL    RD  V +I +  +A L  ++  +   +   +Y  + DN   +GVL  Y   ++ED+VI+L  +  + H WL++F +P FR+WI    K        + R ++ F+  + +     + W     YLQN +PVLY+R+ QL+  + +   + + P+    E+++ +
Sbjct:    2 MAVGGVGALLALPTVVFGVLGELALLAAFSNKLVRSARQHIFSAYQCVFGIAFLIYFGINNLFLTKGLLWLGYEPIFLEYSHTYACKTSRFLKCFISATVSNILYADAINRAMAIKAKCYQPVTTTKCFVLLCCCVIGGFVAAVPNFIISNIWLIDGRYICGKDPAWSQSTVLWTTVHETLFANGCAQALSVLFLIMAMSRDVGKLDNTIDYLHTAHKLPGTLTETVFQVTFLLREARRDAWVCIIFNMSLAILMFVRGVIRGFLDWEIYSKFEDNGRTDGVLSFYMIIALEDLVIYLMMIVFAYHFWLFFFYVPAFRTWIFGETKDTVG---GLRRKLEPFLPINPDEEYYQENWDAGTFYLQNGNPVLYQRMVQLDKIINEAQREVSRPTGGTDELRISQ 400          
BLAST of GCR139 vs. TrEMBL
Match: A0A183SL57 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS4955 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.751e-56
Identity = 115/384 (29.95%), Postives = 196/384 (51.04%), Query Frame = 1
Query:  181 ISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQT 1332
            +++GG+ ALL +PTV  G  G + L +A   ++ RSARQ  +  F S      LLY GI     +KGL WLG++  ++E++    CK S+F   F++    N+L+ +A  R + IK++             L   +   FV   P   + NL R DGR  C  DP W  ++I W   H  ++ +G  Q + ++F        + KL  TI+Y+    +    +++T+ Q+T LL    RD  V ++ +  +A L   ++++   +   +Y +Y DN   +GVL  Y + ++ED+VIFL  +  + H WL+++ IP FR+WI    K        + R ++ F+  + +  +  + W     YLQN +PVLYER+ +L+  + + 
Sbjct:    1 MAVGGVAALLVLPTVVFGIIGELTLITAFCNKLIRSARQHAFSAFQSAFGIAFLLYFGIYYLLFTKGLSWLGYEPVFLEHSHTFACKASRFICCFISATVSNILYADASNRAMAIKAKCYQPATTTKGFVVLSCCVIGGFVAAMPEFIICNLWRIDGRLICEKDPAWAPSVIHWLIFHETVFINGFGQALAVIFLIMAMSRDVGKLDNTIDYLHTAHRLPGTITETVFQVTFLLRESRRDAWVCIVFNMSLAILMFARATIRSCLNYEIYYNYEDNGRTDGVLKFYMFNALEDLVIFLMMIVFAYHFWLFFYYIPAFRTWIFGETKDTVG---GIRRKLEPFLPLNPDGEDYQENWDSGTFYLQNGNPVLYERLVELDNIINEA 381          
BLAST of GCR139 vs. Planmine SMEST
Match: SMESG000046223.1 (SMESG000046223.1)

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 447/448 (99.78%), Postives = 448/448 (100.00%), Query Frame = 1
Query:   40 MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQAEPSAVDVEVKLQK 1383
            MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTD+QAEPSAVDVEVKLQK
Sbjct:    1 MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDIQAEPSAVDVEVKLQK 448          
BLAST of GCR139 vs. Planmine SMEST
Match: SMESG000046233.1 (SMESG000046233.1)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 425/425 (100.00%), Postives = 425/425 (100.00%), Query Frame = 1
Query:  109 MYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQAEPSAVDVEVKLQK 1383
            MYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQAEPSAVDVEVKLQK
Sbjct:    1 MYTQCAEHSLNFGKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGLLKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQAEPSAVDVEVKLQK 425          
BLAST of GCR139 vs. Planmine SMEST
Match: SMESG000046231.1 (SMESG000046231.1)

HSP 1 Score: 482.256 bits (1240), Expect = 3.640e-168
Identity = 235/437 (53.78%), Postives = 314/437 (71.85%), Query Frame = 1
Query:   40 MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNF---GKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQ 1341
            M +  +N S   N S+ +F++ +MYT+CAE  L     GK +    CD  IS GG+  LLTIPT  +  + N+I+    L  +R SA+QEIYG+F+ V++++NLL+TGI +NF SKGLPWLGF G YIEYASPL CK S+F Q FLNC  IN+L CE +GRLI + S GAHSP    +IY L  A+  SF  C P+I LYNL++PDGRYDC+ DP WP   I+W AIHR+++CDGL+Q + IL  N   +  LLK R TI  I     ESNIVSDTLKQ+ RLL+N  RD+ +VVIHST +  LF ++S VSY +++V+++D+ DNTTV+G L+NYKWT++ED + FL+ L ISC+MWLY+FIIP FR++IR  IK++++ N +VLR+ D+FMLTDNEM E+P+ W+KSQ++L NLD VL+ER+ QLEGALK    Q
Sbjct:    1 MTEKTYNDSFVYNLSVLYFFNSDMYTECAEKDLYMLYVGKGKANFNCDYLISFGGVTGLLTIPTALIAIFLNIIIGFGFLFSLRLSAKQEIYGMFYVVINSINLLFTGIAVNFLSKGLPWLGFTGIYIEYASPLSCKLSRFLQTFLNCSLINILLCEVIGRLIYLLSYGAHSPDLNFIIYILAGALFSSFFLCFPMIILYNLQKPDGRYDCIPDPEWPYVFIRWHAIHRMIFCDGLMQSLIILVLNGFIVFQLLKFRWTIASIQSFFTESNIVSDTLKQVIRLLNNNARDSILVVIHSTFVVLLFFVRSIVSYVVHKVIFIDFLDNTTVDGALLNYKWTAVEDFLTFLHILFISCYMWLYFFIIPTFRTYIRKSIKRISRKNQTVLRIADLFMLTDNEMAESPEVWKKSQDHLGNLDSVLFERVHQLEGALKYNSNQ 437          
BLAST of GCR139 vs. Planmine SMEST
Match: SMESG000046224.1 (SMESG000046224.1)

HSP 1 Score: 481.871 bits (1239), Expect = 5.292e-168
Identity = 235/437 (53.78%), Postives = 314/437 (71.85%), Query Frame = 1
Query:   40 MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNF---GKKQPTTYCDNFISIGGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMNLLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQ 1341
            M +  +N S   N S+ +F++ +MYT+CAE  L     GK +    CD  IS GG+  LLTIPT  +  + N+I+    L  +R SA+QEIYG+F+ V++++NLL+TGI +NF SKGLPWLGF G YIEYASPL CK S+F Q FLNC  IN+L CE +GRLI + S GAHSP    +IY L  A+  SF  C P+I LYNL++PDGRYDC+ DP WP   I+W AIHR+++CDGL+Q + IL  N   +  LLK R TI  I     ESNIVSDTLKQ+ RLL+N  RD+ +VVIHST +  LF ++S VSY +++V+++D+ DNTTV+G L+NYKWT++ED + FL+ L ISC+MWLY+FIIP FR++IR  IK++++ N +VLR+ D+FMLTDNEM E+P+ W+KSQ++L NLD VL+ER+ QLEGALK    Q
Sbjct:    1 MTEKTYNDSFVYNLSVIYFFNSDMYTECAEKDLYMLYVGKGKANFNCDYLISFGGVTGLLTIPTALIAIFLNIIIGFGFLFSLRLSAKQEIYGMFYVVINSINLLFTGIAVNFLSKGLPWLGFTGIYIEYASPLSCKLSRFLQTFLNCSLINILLCEVIGRLIYLLSYGAHSPDLNFIIYILAGALFSSFFLCFPMIILYNLQKPDGRYDCIPDPEWPYVFIRWHAIHRMIFCDGLMQSLIILVLNGFIVFQLLKFRWTIASIQSFFTESNIVSDTLKQVIRLLNNNARDSILVVIHSTFVVLLFFVRSIVSYVVHKVIFIDFLDNTTVDGALLNYKWTAVEDFLTFLHILFISCYMWLYFFIIPTFRTYIRKSIKRISRKNQTVLRIADLFMLTDNEMAESPEVWKKSQDHLGNLDSVLFERVHQLEGALKYNSNQ 437          
BLAST of GCR139 vs. Planmine SMEST
Match: SMESG000050119.1 (SMESG000050119.1)

HSP 1 Score: 151.754 bits (382), Expect = 5.858e-42
Identity = 101/309 (32.69%), Postives = 160/309 (51.78%), Query Frame = 1
Query:  391 LGFQGFYIEYASPLMCKFSKFFQVFLNCYSINMLFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLRRPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGXXXXXXXXXXXXXXXXXXXKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAFLFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCISCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETPDQWRKSQNYLQNLDPVLYERIRQLEG 1317
            +G  G Y+ Y S L CK   F  +FL+  S+N+L  E+  R +++K +G    + + VI+ + V +  SF+Q +P+  +++L   DGRYDC +D  +P  I+QW  IH  L+C+GL Q + I F N  +      L  TI  I     E  + S  L +I   L     D    ++H+T+ A +  +K+  S +I+   +  Y DNTTV GV+  Y   ++  I   L++L  S H WLY+F    FR  I+  I      +  +  V+D FM     MG++  +  K ++ L+  + VLYERIR  +G
Sbjct:    2 VGIYGVYVLYKSTLSCKLFSFAGIFLDSLSVNLLLGESFHRFLILKFKGGIEIQREFVIFGVLVIIIFSFIQSAPLTVIFSLWLIDGRYDCEIDCQFPWPIVQWTGIHFGLFCNGLFQTLIIFFLNSFSWYYWYVLYHTIHTIQTATNEYRLSSKILDEICNSLTVSLDDAFCTLVHTTVGAAILNIKAIFSLKIFYEFFSVYEDNTTVEGVVYMYYLRTLGQIFSTLFYLFESYHFWLYFFCNSNFRQLIKTKIMMFNPESERLSNVIDQFM-----MGDSVKKTAKMED-LKMHNLVLYERIRNFDG 304          
The following BLAST results are available for this feature:
BLAST of GCR139 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUF30.000e+0100.00GCR139 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
A0A193KUU25.121e-13857.27GCR137 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
A0A193KUN94.984e-7034.81GCR128 OS=Schmidtea mediterranea OX=79327 GN=gcr12... [more]
A0A3P7P5P69.451e-5729.60Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A183SL571.751e-5629.95Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of GCR139 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR139 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046223.10.000e+099.78SMESG000046223.1[more]
SMESG000046233.10.000e+0100.00SMESG000046233.1[more]
SMESG000046231.13.640e-16853.78SMESG000046231.1[more]
SMESG000046224.15.292e-16853.78SMESG000046224.1[more]
SMESG000050119.15.858e-4232.69SMESG000050119.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017559 ID=SMED30017559|Name=GCR139|organism=Schmidtea mediterranea sexual|type=transcript|length=1458bp
GATCTTTTTAACGTCGATTGATTCTATAGGCGACATTCAATGGATGATGA
CTATTTCAATAGGAGTATCTATGAAAATAGATCCCTAGAATTTTTCTATC
ACCGGGAAATGTATACTCAATGCGCGGAACATTCTCTAAACTTTGGCAAA
AAACAACCAACAACATATTGTGACAATTTTATTTCCATCGGTGGAATCGT
CGCCCTCCTAACCATTCCCACCGTATGGGTCGGATTCTGGGGTAACGTGA
TTCTGTTTTCGGCTTTGCTTCTGCAAATTCGACGTTCTGCCAGACAAGAA
ATATATGGAGTCTTTTTTTCGGTTGTTGATACCATGAATTTGTTATATAC
AGGAATTTTAATTAATTTTGGCAGCAAGGGTCTTCCGTGGTTAGGATTCC
AAGGATTTTATATTGAATATGCCAGTCCGTTGATGTGTAAGTTTAGTAAA
TTCTTTCAGGTATTTTTAAATTGCTATTCAATTAATATGCTATTTTGTGA
GGCGTTAGGAAGATTGATAATGATAAAGTCTAGAGGTGCGCATTCACCAA
GATATCAGCATGTCATTTATTTTCTGTGTGTAGCGATGGCTATAAGTTTT
GTCCAGTGTAGCCCTATAATAACTCTTTATAATTTAAGAAGACCCGATGG
AAGATACGACTGCGTACTTGACCCCGGATGGCCGAGAGCTATTATTCAAT
GGTTTGCAATTCACCGACTTCTTTATTGTGATGGACTCATTCAATGCATT
TTCATTTTGTTTTTTAATTGTATTAACATTCTTGGCCTGTTGAAGTTACG
AGCAACCATTGAGTATATAGACCATACGGCAAAGGAGTCAAATATTGTTT
CGGATACTCTAAAACAAATTACTCGACTATTACATAACATTGAGCGAGAT
ACCCAAGTCGTCGTAATCCACAGCACAATTATAGCTTTTTTGTTTCTATT
AAAATCTAGTGTTTCCTATGAAATTTACGAAGTTCTGTATGTAGATTATA
CGGATAATACTACGGTAAATGGTGTTTTGATCAATTACAAGTGGACCTCA
ATAGAGGATATTGTGATTTTCTTATACTTTCTCTGTATTAGCTGTCATAT
GTGGTTATATTATTTCATTATTCCTCCGTTTCGATCATGGATTCGTGACG
TTATTAAAAAAGTAACAAAAAATAACCCGTCTGTATTAAGAGTTGTTGAT
ATGTTTATGCTTACTGATAATGAAATGGGTGAAACTCCAGATCAGTGGAG
AAAATCGCAAAATTATTTGCAAAATTTAGATCCAGTTCTTTATGAAAGAA
TTCGTCAACTTGAAGGTGCTTTGAAACAGACTGATGTTCAAGCGGAGCCA
TCTGCCGTAGACGTTGAAGTCAAATTGCAAAAGTAATAATTTTCACTTGA
CCTTGAACGAAACTTCTGTGTTTGATTTGATATATTAATTATTTAAATTG
TATTTGGT
back to top

protein sequence of SMED30017559-orf-1

>SMED30017559-orf-1 ID=SMED30017559-orf-1|Name=SMED30017559-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MDDDYFNRSIYENRSLEFFYHREMYTQCAEHSLNFGKKQPTTYCDNFISI
GGIVALLTIPTVWVGFWGNVILFSALLLQIRRSARQEIYGVFFSVVDTMN
LLYTGILINFGSKGLPWLGFQGFYIEYASPLMCKFSKFFQVFLNCYSINM
LFCEALGRLIMIKSRGAHSPRYQHVIYFLCVAMAISFVQCSPIITLYNLR
RPDGRYDCVLDPGWPRAIIQWFAIHRLLYCDGLIQCIFILFFNCINILGL
LKLRATIEYIDHTAKESNIVSDTLKQITRLLHNIERDTQVVVIHSTIIAF
LFLLKSSVSYEIYEVLYVDYTDNTTVNGVLINYKWTSIEDIVIFLYFLCI
SCHMWLYYFIIPPFRSWIRDVIKKVTKNNPSVLRVVDMFMLTDNEMGETP
DQWRKSQNYLQNLDPVLYERIRQLEGALKQTDVQAEPSAVDVEVKLQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 29..348
e-value: 4.7E-11
score: 44.2
NoneNo IPR availableCDDcd151967tmA_Vasopressin_Oxytocincoord: 104..201
e-value: 3.1505E-6
score: 46.0738
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 30..359
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 209..228
NoneNo IPR availableTMHMMTMhelixcoord: 319..341
NoneNo IPR availableTMHMMTMhelixcoord: 152..174
NoneNo IPR availableTMHMMTMhelixcoord: 267..289
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 117..139