Saposin B-type domain-containing protein

Overview
NameSaposin B-type domain-containing protein
Smed IDSMED30017556
Length (bp)974
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Saposin B-type domain-containing protein (SMED30017556) t-SNE clustered cells

Violin plots show distribution of expression levels for Saposin B-type domain-containing protein (SMED30017556) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Saposin B-type domain-containing protein (SMED30017556) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Saposin B-type domain-containing protein (SMED30017556) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017556

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30017556SMESG000020046.1 dd_Smed_v4_1329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017556SMESG000020046.1 dd_Smed_v6_1329_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017556SMESG000020046.1 dd_Smed_v4_1329_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30017556SMESG000020046.1 dd_Smed_v4_1329_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30017556SMESG000020046.1 dd_Smed_v4_1329_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30017556SMESG000020046.1 dd_Smed_v4_1329_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Saposin B-type domain-containing protein vs. Ensembl Fly
Match: Sap-r (gene:FBgn0000416 transcript:FBtr0085713)

HSP 1 Score: 50.8322 bits (120), Expect = 1.168e-6
Identity = 39/175 (22.29%), Postives = 80/175 (45.71%), Query Frame = 3
Query:  297 CFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFKNDDKVPNPSKY--------CSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLC 797
            C  C   ++ ++  + T  T D++++ + ++C  + S    +  +F++  G  +I  +++   P  +C +   C K  +  K D +V NP           C +C     Q     +   SK+ I +++   CS  P     EC  F++ + +++I  +IT+ K   +C  L+LC
Sbjct:  437 CTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPK-NLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNGLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLC 610          
BLAST of Saposin B-type domain-containing protein vs. Ensembl Fly
Match: Sap-r (gene:FBgn0000416 transcript:FBtr0085714)

HSP 1 Score: 50.8322 bits (120), Expect = 1.286e-6
Identity = 39/175 (22.29%), Postives = 80/175 (45.71%), Query Frame = 3
Query:  297 CFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFKNDDKVPNPSKY--------CSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLC 797
            C  C   ++ ++  + T  T D++++ + ++C  + S    +  +F++  G  +I  +++   P  +C +   C K  +  K D +V NP           C +C     Q     +   SK+ I +++   CS  P     EC  F++ + +++I  +IT+ K   +C  L+LC
Sbjct:  360 CTLCEYMLHFIQETLATPSTDDEIKHTVENICAKLPSGVAGQCRNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPK-NLPKKEDVEVFNPQPASDEQDPPTCPLCLFAVEQAQMKIRDNKSKDNIKKVLNGLCSHLPNEIKEECVDFVNTYSNELIDMLITDFKPQEICVQLKLC 533          
BLAST of Saposin B-type domain-containing protein vs. TrEMBL
Match: A0A1I8G4W7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034575g1 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 5.540e-10
Identity = 58/248 (23.39%), Postives = 115/248 (46.37%), Query Frame = 3
Query:  126 QNANKVSETICRLLPKAFQLQCSSLLHENNNKNIKVHAQ--------------LDLEMSKDKESR-WKPKR---KCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEV-IFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKK 812
            Q   ++ E +C  LP A Q  C S ++E     I++  Q                 +M+    S   KP R   +C  C   +  +E+ ++ + T  ++++ L  +C ++    +++   F+++  P +I  ++    P +IC +   C +++  +     K+   S  C  CQ+V   + SL K   ++++I   V   C+F PTA+   CK F+ ++   +I  ++ +   + +C+ L LC TQKK
Sbjct:  581 QEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPVASLVRKPARASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQPVSPVRAKLGATSTACDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLC-TQKK 827          

HSP 2 Score: 70.0922 bits (170), Expect = 2.251e-9
Identity = 48/242 (19.83%), Postives = 109/242 (45.04%), Query Frame = 3
Query:  153 ICRLLPKAFQLQCSSLLHE----------NNNKNIKVHAQLDLEMSKDKESRWKPKRK-------CFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFK----NDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKKS 815
            +C LLP+  + +C   + +          N     ++   L L  +  +     P RK       C  C   +  +++ +  + T  +++  LL +C ++    +++  +F+++  P +I  ++    P ++C     C +   + +          + S  C +CQ+V     SL +   ++++I Q+V   CSF PTA+   CK+F++++   +I  ++ +     +C+ + LC+T K +
Sbjct:  398 VCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTASTQRPPVTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMT 639          

HSP 3 Score: 67.3958 bits (163), Expect = 1.473e-8
Identity = 48/243 (19.75%), Postives = 109/243 (44.86%), Query Frame = 3
Query:  147 ETICRLLPKAFQLQCSS------------LLHENNNKNI----KVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFK----NDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKKS 815
            E +C  LP A +  C              LL + N   +     +  Q  L+ +  K+ +     +C  C   +  +++ ++ + T  +++  LL +C ++    +++   F+++  P +I  ++    P ++C     C +   + +          + S  C +CQ+V     SL +   ++++I Q+V   CSF PTA+   CK+F++++   +I  ++ +     +C+ L LC+  + +
Sbjct:  778 EKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLCTQKKLQAAVRKQKQISAGPQCLLCEFVMREVDKQLSQNATQTEIEAALLQVCSVLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKSSSTVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSRST 1020          
BLAST of Saposin B-type domain-containing protein vs. TrEMBL
Match: A0A267GYV9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034575g2 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.424e-10
Identity = 58/248 (23.39%), Postives = 115/248 (46.37%), Query Frame = 3
Query:  126 QNANKVSETICRLLPKAFQLQCSSLLHENNNKNIKVHAQ--------------LDLEMSKDKESR-WKPKR---KCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEV-IFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKK 812
            Q   ++ E +C  LP A Q  C S ++E     I++  Q                 +M+    S   KP R   +C  C   +  +E+ ++ + T  ++++ L  +C ++    +++   F+++  P +I  ++    P +IC +   C +++  +     K+   S  C  CQ+V   + SL K   ++++I   V   C+F PTA+   CK F+ ++   +I  ++ +   + +C+ L LC TQKK
Sbjct:  581 QEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPVASLVRKPVRASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQPVSPVRAKLGATSTACDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLC-TQKK 827          

HSP 2 Score: 70.0922 bits (170), Expect = 2.313e-9
Identity = 48/242 (19.83%), Postives = 109/242 (45.04%), Query Frame = 3
Query:  153 ICRLLPKAFQLQCSSLLHE----------NNNKNIKVHAQLDLEMSKDKESRWKPKRK-------CFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFK----NDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKKS 815
            +C LLP+  + +C   + +          N     ++   L L  +  +     P RK       C  C   +  +++ +  + T  +++  LL +C ++    +++  +F+++  P +I  ++    P ++C     C +   + +          + S  C +CQ+V     SL +   ++++I Q+V   CSF PTA+   CK+F++++   +I  ++ +     +C+ + LC+T K +
Sbjct:  398 VCSLLPQTVRQECDGFVQQFTPIIIQLLVNGLSPQRICTVLGLCTASTQRPPVTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMT 639          

HSP 3 Score: 64.6994 bits (156), Expect = 1.180e-7
Identity = 47/243 (19.34%), Postives = 108/243 (44.44%), Query Frame = 3
Query:  147 ETICRLLPKAFQLQCSS------------LLHENNNKNI----KVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFK----NDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKKS 815
            E +C  LP A +  C              LL + N   +     +  Q  L+ +  K+ +     +C  C   +  +++ ++ + T  +++  L  +C ++    +++   F+++  P +I  ++    P ++C     C +   + +          + S  C +CQ+V     SL +   ++++I Q+V   CSF PTA+   CK+F++++   +I  ++ +     +C+ L LC+  + +
Sbjct:  778 EKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLCTQKKLQAAVRKQKQISAGPQCLLCEFVMREVDKQLSQNATQTEIEAALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKSSSTVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSRST 1020          
BLAST of Saposin B-type domain-containing protein vs. TrEMBL
Match: A0A1I8GSE6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.041e-9
Identity = 58/248 (23.39%), Postives = 115/248 (46.37%), Query Frame = 3
Query:  126 QNANKVSETICRLLPKAFQLQCSSLLHENNNKNIKVHAQ--------------LDLEMSKDKESR-WKPKR---KCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEV-IFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKK 812
            Q   ++ E +C  LP A Q  C S ++E     I++  Q                 +M+    S   KP R   +C  C   +  +E+ ++ + T  ++++ L  +C ++    +++   F+++  P +I  ++    P +IC +   C +++  +     K+   S  C  CQ+V   + SL K   ++++I   V   C+F PTA+   CK F+ ++   +I  ++ +   + +C+ L LC TQKK
Sbjct:  581 QEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMTPPVASLVRKPVRASPQCLTCEFVMREVEQQLSQNATQTEIESALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTQVQQPVSPVRAKLGATSTACDTCQTVVVYVKSLLKENATEQEIIDTVEKVCNFLPTAERPTCKMFVDQYGPYVIQLLLQDLNPMQVCQLLGLC-TQKK 827          

HSP 2 Score: 69.707 bits (169), Expect = 2.704e-9
Identity = 48/242 (19.83%), Postives = 109/242 (45.04%), Query Frame = 3
Query:  153 ICRLLPKAFQLQCSSLLHE----------NNNKNIKVHAQLDLEMSKDKESRWKPKRK-------CFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFK----NDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKKS 815
            +C LLP+  + +C   + +          N     ++   L L  +  +     P RK       C  C   +  +++ +  + T  +++  LL +C ++    +++  +F+++  P +I  ++    P ++C     C +   + +          + S  C +CQ+V     SL +   ++++I Q+V   CSF PTA+   CK+F++++   +I  ++ +     +C+ + LC+T K +
Sbjct:  398 VCSLLPQTVRQECDGFVQQFTPIIIQLLVNGLSPQRICTVLGLCTASTQRPPVTPVRKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSVLPQTVRQECDNFVQQFTPTIIQLLVNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKSSSTTCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLVGLCTTTKMT 639          

HSP 3 Score: 67.781 bits (164), Expect = 1.166e-8
Identity = 49/256 (19.14%), Postives = 113/256 (44.14%), Query Frame = 3
Query:  126 QNANKVS-----ETICRLLPKAFQLQCSSLLHE----------NNNKNIKVHAQLDLEMSKDKESRWKPKRK-------CFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFK----NDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKKS 815
            QNA +       + +C LLP+  + +C   + +          N     ++   L L  +  +     P +K       C  C   +  +++ +  + T  +++  LL +C ++    +++  +F+++  P +I  ++    P ++C     C +   + +          + S  C +CQ+V     SL +   ++++I Q+V   CSF PTA+   CK+F++++   +I  ++ +     +C+ L LC+  + +
Sbjct:  860 QNATQTEIEAALQQVCSLLPQTVRQECDGFVQQYTPIIIQLLVNGLSPQRICTVLGLCTASTQRPPVTPVQKPVQAGPQCLICEFVMREVDKQLGQNATQAEIETALLQVCSLLPQTVRQECDNFVQQFTPTIIQLLMNGLSPQRVCSALGLCSQRAPLHRLAPTPKSSTKSSSTVCDVCQTVMQYAKSLLQENATEQEIVQLVERVCSFLPTAEQAACKSFINEYGAYVIQLLLQDANPRQICQLLGLCTNSRST 1115          
BLAST of Saposin B-type domain-containing protein vs. TrEMBL
Match: A0A2S2PIT1 (Sulfated glycoprotein 1 OS=Schizaphis graminum OX=13262 GN=Psap PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.519e-8
Identity = 64/284 (22.54%), Postives = 118/284 (41.55%), Query Frame = 3
Query:  147 ETICRLLPKAFQLQCSSLLHENNNKNIKVHAQ----------------LDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCC---------------------HKIEVIFKN---------------DDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFM-ITEDKTVSLCESLRLCSTQKKSSDTLFGLP 839
            E  C ++P + + QC   + +  +  I + AQ                +DL ++ +K+S  +    C  C+ F+  LE  I+   T + ++  L  LC  + S  K +  +F+  +   ++  ++ +  P +IC + + C                      ++ ++F                 + KVP P   C +C  V   L  + K K ++E+I Q++ +ACS  P  + NEC+ F++    KII F+ I  D  V+ C +L +C   K        LP
Sbjct:  504 EKSCMVMPSSLEQQCKQFVDQYGDAFISLVAQEVDPSIICPELKLCPEIDLSLTSNKDS--ESSNNCPMCVIFMSALESEISNKDTEEVIKKKLEKLCTKLPSKWKGECTNFVSSQLQSILDMLVAQVKPEEICVLLDICKPKTISESAEDDLETNMIATAGQVTIVFPGYNMGQLLANNYKMLEEPKVPTP--LCLVCTVVMKYLHGIIKDKTNQEEIEQVLDSACSVLPNVEENECQTFINTNYQKIIKFIQIGTDPGVA-CMALMVCEEDKVKGKINIDLP 782          
BLAST of Saposin B-type domain-containing protein vs. TrEMBL
Match: A0A0P4WIQ3 (Uncharacterized protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 4.661e-7
Identity = 42/173 (24.28%), Postives = 80/173 (46.24%), Query Frame = 3
Query:  282 KPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCC-HKIEVIFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLC 797
            K   KC  C   +  L   +    T + ++N +  +C+++     E+  D+++  G ++I  + ++  P K+CQM + C  + E + + DD        C +C+    QL  +     ++E+I Q +   CS  P     EC+ F+  + D++I  +I E     +C  L LC
Sbjct:  446 KDDNKCVMCEFVMQFLRNMLEQKDTREDIENAVESVCRLMPHHLSEECEDYVEAYGDQVIELLAQEIDPAKVCQMIHLCPAEPEAMPQKDDV------SCVMCEYAITQLDKMLGDHKTEEEIRQALDNLCSVLPKTVRAECQLFVDTYTDQVIRMLINEFTPDQICIQLHLC 612          
BLAST of Saposin B-type domain-containing protein vs. Ensembl Nematostella
Match: EDO31455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXX5])

HSP 1 Score: 57.7658 bits (138), Expect = 2.342e-9
Identity = 42/180 (23.33%), Postives = 85/180 (47.22%), Query Frame = 3
Query:  282 KPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCC----HKIEVIFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQK 809
            K   +C  C   +  L+  ++ + T  ++   +  +C I+ S  K K   F+++ GP LI  + ++  P  +C     C    H+I  + ++   V   ++ C IC +V   L +      + E+I   +   C++ P+  A+EC A +S++   ++  +   D T +LC+ + LCS  +
Sbjct:  237 KTSTECVLCEFVMKELDDMLSKNSTQQEIIQAVEKVCSILPSTIKSKCDQFVQEYGPALIEILEQEVSPKLVCTTLGLCANREHRI-AMRRSHKLVIGSNETCEICTTVMTYLKAFLNNNATDEEIVNFLEKVCNYLPSQIASECNAIVSEYGSTVLQIIANTDPT-TLCKEIGLCSANQ 414          
BLAST of Saposin B-type domain-containing protein vs. Planmine SMEST
Match: SMESG000020046.1 (SMESG000020046.1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.140e-173
Identity = 238/244 (97.54%), Postives = 242/244 (99.18%), Query Frame = 3
Query:  111 CDDEFQNANKVSETICRLLPKAFQLQCSSLLHENNNKNIKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKKSSDTLFGLPM 842
            CDDEFQNANKVSETICRLLPKAFQLQCSSLLHENNNK+IKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCP+KICQMEN CHKIEVIF+NDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQ+VGTACSFGPTAQANECKAFLS FQDKIISFMITEDKTVSLCESLRLCSTQKKSSDTLFGLPM
Sbjct:   19 CDDEFQNANKVSETICRLLPKAFQLQCSSLLHENNNKHIKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPIKICQMENFCHKIEVIFENDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQVVGTACSFGPTAQANECKAFLSIFQDKIISFMITEDKTVSLCESLRLCSTQKKSSDTLFGLPM 262          
BLAST of Saposin B-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019975.1 (SMESG000019975.1)

HSP 1 Score: 65.4698 bits (158), Expect = 4.428e-12
Identity = 54/235 (22.98%), Postives = 104/235 (44.26%), Query Frame = 3
Query:  153 ICRLLPKAFQLQCS--SLLHENNNKNIKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQK----KSSDTLFGLP 839
            +C L P+ F+ +CS  S         I++HAQ+ ++M+  +E++      C  C   +  +   I ++ + D V+  L  +C  +    K    D + K    ++  I+K     KICQ    C  +  I    +K    S  C IC  +  ++      +   E+I + +   C+  P    ++C  F+ ++  +I+  ++       +C +L+LC T+     KS DT++ LP
Sbjct:   33 LCTLFPETFREKCSEYSPTKPIGISEIEIHAQIKIKMTNSEENK---SFGCDVCKKLIQQVIDAIGSNHSKDVVRKELEKVCDGLPFVWKPVCKDIVDKFADTIVDEIVKNLPADKICQNIGLCSSLAAISPPREK----SVLCWICSQIIEEIFKQIGERRVAEEIKRALEGVCNIFPVIYRHQCNEFVDRYAVEIVKLILEGKAGGVICSALQLCETRNYPTIKSKDTMYFLP 260          
BLAST of Saposin B-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019973.1 (SMESG000019973.1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.091e-12
Identity = 58/242 (23.97%), Postives = 115/242 (47.52%), Query Frame = 3
Query:  126 QNANKVSETICRLLPKAFQLQCSSLLHENNNKNIKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQ---MENCCHKIEVIFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKK-SSDTLFGLP 839
            +N   + + +C + PK+ +++C +                + + S DKE  + P +  F C      L   ++TS + +Q++   L  C +  S  +     F ++EG K+I ++LKK+ P K+C+   +     K   +     KV NP + C +C+ +   L  + K + +KE+I   +   CS  P  ++ +C  F+ K+  KI+ F++  +    +C  L +CS++     DT++ +P
Sbjct:   30 KNVQNIKKALCEMFPKSLKVECYT----------------EPDKSDDKEF-YIPHQHQFICKRIAMFLGHDLDTSKSPEQLKKLFLPTCNMFRSHLRNICKKFTEEEGKKIIKKLLKKENPKKVCKKRLLRVSVGKNNGLITAKSKVNNPLE-CLLCKEIIKYLDEILKKESTKEEILLALNKVCSLLPANKSKQCVLFIDKYASKIMDFLVDGNPPEMVCHFLLVCSSKDTVPEDTMYFIP 253          
BLAST of Saposin B-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019986.1 (SMESG000019986.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.415e-10
Identity = 63/249 (25.30%), Postives = 111/249 (44.58%), Query Frame = 3
Query:  153 ICRLLPKAFQLQCSSLLHENN----NKNIKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIEVIFKNDDKVPN--------------PSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACS-FGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKKSSDTLFGLPM 842
            +C+L  + F+  C   L  ++    N +IKV  QLD E+S   + R   + KC  C   +   +  I+ SL++  +QN  L +C     P ++    F K +G ++I  I + +  MKICQ+ N C     ++++ D   N               +K C+ C +  + +      KL+ E++   + + C  F P +Q   CK   S    K I  ++    T  +C++L LC  +    +TL  + M
Sbjct:   39 LCQLFSENFKEVCHKNLSNDDKFTVNADIKV--QLDSEISTADQPRVH-RNKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLC-----LYEDSDDKYNVLTDLLLIDIFQQPTTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTF-CKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINM 278          

HSP 2 Score: 54.6842 bits (130), Expect = 6.327e-8
Identity = 51/212 (24.06%), Postives = 91/212 (42.92%), Query Frame = 3
Query:  249 LEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHK----------IEVIFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVG---TACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLC---STQKKSSDTLFGL 836
            ++M K K       + C  C+  V   E  +N SL+++ +Q  ++ LC I ++  K   I F + +G ++I  IL  + P KICQ+ N C            ++++  +  + P P      CQS    +    K   + +   +I G     CS      AN C  + +    +II  ++ ++    +CE L  C   ++Q + S  L  L
Sbjct:  472 IKMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDH----CQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTL 679          

HSP 3 Score: 49.2914 bits (116), Expect = 3.233e-6
Identity = 41/182 (22.53%), Postives = 77/182 (42.31%), Query Frame = 3
Query:  291 RKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQMENCCHKIE--------VIFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQIVGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQKK 812
            +KC  C   + +LE  +N +L +  +QN +L  C + +SP K+K I F +  G ++I  +L  + P K+C+    C K          +   N     N ++ C IC+     +  +     + E++  +V   C          CK F  K   ++   ++      ++C+ L  C   +K
Sbjct:  289 QKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVLPR----TVCQKLEFCRADEK 466          
BLAST of Saposin B-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019977.1 (SMESG000019977.1)

HSP 1 Score: 48.521 bits (114), Expect = 9.261e-7
Identity = 34/137 (24.82%), Postives = 69/137 (50.36%), Query Frame = 3
Query:  114 DDEFQNANKVSETICRLLPKAFQLQCSSLLHENNNKNIKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLTSDQVQNHLLDLCQIISSPKKE-KIIDFLKKEGPKLIPRILKKDCPMKICQMENCCH 521
             +E QN+    + +C L P+ F+ +CS  ++E++    K+    ++E+  + E   K K KC  C   +  + ++I  + T  ++   +  +C+     + E K++  +KK GPK++  I+K     +IC+    CH
Sbjct:   20 GEEIQNSAGEIKLLCTLFPQTFKEKCSEFINEDSTSKCKIEITANIEIEVNDE---KGKSKCKLCKKVIGAIIKYIGKNPTKKKIIEAMKVICKFFGVFEFECKLL--IKKYGPKILDYIMKWMSSDQICKKLGLCH 151          
The following BLAST results are available for this feature:
BLAST of Saposin B-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Sap-r1.168e-622.29gene:FBgn0000416 transcript:FBtr0085713[more]
Sap-r1.286e-622.29gene:FBgn0000416 transcript:FBtr0085714[more]
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G4W75.540e-1023.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GYV98.424e-1023.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GSE61.041e-923.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2S2PIT12.519e-822.54Sulfated glycoprotein 1 OS=Schizaphis graminum OX=... [more]
A0A0P4WIQ34.661e-724.28Uncharacterized protein OS=Scylla olivacea OX=8555... [more]
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO314552.342e-923.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Saposin B-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Saposin B-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020046.11.140e-17397.54SMESG000020046.1[more]
SMESG000019975.14.428e-1222.98SMESG000019975.1[more]
SMESG000019973.17.091e-1223.97SMESG000019973.1[more]
SMESG000019986.11.415e-1025.30SMESG000019986.1[more]
SMESG000019977.19.261e-724.82SMESG000019977.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017556 ID=SMED30017556|Name=Saposin B-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=974bp
AATTACTCCATTTAATTTGATTATCGTCATTGATTTTACGCAATTGAAAG
TTAAAAATGAAATTATTACTTGGCATAATTATCTTATTGGCATTAAATTC
TTCATCTTTATGTGATGATGAATTTCAGAATGCCAATAAAGTATCCGAAA
CTATCTGTAGATTACTTCCTAAGGCTTTCCAATTGCAGTGTTCAAGTCTT
TTACACGAGAATAATAATAAAAATATTAAAGTACACGCTCAATTGGATTT
GGAAATGTCAAAAGATAAAGAATCACGATGGAAACCAAAAAGAAAATGCT
TTAAATGTATAGCTTTCGTCTATATGTTAGAGCGTTTCATCAATACTTCA
CTGACTTCAGATCAAGTACAAAATCATTTGTTAGATCTTTGCCAAATAAT
TTCTTCACCGAAAAAAGAAAAAATTATCGATTTCTTGAAAAAAGAAGGAC
CTAAATTGATTCCACGAATACTTAAAAAAGACTGTCCAATGAAGATTTGT
CAAATGGAAAACTGTTGTCACAAAATCGAAGTTATATTCAAAAATGATGA
TAAGGTTCCAAATCCATCAAAATATTGTTCGATCTGCCAATCGGTTTCAA
ATCAGCTGGGTAGCCTTAGAAAATTGAAACTATCGAAAGAAAAAATTAAC
CAAATTGTCGGAACTGCATGCTCCTTCGGGCCTACAGCGCAAGCCAATGA
ATGCAAGGCATTCCTTTCAAAATTCCAAGACAAAATCATTAGCTTCATGA
TTACTGAAGACAAAACTGTCTCACTTTGTGAATCATTACGTTTGTGCTCG
ACTCAAAAGAAATCATCTGATACTTTATTCGGACTACCAATGTTGGAACT
CCAATAACTTGAACTTAATTTTAACTAACTGCACAAATTCTTAATCTTTT
ATTTTAGATTTATTAGCTGCTCATTTCTTAGTATTTACATTTTTAATAAA
TATTCGATAAACCTTGAAAAAAAA
back to top

protein sequence of SMED30017556-orf-1

>SMED30017556-orf-1 ID=SMED30017556-orf-1|Name=SMED30017556-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=267bp
MKLLLGIIILLALNSSSLCDDEFQNANKVSETICRLLPKAFQLQCSSLLH
ENNNKNIKVHAQLDLEMSKDKESRWKPKRKCFKCIAFVYMLERFINTSLT
SDQVQNHLLDLCQIISSPKKEKIIDFLKKEGPKLIPRILKKDCPMKICQM
ENCCHKIEVIFKNDDKVPNPSKYCSICQSVSNQLGSLRKLKLSKEKINQI
VGTACSFGPTAQANECKAFLSKFQDKIISFMITEDKTVSLCESLRLCSTQ
KKSSDTLFGLPMLELQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042742defense response to bacterium
GO:0006629lipid metabolic process
GO:0006665sphingolipid metabolic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR008139SaposinB_dom
IPR011001Saposin-like
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008139Saposin B type domainSMARTSM00741sapb_4coord: 172..247
e-value: 4.1E-5
score: 33.0
coord: 79..154
e-value: 0.48
score: 12.4
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 77..158
score: 9.954
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 170..251
score: 14.603
NoneNo IPR availableGENE3DG3DSA:1.10.225.10coord: 77..158
e-value: 2.2E-7
score: 33.3
coord: 170..255
e-value: 5.8E-10
score: 41.5
NoneNo IPR availablePANTHERPTHR11480SAPOSIN-RELATEDcoord: 79..250
NoneNo IPR availablePANTHERPTHR11480:SF67SAPOSIN-RELATEDcoord: 79..250
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.895
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 172..249
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 80..156