Lipopolysaccharide cholinephosphotransferase

Overview
NameLipopolysaccharide cholinephosphotransferase
Smed IDSMED30017555
Length (bp)1113
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lipopolysaccharide cholinephosphotransferase (SMED30017555) t-SNE clustered cells

Violin plots show distribution of expression levels for Lipopolysaccharide cholinephosphotransferase (SMED30017555) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lipopolysaccharide cholinephosphotransferase (SMED30017555) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lipopolysaccharide cholinephosphotransferase (SMED30017555) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017555

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017555SMESG000043355.1 dd_Smed_v4_2367_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017555SMESG000043355.1 dd_Smed_v4_2367_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017555SMESG000043355.1 dd_Smed_v4_2367_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30017555SMESG000043355.1 dd_Smed_v4_2367_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipopolysaccharide cholinephosphotransferase vs. TrEMBL
Match: A0A5J4NGR6 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0005546 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 6.888e-43
Identity = 86/219 (39.27%), Postives = 123/219 (56.16%), Query Frame = 1
Query:  454 KDCGIPG--EHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYN-GPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHEN------KLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKT--FQSLYKC--SKGSWV 1071
            K+C + G    + L + +K WI+F +D+ I WW+ YGSL+GS+R+  M+ +D+D+D+ +   +E  LR L+T R NI+  Q N++TRPG HC Y+ G R+DC G  VTS  D CAFCGPLAR+FY   + IDIY   +++  N           +EGT EY         +  FPL +C  M L V CP   + +L + Y        YKC  + G W 
Sbjct:  227 KNCSVVGLSRRQSLLRTLKHWIRFANDNMIIWWITYGSLLGSVRNGTMIPYDTDMDIAILGSHEAQLRRLATDRQNITPGQFNLVTRPGDHCVYSTGSRVDCTGKQVTSLTDTCAFCGPLARIFYEFGQYIDIYQVHLELRLNSANKPLSFGFYDEGTHEYTPTENLHDASSLFPLSSCRMMGLDVPCPSEPDKILEEVYGAEFIIPKYKCNLTNGEWT 445          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. TrEMBL
Match: G7YSX8 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_109802 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 7.848e-39
Identity = 85/222 (38.29%), Postives = 127/222 (57.21%), Query Frame = 1
Query:  433 YSDLKFSKDCGIPGE--HEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYN-GPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKL-KIIEEGTF-EYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSL--YKCSK--GSWV 1071
            ++    S+ C +  E   E L++ ++ WI+  +   I WW+ YG+L+GS R  +M+ +DSD+D+ +   YE  LR L+T R +I   + N++TRPG HC  + G R+DC G+ VTS  D C+FCGPLAR+F+   + +DIYL  +++  +     IE G F E M      P +  FPLR C +M L V CP + E  LT  Y    +L   +CS+  GSW 
Sbjct:  198 FNKTSLSRPCPVVRESRRESLYRTLQEWIRIANQSGILWWITYGTLLGSWRDGNMIPYDSDVDISILGSYEKRLRQLATDRKSIQKGKFNLVTRPGEHCVTSPGLRLDCDGHNVTSLQDTCSFCGPLARMFHQYGEYVDIYLVHLEVRVDVANNPIEFGYFDEGMDRDRVEPASVIFPLRTCKYMGLSVPCPNDPERFLTSVYGEEFALPRSRCSQETGSWT 419          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. TrEMBL
Match: A0A419Q1H5 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_8277s PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 7.930e-39
Identity = 85/222 (38.29%), Postives = 127/222 (57.21%), Query Frame = 1
Query:  433 YSDLKFSKDCGIPGE--HEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYN-GPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKL-KIIEEGTF-EYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSL--YKCSK--GSWV 1071
            ++    S+ C +  E   E L++ ++ WI+  +   I WW+ YG+L+GS R  +M+ +DSD+D+ +   YE  LR L+T R +I   + N++TRPG HC  + G R+DC G+ VTS  D C+FCGPLAR+F+   + +DIYL  +++  +     IE G F E M      P +  FPLR C +M L V CP + E  LT  Y    +L   +CS+  GSW 
Sbjct:  198 FNKTSLSRPCPVVRESRRESLYRTLQEWIRIANQSGILWWITYGTLLGSWRDGNMIPYDSDVDISILGSYEKRLRQLATDRKSIQKGKFNLVTRPGEHCVTSPGLRLDCDGHNVTSLQDTCSFCGPLARMFHQYGEYVDIYLVHLEVRVDVANNPIEFGYFDEGMDRDRVEPASVIFPLRTCKYMGLSVPCPNDPERFLTSVYGEEFALPRSRCSQETGSWT 419          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. TrEMBL
Match: A0A4S2L6M5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009663 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 8.265e-39
Identity = 90/225 (40.00%), Postives = 125/225 (55.56%), Query Frame = 1
Query:  427 KGYSDL-KFSKDCGI--PGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYN-GPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKL-KIIEEGTF-EYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYK--CSK--GSWV 1071
            KG+S+    SK C I      E L+Q ++ WIK  +   I WW+ YG+L+GS R  +M+ +DSD+D+ +   YE  LR L+T R  I   + N++TRPG HC  + G R+DC G  VTS  D C+FCGPLAR+F+   + +DIY   +++H +     IE G   E M      P +  FPLR C +M L V CP + E  LT  Y    +L K  CS+  G W 
Sbjct:  195 KGFSNKNSLSKPCPIVRASRRESLYQTLQEWIKMANQSKILWWITYGTLLGSWRDGNMIPYDSDVDISILGSYEKRLRELATDRKAIQKGKFNLVTRPGEHCVTSPGLRLDCNGRNVTSLQDTCSFCGPLARMFHQYGEYVDIYPVHLEVHVDVANNPIEFGYLDEGMDRDRVDPASVIFPLRTCKYMGLSVPCPNDPERFLTSVYGKEFALPKSRCSQETGKWT 419          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. TrEMBL
Match: A0A075A604 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_12530 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.361e-36
Identity = 85/217 (39.17%), Postives = 120/217 (55.30%), Query Frame = 1
Query:  448 FSKDCGI--PGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYN-GPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKL-KIIEEGTF-EYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYK--CSK--GSWV 1071
             S+ C I      E L++ ++ WI+  +   I WW+ YG+L+GS R  +M+ +DSD+D+ +   YE  LR L+T R +I   + N++TRPG HC  + G R+DC G  VTS  D C+FCGPLAR+F    + IDIY   +++  +     IE G   E M      P +  FPLRNC +M L V CP + E  LT  Y    +L K  CS+  G W 
Sbjct:  199 LSRPCPIVSASRRESLYRTLQDWIRIANQSKILWWITYGTLLGSWRDGNMIPYDSDVDISILGSYEKRLRELATDRKSIQKGKFNLVTRPGEHCVTSPGLRLDCGGRNVTSLRDTCSFCGPLARMFRQYGEYIDIYPVHLEVRMDVANNPIEFGYLDEGMDRDRVEPASVIFPLRNCKYMGLNVPCPNDPERFLTSVYGKEFALPKSRCSQETGRWT 415          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Nematostella
Match: EDO31192 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYN3])

HSP 1 Score: 105.916 bits (263), Expect = 3.504e-26
Identity = 67/207 (32.37%), Postives = 110/207 (53.14%), Query Frame = 1
Query:  478 HEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSR--LNISNKQVNIITRPGPHCPYNG-----PRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYK---TFQSLYKCSKGSW 1068
              QL +L+ +W KFT ++NI + + +GSL+G +R  D++AWD DID+ +  +    LR L+ +    + ++  +++     P   +N       R+ C+G  V   +D C+F  PLAR+    W  IDIY + V++ + KL  + EG    M++A        FPL+ C +M L  LCP+N E +L D+Y       + +KC  G W
Sbjct:   85 RAQLTELLNYWNKFTKNNNISYAIMWGSLLGLLRTNDIMAWDYDIDVIVSLKDLVKLRKLAKAEGSFDYNDGNIHLAVMAEPEKSFNTSADKRARLSCRGEAVDKVMDPCSFVDPLARLLL-KWFFIDIYTY-VEVGD-KLFALPEGKRFVMNKAD------MFPLQRCHYMGLECLCPRNPERLLEDWYGPGCVDANEFKCRDGEW 282          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Nematostella
Match: EDO45603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB6])

HSP 1 Score: 92.0485 bits (227), Expect = 3.717e-21
Identity = 65/217 (29.95%), Postives = 103/217 (47.47%), Query Frame = 1
Query:  457 DCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQ-----VNIITRPGPHCPYNGP-----RMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKT--FQSLYKCSKGSWV 1071
            +C   G  + L  ++++W + T+ HNI + L +GSLIG+IR  D++ WD D+DL +P +   +L  L   R +   K      +N I    P   +N       R DC G L  S VD C+   P+ R  YN+   +D++ +  Q  E  + I E    E          N ++P+R C F+ +   CP N  ++L+ +Y     +S   C  G WV
Sbjct:  110 NCPDNGRRKPLTAILQYWTEITAKHNITYALMWGSLIGAIRTNDVIPWDHDMDLVVPYKDILVLEKLGWPRSSDPYKSDGRTYINAI----PSSEHNKSMDDRLRWDCSGKLTPSHVDLCSIQEPIVR-LYNNGAFLDVFHYYDQ-GETVVTIPEGHKLEMKR-------NDFYPIRECLFLGIKSKCPNNPASLLSKWYGLNFIKSPKTCKDGHWV 313          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Nematostella
Match: EDO45540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB7])

HSP 1 Score: 77.0258 bits (188), Expect = 3.514e-16
Identity = 61/209 (29.19%), Postives = 96/209 (45.93%), Query Frame = 1
Query:  487 LFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLR-----NLSTSR--LNISNKQVNIITRP-GPHCPY--NGPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKT--FQSLYKCSKGSWVKI 1077
            L  L++ W    S HNI + L YGSL+G  R  D++ WD D+D+ +   Y+ +L+     N+   R   +I++   +++  P   H  +  +  R DC G  V   VD C+   PLAR+   S   +D Y +  +  +N + + E  T  Y            FPL+ C  M +   CPK+   VL  +Y      S   C  G WV++
Sbjct:   56 LVTLLRTWNLIASHHNITYSLMYGSLLGVERTADILPWDHDLDIMV--SYDGILKLERIANICDPRGHFDINDGLPHLVVLPNSEHNVFMDDRRRFDCAGKEVAKLVDACSIQEPLARLIAGS-VFMDFYHY-TEKEDNLISVPEGKTVTYAKGE-------VFPLKECFLMGVKSWCPKDPIRVLETWYGKGRLGSHKSCQSGEWVEL 253          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Nematostella
Match: EDO38600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCH0])

HSP 1 Score: 59.6918 bits (143), Expect = 7.000e-10
Identity = 59/207 (28.50%), Postives = 98/207 (47.34%), Query Frame = 1
Query:  487 LFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGPRMD------CKGNLV-TSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPR--SPLNWYFPLRNCSFMNLMVLCPKNLEAVL-TDYYKTFQSLYK-CSKGSWVK 1074
            L  L+  W    + H I +++  GSL+G  R++D++ +DSD+D+ +       LR++++ R +   K  +  TR      Y G  MD      C G  V    VD C+F  P+AR+     + +DI+ +      N +         Y     +   P + +FP++ C+F+     CP+N E +L T Y + F + YK C  G WVK
Sbjct:  270 LRDLLASWHLLAAKHKIRYFITSGSLLGYYRNRDIIPYDSDVDVYVDVDSYSTLRSIASPR-DFKFKTADSKTRLVVQMDYWGTPMDSRIRTSCDGRTVDRGSVDPCSFQDPMARLIRRG-RYVDIFAY---FTTNGVVNTTPTPMYYDPTTKKYFKPED-FFPIKPCTFIGTPTYCPRNAETMLKTMYGEHFATPYKICKNGLWVK 470          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Nematostella
Match: EDO41199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S587])

HSP 1 Score: 50.0618 bits (118), Expect = 5.374e-7
Identity = 16/40 (40.00%), Postives = 30/40 (75.00%), Query Frame = 1
Query:  514 KFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQ 633
            + +  HN+ +W+A G+L+G++RHK M+ WD D+D+ +P +
Sbjct:   90 EISQKHNLTYWIARGTLLGAVRHKGMIPWDIDLDIVLPNE 129          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Medaka
Match: fkrp (fukutin related protein [Source:NCBI gene;Acc:101164830])

HSP 1 Score: 48.521 bits (114), Expect = 8.334e-6
Identity = 18/46 (39.13%), Postives = 30/46 (65.22%), Query Frame = 1
Query:  487 LFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGM 624
            L +  K+ I       + +WL  GSL+G++RH+D++ WD D+DLG+
Sbjct:  358 LRETTKYVINILESSGVRYWLEGGSLLGAVRHQDIIPWDYDVDLGI 403          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Planmine SMEST
Match: SMESG000043355.1 (SMESG000043355.1)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 311/313 (99.36%), Postives = 312/313 (99.68%), Query Frame = 1
Query:  139 MNLSTENGNQCPMFKEKPKRXXXXXXXXXXXXXXSVYYYFFDISIFNSPKLEFSNSYLCKYFINNNETWNFTEFDVTTIGDMTPIQLQLHNSNISYKGYSDLKFSKDCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYKCSKGSWVKI 1077
            MNLSTENGNQCPMFKE PKRFLFVLLCLFGLVFLSVYYYFFDISIFNSPKLEFSNSYLCKYFINNNETWNFTEFDVTTIGDMTPIQLQLHNSNISYKGYSDLKFSKDCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKI+EEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYKCSKGSWVKI
Sbjct:    1 MNLSTENGNQCPMFKENPKRFLFVLLCLFGLVFLSVYYYFFDISIFNSPKLEFSNSYLCKYFINNNETWNFTEFDVTTIGDMTPIQLQLHNSNISYKGYSDLKFSKDCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIVEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYKCSKGSWVKI 313          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Planmine SMEST
Match: SMESG000043345.1 (SMESG000043345.1)

HSP 1 Score: 301.982 bits (772), Expect = 5.087e-102
Identity = 133/236 (56.36%), Postives = 176/236 (74.58%), Query Frame = 1
Query:  364 VTTIGDMTPIQLQLHNSNISYKGYSDLKFSKDCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYKCSKGSWV 1071
            +  I  +   ++++ N NISY+GY D  + ++CGIP EH+ LF++MK WI+ T+ +NI WW+ YGSLIGS+RH+DM+ WDSDID+G+P+QYE++LR +ST R  ISN ++NIITRPGPHCPYNG R++C+G  VTS  DGC+FCGP AR+F+    RIDIYLF +QIHEN+L+I++EG +EYM      PLNWYFPLRNCSFM L+V CP   E +L DYY  F+   KC  G W 
Sbjct:   14 IRKISQLESDKIKIMNENISYQGYMDSSYDRECGIPNEHKTLFRIMKSWIEITARNNITWWMIYGSLIGSLRHQDMIPWDSDIDIGIPSQYENVLRQISTPRSEISNDKINIITRPGPHCPYNGMRINCQGKPVTSHEDGCSFCGPFARLFFKPDIRIDIYLFYIQIHENQLQILDEGIYEYMPNPLYFPLNWYFPLRNCSFMGLIVQCPSKSEIILNDYYGDFKMRSKCVNGKWT 249          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Planmine SMEST
Match: SMESG000043345.1 (SMESG000043345.1)

HSP 1 Score: 302.753 bits (774), Expect = 1.629e-101
Identity = 133/236 (56.36%), Postives = 176/236 (74.58%), Query Frame = 1
Query:  364 VTTIGDMTPIQLQLHNSNISYKGYSDLKFSKDCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYKCSKGSWV 1071
            +  I  +   ++++ N NISY+GY D  + ++CGIP EH+ LF++MK WI+ T+ +NI WW+ YGSLIGS+RH+DM+ WDSDID+G+P+QYE++LR +ST R  ISN ++NIITRPGPHCPYNG R++C+G  VTS  DGC+FCGP AR+F+    RIDIYLF +QIHEN+L+I++EG +EYM      PLNWYFPLRNCSFM L+V CP   E +L DYY  F+   KC  G W 
Sbjct:   72 IRKISQLESDKIKIMNENISYQGYMDSSYDRECGIPNEHKTLFRIMKSWIEITARNNITWWMIYGSLIGSLRHQDMIPWDSDIDIGIPSQYENVLRQISTPRSEISNDKINIITRPGPHCPYNGMRINCQGKPVTSHEDGCSFCGPFARLFFKPDIRIDIYLFYIQIHENQLQILDEGIYEYMPNPLYFPLNWYFPLRNCSFMGLIVQCPSKSEIILNDYYGDFKMRSKCVNGKWT 307          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Planmine SMEST
Match: SMESG000043342.1 (SMESG000043342.1)

HSP 1 Score: 246.899 bits (629), Expect = 9.869e-80
Identity = 116/231 (50.22%), Postives = 152/231 (65.80%), Query Frame = 1
Query:  376 GDMTPIQLQLHNSNISYKGYSDLKFSKDCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYKCSKGSW 1068
            G  TP Q Q+ NSN+SY+GY D  F  DC  P  H + F LMK WI    ++NI WWL  GSLIGS + KDM+ WDSDID+G+P+++ +L+ N+ST R +IS  + +IITRPGPHCP NG R+DC GN V + VDGC+FCGP ARVF++  KRIDI+L  ++IH+N+LK+  E  F         P+ W FPL  C FM L V CPK+LE ++   Y  F+    C  G+W
Sbjct:   66 GLFTPQQCQIMNSNVSYQGYLDQSFIGDCSFPANHNEYFDLMKIWIDIAGNNNITWWLISGSLIGSWKFKDMIPWDSDIDIGVPSKFMNLIHNISTDRKDISANKTSIITRPGPHCPRNGMRLDCNGNPVHALVDGCSFCGPFARVFHDHRKRIDIFLSYLEIHDNQLKVSGEEMFNDDLIKRSIPIEWNFPLHQCPFMGLTVPCPKDLEKIINFQYGHFKYDQLCINGTW 296          
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Planmine SMEST
Match: SMESG000043343.1 (SMESG000043343.1)

HSP 1 Score: 246.128 bits (627), Expect = 1.412e-79
Identity = 116/233 (49.79%), Postives = 153/233 (65.67%), Query Frame = 1
Query:  376 GDMTPIQLQLHNSNISYKGYSDLKFSKDCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKDMVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGPRMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKIIEEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQSLYKCSKGSWVK 1074
              ++P Q+Q  N N+ Y+GY D  F K+C IP  HEQLF LMKFWI + + +NI WWL Y S IGS+RHKDM+ WD++I +G+ +QYE +LR  ST    +S+K+VNIIT PG +CP N  R++C G  V  Q DGC+FC P AR+FY    RIDIYL+D+Q+H N+L   E+G F  + + P+S ++W+   R CSFM L VLCPK  E  L  YYK+    Y C  G W K
Sbjct:   52 SQLSPKQIQKINFNVLYQGYVDNDFRKNCKIPKAHEQLFGLMKFWIGYAAANNISWWLIYESFIGSVRHKDMIPWDNEIYIGISSQYESILRLSSTPSEKLSSKKVNIITSPGEYCPNNDLRLNCHGQFVNRQEDGCSFCVPFARLFYIHDTRIDIYLYDLQLHNNRLTFSEDGIFSQILQNPQSRVHWHLESRKCSFMKLTVLCPKMSETPLESYYKSVPPEYHCIYGLWKK 284          
The following BLAST results are available for this feature:
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NGR66.888e-4339.27Uncharacterized protein OS=Paragonimus westermani ... [more]
G7YSX87.848e-3938.29Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A419Q1H57.930e-3938.29Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A4S2L6M58.265e-3940.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A075A6041.361e-3639.17Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO311923.504e-2632.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456033.717e-2129.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455403.514e-1629.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386007.000e-1028.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411995.374e-740.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fkrp8.334e-639.13fukutin related protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Lipopolysaccharide cholinephosphotransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043355.10.000e+099.36SMESG000043355.1[more]
SMESG000043345.15.087e-10256.36SMESG000043345.1[more]
SMESG000043345.11.629e-10156.36SMESG000043345.1[more]
SMESG000043342.19.869e-8050.22SMESG000043342.1[more]
SMESG000043343.11.412e-7949.79SMESG000043343.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017555 ID=SMED30017555|Name=Lipopolysaccharide cholinephosphotransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1113bp
CTAATATTTGCAGAAACTGGGCTGATTAGATAGAATTTCATCGATTGCAC
ACACCCAACAATTTACAGATCTCAATCGGCCAATCAAAACCAATCTTAGC
ATTTTAGGCTCTTTGTGCATAAATTATTGAAATCAAAAATGAATTTATCG
ACAGAAAATGGAAATCAATGTCCAATGTTTAAAGAAAAACCGAAAAGATT
TCTATTCGTTTTACTTTGTCTATTTGGATTAGTTTTCTTGAGTGTATATT
ATTATTTTTTTGATATTTCAATTTTTAACTCTCCGAAATTGGAATTTTCA
AATTCATATTTATGCAAATATTTTATTAATAACAATGAGACCTGGAACTT
CACCGAATTCGATGTGACCACAATCGGTGACATGACACCGATACAATTGC
AGTTGCATAACTCAAATATTTCTTACAAAGGATATTCGGATCTGAAATTC
AGCAAAGACTGTGGAATACCGGGCGAACACGAGCAACTGTTCCAATTGAT
GAAATTCTGGATCAAGTTCACTTCTGATCACAATATACCTTGGTGGTTGG
CCTATGGGTCACTGATCGGATCAATTAGGCATAAAGATATGGTTGCTTGG
GATTCTGACATTGACCTAGGGATGCCAACGCAGTACGAACACCTTTTAAG
AAATTTGAGTACTAGTCGGTTGAACATCTCAAATAAACAAGTTAACATAA
TAACAAGACCTGGTCCGCATTGTCCGTATAACGGCCCGAGAATGGATTGT
AAAGGGAATTTGGTCACGTCTCAAGTAGATGGCTGTGCATTTTGTGGCCC
TTTGGCAAGAGTATTTTACAATTCATGGAAAAGAATCGATATCTATTTAT
TTGATGTGCAAATACACGAAAACAAGTTGAAAATAATAGAAGAAGGAACT
TTCGAATATATGTCTGAGGCTCCGCGTTCACCTTTAAACTGGTACTTTCC
TCTTCGAAATTGCTCATTTATGAATTTGATGGTTCTCTGTCCTAAGAACT
TAGAGGCAGTTTTGACGGATTATTACAAGACTTTCCAAAGTTTATATAAA
TGCAGCAAAGGCTCCTGGGTTAAAATTTAATTTGTGAATAAATTTTCTGA
ATTTTAAAAAAAA
back to top

protein sequence of SMED30017555-orf-1

>SMED30017555-orf-1 ID=SMED30017555-orf-1|Name=SMED30017555-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=314bp
MNLSTENGNQCPMFKEKPKRFLFVLLCLFGLVFLSVYYYFFDISIFNSPK
LEFSNSYLCKYFINNNETWNFTEFDVTTIGDMTPIQLQLHNSNISYKGYS
DLKFSKDCGIPGEHEQLFQLMKFWIKFTSDHNIPWWLAYGSLIGSIRHKD
MVAWDSDIDLGMPTQYEHLLRNLSTSRLNISNKQVNIITRPGPHCPYNGP
RMDCKGNLVTSQVDGCAFCGPLARVFYNSWKRIDIYLFDVQIHENKLKII
EEGTFEYMSEAPRSPLNWYFPLRNCSFMNLMVLCPKNLEAVLTDYYKTFQ
SLYKCSKGSWVKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007074LicD_fam
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007074LicD familyPFAMPF04991LicDcoord: 129..238
e-value: 5.5E-14
score: 52.9
NoneNo IPR availablePANTHERPTHR43404FAMILY NOT NAMEDcoord: 105..308
NoneNo IPR availableTMHMMTMhelixcoord: 21..43