Cleavage stimulation factor subunit 3

Overview
NameCleavage stimulation factor subunit 3
Smed IDSMED30017552
Length (bp)2275
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cleavage stimulation factor subunit 3 (SMED30017552) t-SNE clustered cells

Violin plots show distribution of expression levels for Cleavage stimulation factor subunit 3 (SMED30017552) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cleavage stimulation factor subunit 3 (SMED30017552) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cleavage stimulation factor subunit 3 (SMED30017552) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017552

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017552SMESG000022467.1 SmedASXL_014563SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30017552SMESG000022467.1 SmedASXL_014563SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30017552SMESG000022467.1 dd_Smed_v4_2751_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017552SMESG000022467.1 SMED30017552smed_20140614PMID:22696458
Labbé et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Human
Match: CSTF3 (cleavage stimulation factor subunit 3 [Source:HGNC Symbol;Acc:HGNC:2485])

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 400/727 (55.02%), Postives = 534/727 (73.45%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTA--LSIE----MAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E KAK ++ VEKLF+  L ++ HIDLWK YLSY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QV++WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EKV +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +   L +  D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME F   KIP       V+E + I +G A  L++E    + +NA L +  +R   NE++ D D+E G         +P +        DIY+ RQQK+ R
Sbjct:   47 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFK--EEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPICFQGPFVQVDELMEIFRRCKIPNT-----VEEAVRIITGGAPELAVEGNGPVESNAVLTKAVKR--PNEDS-DEDEEKG-------AVVPPVH-------DIYRARQQKRIR 749          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Human
Match: CSTF3 (cleavage stimulation factor subunit 3 [Source:HGNC Symbol;Acc:HGNC:2485])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 400/727 (55.02%), Postives = 534/727 (73.45%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTA--LSIE----MAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E KAK ++ VEKLF+  L ++ HIDLWK YLSY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QV++WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EKV +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +   L +  D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME F   KIP       V+E + I +G A  L++E    + +NA L +  +R   NE++ D D+E G         +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFK--EEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPICFQGPFVQVDELMEIFRRCKIPNT-----VEEAVRIITGGAPELAVEGNGPVESNAVLTKAVKR--PNEDS-DEDEEKG-------AVVPPVH-------DIYRARQQKRIR 717          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Human
Match: CSTF3 (cleavage stimulation factor subunit 3 [Source:HGNC Symbol;Acc:HGNC:2485])

HSP 1 Score: 68.1662 bits (165), Expect = 2.364e-13
Identity = 28/61 (45.90%), Postives = 48/61 (78.69%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQE 271
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAE 75          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Human
Match: CSTF3 (cleavage stimulation factor subunit 3 [Source:HGNC Symbol;Acc:HGNC:2485])

HSP 1 Score: 57.3806 bits (137), Expect = 5.528e-10
Identity = 22/47 (46.81%), Postives = 39/47 (82.98%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQF 229
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QF
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQF 61          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Human
Match: PRPF39 (pre-mRNA processing factor 39 [Source:HGNC Symbol;Acc:HGNC:20314])

HSP 1 Score: 54.6842 bits (130), Expect = 6.048e-7
Identity = 37/146 (25.34%), Postives = 69/146 (47.26%), Query Frame = 2
Query:   65 MAENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDA-QSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRI-YHIDLWKFYLSYIKDK-DNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINF 493
            + E + + P +  K  + +++NP D   W  LL+   Q   +   R  F+R    +P    Y K Y   EK+    +  +++++  L  I   +DLW  Y++++K+  D   P     +   +++AV   G D +S  +W  YIN+
Sbjct:   70 LTETEANFPPEYEKFWKTVENNPQDFTGWVYLLQYVEQENHLMAARKAFDRFFIHYPYCYGYWKKYADLEKRHDNIKPSDEVYRRGLQAIPLSVDLWIHYINFLKETLDPGDPETNNTIRGTFEHAVLAAGTDFRSDRLWEMYINW 215          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Celegans
Match: suf-1 (SUppressor-of-Forked (Drosophila) homolog [Source:UniProtKB/TrEMBL;Acc:Q19866])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 334/742 (45.01%), Postives = 469/742 (63.21%), Query Frame = 2
Query:  110 EERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQS-HETALLIDRYKFMELFPCSDAELKSIGYRDI---------SRQISSQIATSVPELGSNLDNNADGPG-----GYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMI-----------------IDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMG-NNLSTSIGGIPTIQSAEGNIIDIYKFRQQKK 2233
            E RI++NP+D++AWN+LLR+ QS  I++ R  +E LV QFP +G+Y K+YI  E ++K FENVEKLF   L  + +IDLWK Y+ Y+ +   +   ++E MA+AYD+A++K+G+D++++ I+++YI FLK      QYAE+Q+  A R+IY +A+ TPM  +E IW DY  +E +IN  +A+K I ER ++Y NARRV K+ + +T+GLNR   SVPP+ T  E KQVELWK  I WEK NPL+TE+     +R ++ YEQ LLCLG++PDIWYEAA +L+ AS  L EKGD + ++    +   +Y+RA T +++E+ LL+FAYAD++E   +FE V+ IY  L+  +HI+PTL Y+Q  RFIRRS+G   AR VFK ARED RT YQV++ AA++E+ C KD +VA ++F+LGLK+Y   PEF LAY D++++LNEDNNTRV+FER L S  +P +KS  IWD+FL FES VGDLASILKVE+RR  A E  ++ Q+ + + L+IDRYKFM+L PCS  +LK IGY  +         S   S  + T  P+  S +   A G       G+ RPD  QM+PFKP+       HPV GG FPPP + + L+ LLPPP CF GPF+ V         +++P   + P  ++NM+                   S  +  +  +A + L RKR          DSDDE   ++L   IG + +         D YK R  KK
Sbjct:   10 ERRIETNPFDVDAWNLLLREHQSRPIDQERDFYESLVKQFPNSGRYWKAYIEHELRSKNFENVEKLFSRCLVSVLNIDLWKCYIHYVFETKGQRDQYREEMAKAYDFALEKVGMDVQAYSIFTEYIAFLKKVPAVGQYAENQRITAVRKIYQKALATPMHNLELIWNDYCTYEKAINITLAEKLIAERGKEYQNARRVEKDLQQMTRGLNRQAVSVPPKGTATEFKQVELWKNLIAWEKTNPLQTEEYGQHARRVVYTYEQSLLCLGYYPDIWYEAAMFLQEASHTLDEKGDVKMAQVLKLETISLYERAITGLMKESKLLYFAYADFQEEHKQFEAVKNIYDRLLGIEHINPTLTYVQLMRFIRRSEGPNNARLVFKRAREDKRTGYQVFVAAALLEYNCMKDKEVAIRVFKLGLKKYENEPEFGLAYADFLSNLNEDNNTRVVFERILTSSKLPADKSIRIWDRFLDFESCVGDLASILKVEKRRKTAYEEAQKDQTMNHSMLVIDRYKFMDLMPCSGEQLKLIGYNALKGTESIAGPSFVGSKNVPTHGPQAASAIMGGAGGHADVARYGFPRPDISQMIPFKPRVNCTASFHPVPGGVFPPPQSVAHLMSLLPPPTCFIGPFINVELLCNMINNMQLP-NVSYPKSEDNMLGPMLEQDVKKDMYQLLATTSDPSAVVRSSALSDLKRKR---------GDSDDEEDYSHLGAVIGSLGS--------RDAYKRRMNKK 733          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Celegans
Match: suf-1 (SUppressor-of-Forked (Drosophila) homolog [Source:UniProtKB/TrEMBL;Acc:Q19866])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 334/742 (45.01%), Postives = 469/742 (63.21%), Query Frame = 2
Query:  110 EERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQS-HETALLIDRYKFMELFPCSDAELKSIGYRDI---------SRQISSQIATSVPELGSNLDNNADGPG-----GYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMI-----------------IDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMG-NNLSTSIGGIPTIQSAEGNIIDIYKFRQQKK 2233
            E RI++NP+D++AWN+LLR+ QS  I++ R  +E LV QFP +G+Y K+YI  E ++K FENVEKLF   L  + +IDLWK Y+ Y+ +   +   ++E MA+AYD+A++K+G+D++++ I+++YI FLK      QYAE+Q+  A R+IY +A+ TPM  +E IW DY  +E +IN  +A+K I ER ++Y NARRV K+ + +T+GLNR   SVPP+ T  E KQVELWK  I WEK NPL+TE+     +R ++ YEQ LLCLG++PDIWYEAA +L+ AS  L EKGD + ++    +   +Y+RA T +++E+ LL+FAYAD++E   +FE V+ IY  L+  +HI+PTL Y+Q  RFIRRS+G   AR VFK ARED RT YQV++ AA++E+ C KD +VA ++F+LGLK+Y   PEF LAY D++++LNEDNNTRV+FER L S  +P +KS  IWD+FL FES VGDLASILKVE+RR  A E  ++ Q+ + + L+IDRYKFM+L PCS  +LK IGY  +         S   S  + T  P+  S +   A G       G+ RPD  QM+PFKP+       HPV GG FPPP + + L+ LLPPP CF GPF+ V         +++P   + P  ++NM+                   S  +  +  +A + L RKR          DSDDE   ++L   IG + +         D YK R  KK
Sbjct:   10 ERRIETNPFDVDAWNLLLREHQSRPIDQERDFYESLVKQFPNSGRYWKAYIEHELRSKNFENVEKLFSRCLVSVLNIDLWKCYIHYVFETKGQRDQYREEMAKAYDFALEKVGMDVQAYSIFTEYIAFLKKVPAVGQYAENQRITAVRKIYQKALATPMHNLELIWNDYCTYEKAINITLAEKLIAERGKEYQNARRVEKDLQQMTRGLNRQAVSVPPKGTATEFKQVELWKNLIAWEKTNPLQTEEYGQHARRVVYTYEQSLLCLGYYPDIWYEAAMFLQEASHTLDEKGDVKMAQVLKLETISLYERAITGLMKESKLLYFAYADFQEEHKQFEAVKNIYDRLLGIEHINPTLTYVQLMRFIRRSEGPNNARLVFKRAREDKRTGYQVFVAAALLEYNCMKDKEVAIRVFKLGLKKYENEPEFGLAYADFLSNLNEDNNTRVVFERILTSSKLPADKSIRIWDRFLDFESCVGDLASILKVEKRRKTAYEEAQKDQTMNHSMLVIDRYKFMDLMPCSGEQLKLIGYNALKGTESIAGPSFVGSKNVPTHGPQAASAIMGGAGGHADVARYGFPRPDISQMIPFKPRVNCTASFHPVPGGVFPPPQSVAHLMSLLPPPTCFIGPFINVELLCNMINNMQLP-NVSYPKSEDNMLGPMLEQDVKKDMYQLLATTSDPSAVVRSSALSDLKRKR---------GDSDDEEDYSHLGAVIGSLGS--------RDAYKRRMNKK 733          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Fly
Match: su(f) (gene:FBgn0003559 transcript:FBtr0113733)

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 344/729 (47.19%), Postives = 499/729 (68.45%), Query Frame = 2
Query:   92 DKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSN-LDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENM-------------IIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKK 2233
            +++++A++ ++  P+DIE+W+V++R+AQ+  I E R ++E LV+ FP T +Y K YI  E +++ +E VEKLF+  L +I +IDLWK YL+Y+K+  +   + KE+MAQAYD+A++K+G+DL SF IW DYI FL+  +    YAE+QK  A RR+Y +A+VTP+VGIE +W+DY AFE +IN +I++K   ERS+DYMNARRVAKE E  TKGLNRNLP+VPP  T EE+KQVELWK++I +EK NPL+TED   +T+R +FA EQCLL L HHP +W++A+ +L+ ++++L EKGD + +K FAD+ A + +R+   +L  N LL+FAYAD+EE R K+EKV  +Y  L+    IDPTLVY+Q+ +F RR++GI +AR +FK ARED R+ Y +++ AA+ME+YC+KD ++A +IFELGLKR+   PE+V+ Y+DY++HLNEDNNTRVLFER L SG + P KS  +W++FL+FES++GDL+SI+KVERRR    E LKE++  ETA L+DRYKF++L+PC+  ELKSIGY +    I +++        +  ++ +++      RPD+ QM+PFKP+     G+HP+AGG FP PPA ++L   LPPP  F GPFV V    + F+ L +P+    P  D  +             I+D+ T   ++ +  A   R+RR +       DSDDE+              Q+A     DIY+ RQ K+
Sbjct:   17 ERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVNVFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHKEKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTPIVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPPTLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQFLDTSARVLTEKGDVQAAKIFADECANILERSINGVLNRNALLYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQYMKFARRAEGIKSARSIFKKAREDVRSRYHIFVAAALMEYYCSKDKEIAFRIFELGLKRFGGSPEYVMCYIDYLSHLNEDNNTRVLFERVLSSGGLSPHKSVEVWNRFLEFESNIGDLSSIVKVERRRSAVFENLKEYEGKETAQLVDRYKFLDLYPCTSTELKSIGYAENVGIILNKVGGGAQSQNTGEVETDSEATPPLPRPDFSQMIPFKPRPCAHPGAHPLAGGVFPQPPALAALCATLPPPNSFRGPFVSVELLFDIFMRLNLPDSAPQPNGDNELSPKIFDLAKSVHWIVDTSTYTGVQHSVTAVPPRRRRLLP---GGDDSDDEL--------------QTAVPPSHDIYRLRQLKR 728          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Fly
Match: su(f) (gene:FBgn0003559 transcript:FBtr0306545)

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 344/729 (47.19%), Postives = 499/729 (68.45%), Query Frame = 2
Query:   92 DKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSN-LDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENM-------------IIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKK 2233
            +++++A++ ++  P+DIE+W+V++R+AQ+  I E R ++E LV+ FP T +Y K YI  E +++ +E VEKLF+  L +I +IDLWK YL+Y+K+  +   + KE+MAQAYD+A++K+G+DL SF IW DYI FL+  +    YAE+QK  A RR+Y +A+VTP+VGIE +W+DY AFE +IN +I++K   ERS+DYMNARRVAKE E  TKGLNRNLP+VPP  T EE+KQVELWK++I +EK NPL+TED   +T+R +FA EQCLL L HHP +W++A+ +L+ ++++L EKGD + +K FAD+ A + +R+   +L  N LL+FAYAD+EE R K+EKV  +Y  L+    IDPTLVY+Q+ +F RR++GI +AR +FK ARED R+ Y +++ AA+ME+YC+KD ++A +IFELGLKR+   PE+V+ Y+DY++HLNEDNNTRVLFER L SG + P KS  +W++FL+FES++GDL+SI+KVERRR    E LKE++  ETA L+DRYKF++L+PC+  ELKSIGY +    I +++        +  ++ +++      RPD+ QM+PFKP+     G+HP+AGG FP PPA ++L   LPPP  F GPFV V    + F+ L +P+    P  D  +             I+D+ T   ++ +  A   R+RR +       DSDDE+              Q+A     DIY+ RQ K+
Sbjct:   17 ERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVNVFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHKEKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTPIVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPPTLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQFLDTSARVLTEKGDVQAAKIFADECANILERSINGVLNRNALLYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQYMKFARRAEGIKSARSIFKKAREDVRSRYHIFVAAALMEYYCSKDKEIAFRIFELGLKRFGGSPEYVMCYIDYLSHLNEDNNTRVLFERVLSSGGLSPHKSVEVWNRFLEFESNIGDLSSIVKVERRRSAVFENLKEYEGKETAQLVDRYKFLDLYPCTSTELKSIGYAENVGIILNKVGGGAQSQNTGEVETDSEATPPLPRPDFSQMIPFKPRPCAHPGAHPLAGGVFPQPPALAALCATLPPPNSFRGPFVSVELLFDIFMRLNLPDSAPQPNGDNELSPKIFDLAKSVHWIVDTSTYTGVQHSVTAVPPRRRRLLP---GGDDSDDEL--------------QTAVPPSHDIYRLRQLKR 728          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Fly
Match: su(f) (gene:FBgn0003559 transcript:FBtr0306544)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 344/761 (45.20%), Postives = 499/761 (65.57%), Query Frame = 2
Query:   92 DKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKG--------------------------------DQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSN-LDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENM-------------IIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKK 2233
            +++++A++ ++  P+DIE+W+V++R+AQ+  I E R ++E LV+ FP T +Y K YI  E +++ +E VEKLF+  L +I +IDLWK YL+Y+K+  +   + KE+MAQAYD+A++K+G+DL SF IW DYI FL+  +    YAE+QK  A RR+Y +A+VTP+VGIE +W+DY AFE +IN +I++K   ERS+DYMNARRVAKE E  TKGLNRNLP+VPP  T EE+KQVELWK++I +EK NPL+TED   +T+R +FA EQCLL L HHP +W++A+ +L+ ++++L EKG                                D + +K FAD+ A + +R+   +L  N LL+FAYAD+EE R K+EKV  +Y  L+    IDPTLVY+Q+ +F RR++GI +AR +FK ARED R+ Y +++ AA+ME+YC+KD ++A +IFELGLKR+   PE+V+ Y+DY++HLNEDNNTRVLFER L SG + P KS  +W++FL+FES++GDL+SI+KVERRR    E LKE++  ETA L+DRYKF++L+PC+  ELKSIGY +    I +++        +  ++ +++      RPD+ QM+PFKP+     G+HP+AGG FP PPA ++L   LPPP  F GPFV V    + F+ L +P+    P  D  +             I+D+ T   ++ +  A   R+RR +       DSDDE+              Q+A     DIY+ RQ K+
Sbjct:   17 ERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVNVFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHKEKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTPIVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPPTLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQFLDTSARVLTEKGVRTSVENISPILCVPVVNQIEWVMAFAWWWAKDVQAAKIFADECANILERSINGVLNRNALLYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQYMKFARRAEGIKSARSIFKKAREDVRSRYHIFVAAALMEYYCSKDKEIAFRIFELGLKRFGGSPEYVMCYIDYLSHLNEDNNTRVLFERVLSSGGLSPHKSVEVWNRFLEFESNIGDLSSIVKVERRRSAVFENLKEYEGKETAQLVDRYKFLDLYPCTSTELKSIGYAENVGIILNKVGGGAQSQNTGEVETDSEATPPLPRPDFSQMIPFKPRPCAHPGAHPLAGGVFPQPPALAALCATLPPPNSFRGPFVSVELLFDIFMRLNLPDSAPQPNGDNELSPKIFDLAKSVHWIVDTSTYTGVQHSVTAVPPRRRRLLP---GGDDSDDEL--------------QTAVPPSHDIYRLRQLKR 760          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Fly
Match: CG1646 (gene:FBgn0039600 transcript:FBtr0113299)

HSP 1 Score: 50.8322 bits (120), Expect = 5.527e-6
Identity = 41/160 (25.62%), Postives = 67/160 (41.88%), Query Frame = 2
Query:  119 IKSNPWDIEAWNVLLRDAQSTS-IEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRI-YHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVG 592
            +K +  D   W  LL+   + S  E  R  ++  +  +P    Y + Y   EK+     N  K+F+  L  I   +DLW  YL ++K       +F   +   Y+ AV   GL+ +S  +W  YI +           ES++     +IY R +  P  G
Sbjct:  315 VKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETF---VRSQYERAVKACGLEFRSDKLWDAYIRWEN---------ESKRYHRVVQIYDRLLAIPTQG 462          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Fly
Match: CG1646 (gene:FBgn0039600 transcript:FBtr0085325)

HSP 1 Score: 50.8322 bits (120), Expect = 5.527e-6
Identity = 41/160 (25.62%), Postives = 67/160 (41.88%), Query Frame = 2
Query:  119 IKSNPWDIEAWNVLLRDAQSTS-IEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRI-YHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVG 592
            +K +  D   W  LL+   + S  E  R  ++  +  +P    Y + Y   EK+     N  K+F+  L  I   +DLW  YL ++K       +F   +   Y+ AV   GL+ +S  +W  YI +           ES++     +IY R +  P  G
Sbjct:  315 VKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETF---VRSQYERAVKACGLEFRSDKLWDAYIRWEN---------ESKRYHRVVQIYDRLLAIPTQG 462          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Zebrafish
Match: cstf3 (cleavage stimulation factor, 3' pre-RNA, subunit 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1997])

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 391/724 (54.01%), Postives = 519/724 (71.69%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRAT-VILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPEL-----GSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKR-RRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E KAK ++ VEKLF+  L ++ HIDLWK YLSY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDY+ +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQN+ +E +QVE+WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  N+K F+D+ A +Y+RA   +L++N+LL+F++ADYEESR K EKV +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK AREDPRT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE++LAY+DY++HLNEDNNTRVLFER L SG + PEKS  IW +FL FES++GDLASILKVERRR  A +   E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR   ++ A+ +PE         L + AD    Y +PD CQM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME      +P+      VD  + + +G  L +    N  +        S+   N DSD+E                S    I DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYSKYEEGINVHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNSPQEAQQVEMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAIGTLLKKNMLLYFSFADYEESRMKHEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRSIFKKAREDPRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYILAYIDYLSHLNEDNNTRVLFERVLTSGSLSPEKSGEIWARFLAFESNIGDLASILKVERRRFMAFKD--EYEGKETALLVDRYKFMDLYPCSPSELKALGYKDVSR---AKYASLIPEAVVAPSTPALKDEADRKPEYPKPDTCQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPSCFTGPFVQVDEMMEALRRCVLPDT-----VDAAVELITGKQLEMSSEGNGPVENHSVANKSLKRPNADSDEEEDKG------------SIAPPIHDIYRARQQKRIR 716          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Xenopus
Match: cstf3 (cleavage stimulation factor, 3' pre-RNA, subunit 3 [Source:NCBI gene;Acc:394769])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 390/723 (53.94%), Postives = 523/723 (72.34%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKL-FKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQL-MRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E K K +   E L F+  L ++ HIDLWK Y+SY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QVE+WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEA  YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EK  +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK AREDPRT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +  +L ++ D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME     K+P+      V+E + I +G+   + M  N  + +      S+   N DSDDE           +P +        DIY+ RQQK+ R
Sbjct:   16 PEKVKKAEKKLEDNPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVKIKNYCKTEHLLFQRCLMKVLHIDLWKCYVSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVEMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAGQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKTHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDPRTRHHVYVTAALMEYYCSKDTSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRYTAFK--EEYEGKETALLVDRYKFMDLYPCSTSELKALGYKDVSRAKLAALIPDPVIAPSIAPSLKDDVDRKPEYPKPDTSQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVILMKLLPPPICFQGPFVQVDEIMEILRRCKLPDT-----VEEAVRIITGSQAEMNMEGNGPVEVNTLLNKSVKRPNEDSDDEEEKG-----SVVPPVH-------DIYRTRQQKRIR 719          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Xenopus
Match: sil1 (SIL1 nucleotide exchange factor [Source:Xenbase;Acc:XB-GENE-5898521])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 390/719 (54.24%), Postives = 518/719 (72.04%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKR-RRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++    +ERLV QFP +G++ K YI  E KAK  + VEKLF+  L ++ HIDLWK Y+SY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QVE+ KKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEA  YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EK  +IY  L++ + IDPTLVYIQ+  F RR++GI + R +FK AREDPRT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR   +++A  +P       +  D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME     K+P+      V+E + I +G+   + M  N  +  K     S+   N DSDDE           +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEDNPYDLDAWSILIREAQNQPIDKAWKTYERLVAQFPSSGRFWKLYIEAEVKAKNDDKVEKLFQRCLMKVLHIDLWKCYVSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVEMGKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAGQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKTHSIYNRLLAIEDIDPTLVYIQYMEFARRAEGIKSGRMIFKKAREDPRTRHHVYVTAALMEYYCSKDTSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRYTAFK--EEYEGKETALLVDRYKFMDLYPCSTSELKALGYKDVSR---AKLAALIP-------DPVDRKPEYPKPDTSQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVILMKLLPPPICFQGPFVQVDEIMEILWRCKLPDT-----VEEAVRIITGSQAEMNMEGNGPVEGKTLLNKSVKRPNEDSDDEEEKG-----SVVPPVH-------DIYRTRQQKRIR 704          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Xenopus
Match: cstf3 (cleavage stimulation factor, 3' pre-RNA, subunit 3 [Source:NCBI gene;Acc:394769])

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 387/722 (53.60%), Postives = 519/722 (71.88%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQL-MRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E           LF+  L ++ HIDLWK Y+SY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QVE+WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEA  YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EK  +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK AREDPRT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +  +L ++ D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME     K+P+      V+E + I +G+   + M  N  + +      S+   N DSDDE           +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEDNPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAE-----------LFQRCLMKVLHIDLWKCYVSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVEMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAGQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKTHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDPRTRHHVYVTAALMEYYCSKDTSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRYTAFK--EEYEGKETALLVDRYKFMDLYPCSTSELKALGYKDVSRAKLAALIPDPVIAPSIAPSLKDDVDRKPEYPKPDTSQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVILMKLLPPPICFQGPFVQVDEIMEILRRCKLPDT-----VEEAVRIITGSQAEMNMEGNGPVEVNTLLNKSVKRPNEDSDDEEEKG-----SVVPPVH-------DIYRTRQQKRIR 706          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Xenopus
Match: sil1 (SIL1 nucleotide exchange factor [Source:Xenbase;Acc:XB-GENE-5898521])

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 370/719 (51.46%), Postives = 496/719 (68.98%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKR-RRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++    +ERLV QFP +G++ K YI  E KAK  + VEKLF+  L ++ HIDLWK Y+SY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QVE+ KKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEA  YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EK  +IY  L++ + IDPTLVYIQ+  F RR++GI + R +FK AREDPRT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR   +++A  +P       +  D    Y +PD  QM+PF+P+                                   GPFVQV + ME     K+P+      V+E + I +G+   + M  N  +  K     S+   N DSDDE           +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEDNPYDLDAWSILIREAQNQPIDKAWKTYERLVAQFPSSGRFWKLYIEAEVKAKNDDKVEKLFQRCLMKVLHIDLWKCYVSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVEMGKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAGQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKTHSIYNRLLAIEDIDPTLVYIQYMEFARRAEGIKSGRMIFKKAREDPRTRHHVYVTAALMEYYCSKDTSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRYTAFK--EEYEGKETALLVDRYKFMDLYPCSTSELKALGYKDVSR---AKLAALIP-------DPVDRKPEYPKPDTSQMIPFQPRHL---------------------------------GPFVQVDEIMEILWRCKLPD-----TVEEAVRIITGSQAEMNMEGNGPVEGKTLLNKSVKRPNEDSDDEEEKG-----SVVPPVH-------DIYRTRQQKRIR 671          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Xenopus
Match: cstf3 (cleavage stimulation factor, 3' pre-RNA, subunit 3 [Source:NCBI gene;Acc:394769])

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 369/726 (50.83%), Postives = 498/726 (68.60%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANA-----QLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E           LF+  L ++ HIDLWK Y+SY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QVE+WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEA  YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EK  +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK AREDPRT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +  +L ++ D    Y +PD  QM+PF+P+                                   GPFVQV + ME     K+P+      V+E + I +G+   + M  N       L+ K    S+   N DSDDE           +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEDNPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAE-----------LFQRCLMKVLHIDLWKCYVSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVEMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAGQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKTHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDPRTRHHVYVTAALMEYYCSKDTSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRYTAFK--EEYEGKETALLVDRYKFMDLYPCSTSELKALGYKDVSRAKLAALIPDPVIAPSIAPSLKDDVDRKPEYPKPDTSQMIPFQPRHL---------------------------------GPFVQVDEIMEILRRCKLPDT-----VEEAVRIITGSQAEMNMEGNGPVEVNTLLNK----SVKRPNEDSDDEEEKG-----SVVPPVH-------DIYRTRQQKRIR 673          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Mouse
Match: Cstf3 (cleavage stimulation factor, 3' pre-RNA, subunit 3 [Source:MGI Symbol;Acc:MGI:1351825])

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 398/727 (54.75%), Postives = 529/727 (72.76%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAAN------AQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E KAK ++ VEKLF+  L ++ HIDLWK YLSY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QV++WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EKV +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A    +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +   L +  D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME F   KIP       V+E + I +G A  + +  N      A L +  +R   NE++ D D+E G         +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFR--EEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPICFQGPFVQVDELMEIFRRCKIPNT-----VEEAVRIITGGAPELAVEGNGPVESSAVLTKAVKR--PNEDS-DEDEEKG-------AVVPPVH-------DIYRARQQKRIR 717          
BLAST of Cleavage stimulation factor subunit 3 vs. UniProt/SwissProt
Match: sp|Q12996|CSTF3_HUMAN (Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1)

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 400/727 (55.02%), Postives = 534/727 (73.45%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTA--LSIE----MAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E KAK ++ VEKLF+  L ++ HIDLWK YLSY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QV++WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EKV +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +   L +  D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME F   KIP       V+E + I +G A  L++E    + +NA L +  +R   NE++ D D+E G         +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFK--EEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPICFQGPFVQVDELMEIFRRCKIPNT-----VEEAVRIITGGAPELAVEGNGPVESNAVLTKAVKR--PNEDS-DEDEEKG-------AVVPPVH-------DIYRARQQKRIR 717          
BLAST of Cleavage stimulation factor subunit 3 vs. UniProt/SwissProt
Match: sp|Q5RDW9|CSTF3_PONAB (Cleavage stimulation factor subunit 3 OS=Pongo abelii OX=9601 GN=CSTF3 PE=2 SV=1)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 400/727 (55.02%), Postives = 533/727 (73.31%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTA--LSIE----MAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW+ L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E KAK ++ VEKLF+  L ++ HIDLWK YLSY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QV++WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EKV +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +   L +  D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME F   KIP       V+E + I +G A  L++E    + +NA L +  +R   NE++ D D+E G         +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSTLIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFK--EEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPICFQGPFVQVDELMEIFRRCKIPNT-----VEEAVRIITGGAPELAVEGNGPVESNAVLTKAVKR--PNEDS-DEDEEKG-------AVVPPVH-------DIYRARQQKRIR 717          
BLAST of Cleavage stimulation factor subunit 3 vs. UniProt/SwissProt
Match: sp|Q99LI7|CSTF3_MOUSE (Cleavage stimulation factor subunit 3 OS=Mus musculus OX=10090 GN=Cstf3 PE=1 SV=1)

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 398/727 (54.75%), Postives = 529/727 (72.76%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQIATSV--PELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAAN------AQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E KAK ++ VEKLF+  L ++ HIDLWK YLSY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDYN +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQNT +E +QV++WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+FAYADYEESR K+EKV +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE+VLAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES++GDLASILKVE+RR  A    +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR ++++ I   V  P +   L +  D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFVQV + ME F   KIP       V+E + I +G A  + +  N      A L +  +R   NE++ D D+E G         +P +        DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFR--EEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPICFQGPFVQVDELMEIFRRCKIPNT-----VEEAVRIITGGAPELAVEGNGPVESSAVLTKAVKR--PNEDS-DEDEEKG-------AVVPPVH-------DIYRARQQKRIR 717          
BLAST of Cleavage stimulation factor subunit 3 vs. UniProt/SwissProt
Match: sp|P25991|SUF_DROME (Protein suppressor of forked OS=Drosophila melanogaster OX=7227 GN=su(f) PE=1 SV=2)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 344/761 (45.20%), Postives = 499/761 (65.57%), Query Frame = 2
Query:   92 DKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKG--------------------------------DQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSN-LDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENM-------------IIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKK 2233
            +++++A++ ++  P+DIE+W+V++R+AQ+  I E R ++E LV+ FP T +Y K YI  E +++ +E VEKLF+  L +I +IDLWK YL+Y+K+  +   + KE+MAQAYD+A++K+G+DL SF IW DYI FL+  +    YAE+QK  A RR+Y +A+VTP+VGIE +W+DY AFE +IN +I++K   ERS+DYMNARRVAKE E  TKGLNRNLP+VPP  T EE+KQVELWK++I +EK NPL+TED   +T+R +FA EQCLL L HHP +W++A+ +L+ ++++L EKG                                D + +K FAD+ A + +R+   +L  N LL+FAYAD+EE R K+EKV  +Y  L+    IDPTLVY+Q+ +F RR++GI +AR +FK ARED R+ Y +++ AA+ME+YC+KD ++A +IFELGLKR+   PE+V+ Y+DY++HLNEDNNTRVLFER L SG + P KS  +W++FL+FES++GDL+SI+KVERRR    E LKE++  ETA L+DRYKF++L+PC+  ELKSIGY +    I +++        +  ++ +++      RPD+ QM+PFKP+     G+HP+AGG FP PPA ++L   LPPP  F GPFV V    + F+ L +P+    P  D  +             I+D+ T   ++ +  A   R+RR +       DSDDE+              Q+A     DIY+ RQ K+
Sbjct:   17 ERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVNVFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHKEKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTPIVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPPTLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQFLDTSARVLTEKGVRTSVENISPILCVPVVNQIEWVMAFAWWWAKDVQAAKIFADECANILERSINGVLNRNALLYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQYMKFARRAEGIKSARSIFKKAREDVRSRYHIFVAAALMEYYCSKDKEIAFRIFELGLKRFGGSPEYVMCYIDYLSHLNEDNNTRVLFERVLSSGGLSPHKSVEVWNRFLEFESNIGDLSSIVKVERRRSAVFENLKEYEGKETAQLVDRYKFLDLYPCTSTELKSIGYAENVGIILNKVGGGAQSQNTGEVETDSEATPPLPRPDFSQMIPFKPRPCAHPGAHPLAGGVFPQPPALAALCATLPPPNSFRGPFVSVELLFDIFMRLNLPDSAPQPNGDNELSPKIFDLAKSVHWIVDTSTYTGVQHSVTAVPPRRRRLLP---GGDDSDDEL--------------QTAVPPSHDIYRLRQLKR 760          
BLAST of Cleavage stimulation factor subunit 3 vs. UniProt/SwissProt
Match: sp|Q8GUP1|CTF77_ARATH (Cleavage stimulation factor subunit 77 OS=Arabidopsis thaliana OX=3702 GN=CSTF77 PE=1 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 3.725e-108
Identity = 197/584 (33.73%), Postives = 332/584 (56.85%), Query Frame = 2
Query:  140 IEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYI-KDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSH--ETAL--LIDRYKFMELFPCSDAELKSIGYRDISRQISSQIA--TSVPELGSNLDNNADGPGGYLRPDYCQMLPFKP--KAYPRTGSHPVAGG 1864
            +E    L + A  + I +  PI+E+L+  +P + ++ K Y+  +      +  +++F   L     + LW+ Y+ +I K  D K    +E   +A+++ ++ +G D+ S PIW++YI FLKS    +   +  +  A R++YHRAI+TP   +E +W+DY  FE ++N  +AK  + E    + +AR V +E +   + ++ N+ +VPP  T +E  Q   WKK++ +EK NP +  D  + TKR ++AYEQCL+CL H+PD+WY+ A +   +                 D   +++QRA   + ++ +L +A+A+ EESR   +  + +Y+N++       +L +IQ+ RF+RR++G+ AAR+ F  AR+ P  +Y VYI  A M     K+PKVA  IFE GLK YM  P ++L Y D++  LN+D N R LFERAL +  +P E S  +W +F+QFE   GDLASILKVE+R  +AL G  E  S   E++L  ++ RY +M+L+PC+  +L  +  +++  +  ++ A  T++P + + + + A      + PD  QM+   P  K+   + ++PVA  
Sbjct:    7 VEEAEALAKRALHSPIAQATPIYEQLLSLYPTSARFWKQYVEAQMAVNNDDATKQIFSRCLLTCLQVPLWQCYIRFIRKVYDKKGAEGQEETTKAFEFMLNYIGTDIASGPIWTEYIAFLKSLPALNLNEDLHRKTALRKVYHRAILTPTHHVEQLWKDYENFENTVNRQLAKGLVNEYQPKFNSARAVYRERKKYIEEIDWNMLAVPPTGTSKEETQWVAWKKFLSFEKGNPQRI-DTASSTKRIIYAYEQCLMCLYHYPDVWYDYAEWHVKSGS--------------TDAAIKVFQRALKAIPDSEMLKYAFAEMEESRGAIQSAKKLYENILGAS--TNSLAHIQYLRFLRRAEGVEAARKYFLDARKSPSCTYHVYIAFATMAFCIDKEPKVAHNIFEEGLKLYMSEPVYILKYADFLTRLNDDRNIRALFERALST--LPVEDSAEVWKRFIQFEQTYGDLASILKVEQRMKEALSGKGEEGSSPPESSLQDVVSRYSYMDLWPCTSNDLDHLARQELLVKNLNKKAGKTNLPHVPAAIGSVASS-SKVVYPDTSQMVVQDPTKKSEFASSANPVAAS 570          
BLAST of Cleavage stimulation factor subunit 3 vs. TrEMBL
Match: A0A430QIK0 (Cleavage stimulation factor subunit 3 (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0006147 PE=4 SV=1)

HSP 1 Score: 904.82 bits (2337), Expect = 0.000e+0
Identity = 462/744 (62.10%), Postives = 562/744 (75.54%), Query Frame = 2
Query:   62 FMAENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR----------------QISSQIATSVPELGSNLDNNADGPGG-------------------YLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDEN----MIIDSGTALSIEMAANAQ------LMRKRRRISINENNRDSDDEMGNNLSTS 2158
            FM + +V   DK+ KAEERIKSNPWDIEAW+VLLRDAQS  I++ R +FER+V QFP+ GQY K YI+QE KAK +E VEKLF+  L +I +IDLWK YL YIK+   K  SFKE+MAQAYD+ +DKMGLDL S+ IW+DYI+FL+STQV+  YAESQK  ATRR+Y RAIVTPM+GIETIWRDY  +E SIN +IAKKF EERSRDYMNARRVAKEYE ITKGL+R +PSVPPQNT  E KQVELWKKYIQWEKDNPLKTED+IT+TKR +FAYEQCLLCLGHHPDIWYEAA+YL+HASK+L EKGDQ  +++FA+  A MY+RA  +L+ N++L+FAYADYEE R K+ KV +IYK L+S ++IDPTL YIQ+ RF RR++GI++AR VFKLAR+D R +Y VY +AA+ME++C+KD  +  KIFELG+KR+  + E+VL YVD+M HLNEDNN RVLFERALGS  +  E++R+IW +FLQFES VGDLASILKVE+RRLQAL+  KEF   ETALLIDRY+F++L PC+D+EL+S+GYR+++R                 ISS  A  V  LGS L   + G  G                   Y +PD  QMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLL+L+PPP+CFHGPFV V KF+EHFLEL+IP++Y      E+      IDSGTALSIE+A+ A       L  ++RR  I     DS    GN  S +
Sbjct:   15 FM-QRRVYKMDKMQKAEERIKSNPWDIEAWSVLLRDAQSKKIDDAREVFERIVTQFPVAGQYWKIYINQEMKAKNYERVEKLFQRCLVKILNIDLWKIYLQYIKETKGKHQSFKEKMAQAYDFTLDKMGLDLNSYSIWADYISFLRSTQVQGSYAESQKITATRRVYQRAIVTPMLGIETIWRDYCMYENSINPLIAKKFTEERSRDYMNARRVAKEYEVITKGLSRTMPSVPPQNTPYEAKQVELWKKYIQWEKDNPLKTEDIITVTKRVMFAYEQCLLCLGHHPDIWYEAASYLDHASKILVEKGDQTTARQFANDTAAMYERAIALLKTNMMLYFAYADYEEGRCKYAKVHSIYKKLVSLENIDPTLPYIQYMRFARRAEGIMSARYVFKLARDDSRITYHVYCSAALMEYFCSKDKTIGHKIFELGMKRFGGIAEYVLCYVDFMAHLNEDNNIRVLFERALGSNQITQERARLIWARFLQFESQVGDLASILKVEKRRLQALDSSKEFSRLETALLIDRYRFLDLLPCTDSELRSLGYRELTRFQLAGIGKGYDDILCGVISSHGAAGV-SLGSTLSGVSGGSAGVVVGDALGSTINGTDPRPTYPQPDVSQMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLLKLIPPPQCFHGPFVDVDKFLEHFLELEIPDDYMEVVAGESEELATSIDSGTALSIELASTATSAAPLLLAARKRRQQI---ALDSLAGHGNRASVA 753          
BLAST of Cleavage stimulation factor subunit 3 vs. TrEMBL
Match: A0A3Q0KPI3 (Putative cleavage stimulation factor OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 904.434 bits (2336), Expect = 0.000e+0
Identity = 453/719 (63.00%), Postives = 553/719 (76.91%), Query Frame = 2
Query:   71 ENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR----------------QISSQIATSVPELGSNLDNNADGPGG-------------------YLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDEN----MIIDSGTALSIEMAANAQ-----LMRKRRR 2095
            + +V   DK+ KAEERIKSNPWDIEAW+VLLRDAQS  I++ R +FER+V QFP+ GQY K YI+QE KAK +E VEKLF+  L +I +IDLWK YL YIK+   K  +FKE+MAQAYD+ +DKMGLDL S+ IW+DYI+FL+STQV+  YAESQK  ATRR+Y RAIVTPM+GIETIWRDY  +E SIN +IAKKF EERSRDYMNARRVAKEYE ITKGL+R +PSVPPQNT  E KQVELWKKYIQWEKDNPLKTED+IT+TKR +FAYEQCLLCLGHHPDIWYEAA+YL+HASK+L EKGDQ  +++FA+  A MY+RA  +L+ N++L+FAYADYEE R K+ KV +IYK L+S ++IDPTL YIQ+ RF RR++GI++AR VFKLAR+D R +Y VY +AA+ME++C+KD  +  KIFELG+KR+  + E+VL YVD+M HLNEDNN RVLFERALGS  +  E++R+IW +FLQFES VGDLASILKVE+RRLQAL+  KEF   ETALLIDRY+F++L PC+D+EL+S+GYR+++R                 ISS  A  V  LGS L   + G  G                   Y +PD  QMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLL+L+PPP+CFHGPFV V KF+EHFLEL+IP++Y      E+      IDSGTALSIE+A+ A      L+  R+R
Sbjct:    2 QRRVYKMDKMQKAEERIKSNPWDIEAWSVLLRDAQSKKIDDAREVFERIVTQFPVAGQYWKIYINQEMKAKNYERVEKLFQRCLVKILNIDLWKIYLQYIKETKGKHQTFKEKMAQAYDFTLDKMGLDLNSYSIWADYISFLRSTQVQGSYAESQKITATRRVYQRAIVTPMLGIETIWRDYCMYENSINPLIAKKFTEERSRDYMNARRVAKEYEVITKGLSRTMPSVPPQNTPYEAKQVELWKKYIQWEKDNPLKTEDIITVTKRVMFAYEQCLLCLGHHPDIWYEAASYLDHASKILVEKGDQTTARQFANDTAAMYERAIALLKTNMMLYFAYADYEEGRCKYAKVHSIYKKLVSLENIDPTLPYIQYMRFARRAEGIMSARYVFKLARDDSRITYHVYCSAALMEYFCSKDKTIGHKIFELGMKRFGGIAEYVLCYVDFMAHLNEDNNIRVLFERALGSNQITQERARLIWARFLQFESQVGDLASILKVEKRRLQALDSSKEFSRLETALLIDRYRFLDLLPCTDSELRSLGYRELTRFQLAGIGKGYDDMLCGVISSHGAAGV-SLGSTLSGVSGGSAGVVVGDALGSTINGTDPRPTYPQPDVSQMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLLKLIPPPQCFHGPFVDVDKFLEHFLELEIPDDYMEVVAGESEELATSIDSGTALSIELASTATSAAPLLLAARKR 719          
BLAST of Cleavage stimulation factor subunit 3 vs. TrEMBL
Match: A0A4Z2DRP2 (Cleavage stimulation factor subunit 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_009412 PE=4 SV=1)

HSP 1 Score: 902.894 bits (2332), Expect = 0.000e+0
Identity = 452/710 (63.66%), Postives = 547/710 (77.04%), Query Frame = 2
Query:   62 FMAENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR---------------QISSQIATSVPELGSNLD---------------------NNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDEN----MIIDSGTALSIEMAANA 2071
            FM + +V   DK+ KAEERIKSN WDIEAW+VLLRDAQS  +E+ R +FER+V QFP+ GQY K YISQE KAK +E VEKLF+  L +I +IDLWK YL YIK+   K  SFKE+MAQAYD+ +DKMGLDL S+ IW+DYI+FL+STQV+  YAESQK  ATRR+Y RAIVTPM+GIETIWRDY  +E SIN +IAKKF EERSRDYMNARRVAKEYE ITKGL+R +PSVPPQNT  E KQVELWKKYIQWEKDNPLKTED+IT+TKR +FAYEQCLLCLGHHPDIWYEAA+YL+HASK+L EKGDQ  +++FA+  A MY+RA  +L+ N++L+FAYADYEE R K+ KV +IYK L+S ++IDPTL YIQ+ RF RR++GI++AR VFKLAR+DPR +Y VY +AA+ME++C+KD  +  KIFELG+KR+  + E+VL YVD+M HLNEDNN RVLFERALGS  +  E++R+IW +FLQFES VGDLASILKVE+RRLQAL+  KEF   ETALLIDRY+F++L PCSD+EL+S+GYR+++R                + S   T+   LGS L                      N  D    Y +PD  QMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLL+L+PPP+CFHGPFV V KF+EHFLEL+IPE+Y      E+      ID GTALSIE+A+ A
Sbjct:    3 FM-QRRVYKMDKMQKAEERIKSNAWDIEAWSVLLRDAQSKKVEDAREVFERIVAQFPVAGQYWKIYISQEMKAKNYERVEKLFQRCLVKILNIDLWKIYLQYIKETKGKHQSFKEKMAQAYDFTLDKMGLDLNSYSIWADYISFLRSTQVQGSYAESQKITATRRVYQRAIVTPMLGIETIWRDYCMYENSINPLIAKKFTEERSRDYMNARRVAKEYEVITKGLSRTMPSVPPQNTPYEAKQVELWKKYIQWEKDNPLKTEDIITVTKRVMFAYEQCLLCLGHHPDIWYEAASYLDHASKVLVEKGDQTTARQFANDTAAMYERAIALLKTNMMLYFAYADYEEGRCKYAKVHSIYKKLVSLENIDPTLPYIQYMRFARRAEGIMSARYVFKLARDDPRITYHVYCSAALMEYFCSKDKTIGHKIFELGMKRFGGIAEYVLCYVDFMAHLNEDNNIRVLFERALGSNQITQERARLIWARFLQFESQVGDLASILKVEKRRLQALDSSKEFSRLETALLIDRYRFLDLLPCSDSELRSLGYRELTRFQLAGIGKGYDDILCGVISSHGTAGVSLGSTLSGVTGGSSGGVVVVSDTLGSTINATDPRPTYPQPDVSQMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLLKLIPPPQCFHGPFVDVDKFLEHFLELEIPEDYMEIVAGESEELATSIDCGTALSIELASTA 711          
BLAST of Cleavage stimulation factor subunit 3 vs. TrEMBL
Match: A0A183SZX5 (Suf domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9773 PE=4 SV=1)

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 450/705 (63.83%), Postives = 547/705 (77.59%), Query Frame = 2
Query:   71 ENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQ-------------------------------ISSQIATSVPELGSNL-DNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEY----ANPPVDENMIIDSGTALSIEMAANAQL 2077
            + +V   DK+ +AEERIKSN WDIEAW+V+LRDAQS  I++ R I ER++ QFP+ GQY K YI QE KAK +E VEKLF+  L +I +IDLWK YL YIK+   K P+FKE+MAQAYD+ +DKMGLDL S+ IW+DYI FL+STQV+  YAESQK  ATRR+Y RAIVTPM+GIETIWRDY  +E SIN  IAKKF EER+RD++NARRV KEYE+ITKGL RN+PSVPPQ T  E+KQVELWKKYIQWEK+NPLKTED ITITKR +FAYEQCLLCLGHHPDIWYEAA+YLE ASKLLAEKGDQ  +++FAD+ A MY+RAT +L+ N++L+FAYADYEE R K+ KV +IYK LIS D IDPTL YIQ+ RF RR +GI++AR VFK+AR+DPR  YQVY++AA+ME+YC+KD  +  KIFELG+KR+   P+FVL YVDYM HLNEDNNTRVLFERALG+  +  E++R+IW +FLQFE  VGDLASILK+E+RRL+ LE +KEFQ  ETALLIDRY+F++LFPCSD+EL+S+ Y+++++                                 S  I+TS    GS+L +++ +    Y +PD  QMLPFKPKAYPRTGSHPVAGGEFPPPPAASSL+ LLPPPECFHGPFVQV KF+EHFL L+IPE+Y    A+   D    IDSGTALSIE+A  A L
Sbjct:    5 QRRVFKMDKVQRAEERIKSNVWDIEAWSVMLRDAQSKKIDDAREILERIIVQFPMAGQYWKIYIQQEMKAKNYERVEKLFQRCLIKILNIDLWKLYLQYIKETKCKHPNFKEKMAQAYDFTLDKMGLDLNSYSIWADYITFLRSTQVQGSYAESQKITATRRVYQRAIVTPMLGIETIWRDYCMYENSINPHIAKKFTEERNRDHVNARRVTKEYESITKGLARNMPSVPPQVTPYEVKQVELWKKYIQWEKNNPLKTEDPITITKRVMFAYEQCLLCLGHHPDIWYEAASYLEQASKLLAEKGDQNMARQFADETAAMYERATALLKTNIMLYFAYADYEEGRCKYAKVHSIYKKLISLDGIDPTLPYIQYMRFTRRCEGILSARSVFKMARDDPRVGYQVYVSAALMEYYCSKDTTIGHKIFELGMKRFASNPDFVLCYVDYMAHLNEDNNTRVLFERALGTEQIQSERARVIWARFLQFELQVGDLASILKIEKRRLKTLENVKEFQGRETALLIDRYRFLDLFPCSDSELRSLNYKELAKYNLTGGGGFMPVPPLLNAAGINEDGGLSTAGVASGAISTSSIAAGSSLFESDGNQRPTYPQPDANQMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLIHLLPPPECFHGPFVQVDKFLEHFLNLEIPEDYLTQVASESEDLANNIDSGTALSIELANTASL 709          
BLAST of Cleavage stimulation factor subunit 3 vs. TrEMBL
Match: A0A1S8X2U7 (Suppressor of forked protein OS=Opisthorchis viverrini OX=6198 GN=X801_03079 PE=4 SV=1)

HSP 1 Score: 889.026 bits (2296), Expect = 0.000e+0
Identity = 454/732 (62.02%), Postives = 556/732 (75.96%), Query Frame = 2
Query:   62 FMAENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFK-------------ERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR--------------------QISSQIATSVPELGSNLDN-------NADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEY---ANPPVDE-NMIIDSGTALSIEMAANAQ------LMRKRRRISIN 2107
            FM + +V   DK+ KAEERIK+NPWDIEAW+VLLRDAQS  +E+ R +FER+V+QFP  GQY K YI+QE KAK FE VEKLF+  L +I +IDLWK YL YIKD   K  +FK             E+MAQAYD+ +DKMGLDL S+ IW+DYI+FL+STQV+  YAESQK  ATRR+Y R+IVTPM+GIETIWRDY  +E SIN +IAKKF EERSRDYMNARRVAKEYE ITKGL+RN+PS+PPQNT  E KQVELWKKYIQWEKDNPLKTED+IT TKR +FAYEQCLLCLGHHPDIWYEAA++LEHASK+L EKGDQ  +++FA++ A MY+RA  +L+ N++L+FAYADYEE R KF KV +IYK LIS ++IDPTL YIQ+ RF RR++GI++AR VFKLAR+D R SY VY  AA ME+YC+KD ++  KIFELG+KR+    +++L YVD+M HLNEDNN RVLFERALGS  +  E++R+IW +FLQFES VGDLASILKVE+RRLQALE +KE    E+ALLIDRY+F++L PCSD+ELKS+GYR+++R                     +    A S+  +GS + +       + D    Y +PD  QMLPFKPKAYPRTGSHPV GGEFPPPPAAS+LLRLLPPPECFHGPFV++ KFMEHFLEL+IP++Y    N   +E +  ID GTALSIE+A+ A       L  ++RR  +N
Sbjct:    3 FM-QRRVYKMDKMQKAEERIKANPWDIEAWSVLLRDAQSKKVEDARDVFERIVNQFPFAGQYWKIYINQEMKAKNFERVEKLFQRCLVKILNIDLWKLYLQYIKDTKGKHHAFKYIIFAHCIFIFTREKMAQAYDFTLDKMGLDLNSYSIWADYISFLRSTQVQGSYAESQKITATRRVYQRSIVTPMLGIETIWRDYCMYENSINPLIAKKFTEERSRDYMNARRVAKEYEVITKGLSRNMPSIPPQNTPYEAKQVELWKKYIQWEKDNPLKTEDIITTTKRVMFAYEQCLLCLGHHPDIWYEAASHLEHASKVLMEKGDQTTARQFANETASMYERAIALLKTNMMLYFAYADYEEGRCKFAKVHSIYKKLISLENIDPTLPYIQYMRFARRAEGILSARHVFKLARDDSRISYHVYCAAAFMEYYCSKDKEIGHKIFELGMKRFGGNADYILCYVDFMTHLNEDNNIRVLFERALGSNQVASERARVIWARFLQFESQVGDLASILKVEKRRLQALETVKEVSRLESALLIDRYRFLDLLPCSDSELKSLGYRELARFQFAGSGRGYDEFFGSVLAPHVGLSTALSL-GVGSTMGDPSVLSGSSGDQRPAYPQPDVSQMLPFKPKAYPRTGSHPVGGGEFPPPPAASALLRLLPPPECFHGPFVEIDKFMEHFLELEIPDDYMEIVNAESEELSNSIDPGTALSIELASTASSTAPMLLAARKRRQQLN 732          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Cavefish
Match: cstf3 (cleavage stimulation factor, 3' pre-RNA, subunit 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1997])

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 380/725 (52.41%), Postives = 513/725 (70.76%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQE-KKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPEL-----GSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKR-RRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K YI  E K    F  +  LF+  L ++ HIDLWK YLSY+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDY+ +E  IN  +AKK IE+RSRDYMNARRVAKEYE + KGL+RN PSVPPQN+ +E +QVE+WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPD+WYEAA YLE +SKLLAEKGD  N+K F+D+ A +Y+RA + +L++N+LL+F++ADYEESR K+EKV +IY  L++ + IDPTLVYIQ+ +F RR++GI + R +FK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y  +PE++LAY+DY++HLNEDNNTRVLFER L SG + PEKS  IW +FL FES++GDLASILKVERRR  A +   E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR   ++ A  +PE         L +  D    Y +PD  QM+PF+P+     G HPV GG FP PPAA  L++LLPPP CF GPFV+V + ME F    +PE      V+  + + +G+     M  N  +        ++   N DSD+E                +    + DIY+ RQQK+ R
Sbjct:   15 PEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVKFHFLFLFLSCLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYSKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNSPQEAQQVEMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDVWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFSFADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRSIFKKAREDVRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYILAYIDYLSHLNEDNNTRVLFERVLTSGSLSPEKSGEIWARFLAFESNIGDLASILKVERRRFMAFKD--EYEGKETALLVDRYKFMDLYPCSSSELKALGYKDVSR---AKYAALIPEAVVAPSAPTLKDETDRKPEYPKPDTNQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPPPTCFMGPFVKVDELMESFRRCTLPET-----VEAAVELITGSRPDAPMEGNGPVENHAVANKALKRPNADSDEEEEKG------------AVAPPVNDIYRARQQKRIR 717          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Cavefish
Match: prpf39 (pre-mRNA processing factor 39 [Source:NCBI gene;Acc:103021423])

HSP 1 Score: 72.4034 bits (176), Expect = 1.285e-12
Identity = 95/410 (23.17%), Postives = 167/410 (40.73%), Query Frame = 2
Query:   71 ENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDA-QSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRI-YHIDLWKFYLSYIK-DKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKS------------------TQVKSQYAE---------------SQKTIATRRIYHRAIVTPMV-------------GIETIWRDYNAFETSINSVIAKKFIEERSRDY-MNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVEL--WKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVI-LRENLLLHFAYADYEESRSKFEKVEAIYKNL 1141
            E K + P    +  + ++ NP D   W  LL+   Q   I   R  F+     +P    Y K Y   EKK    +  +++++  L  I   +DLW  Y+++++ ++DN     + R+  AY++AV   G D +S  +W  YIN+                     TQ+ SQ+ +               S++     R+   A   P V             G E +  D     T I + +  K IE R   +  N   V+K + A  +G+ R      P   V+ +++ +L  W++Y+ +E +N           +R +  +E+CL+    + + W + A YLE  S                + V  +Y++A  I L +   +HF +A +EE +   E+   I K+L
Sbjct:  155 EGKEAMPSDFDRLYKVVEDNPEDFNGWVYLLQYVEQENHILASRRAFDAFFLHYPYCYGYWKKYADIEKKHGFIQEADEVYRRGLQAIPLSVDLWLHYIAFLRENQDNSDGEAESRIRAAYEHAVLAAGTDFRSDRLWEAYINWETEQEKLANVTAVYDRILGIPTQLYSQHFQRFKDHVQNGNPKHFLSEEEFVQLRLELAAANKPTVEGEEEAPSEELPPGTEDL-PDPAKRVTEIEN-MRHKVIEARQEIFNHNEHEVSKRW-AFEEGIKR------PYFHVKALEKTQLSNWREYLDFELEN--------GTPERVVVLFERCLIACALYEEFWIKYAKYLESYS---------------TEGVRHVYKKACTIHLPKKANIHFLWAAFEEQQGNIEEARGILKSL 532          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Cavefish
Match: prpf39 (pre-mRNA processing factor 39 [Source:NCBI gene;Acc:103021423])

HSP 1 Score: 58.151 bits (139), Expect = 1.540e-8
Identity = 45/174 (25.86%), Postives = 77/174 (44.25%), Query Frame = 2
Query:   71 ENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDA-QSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRI-YHIDLWKFYLSYIK-DKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTP 583
            E K + P    +  + ++ NP D   W  LL+   Q   I   R  F+     +P    Y K Y   EKK    +  +++++  L  I   +DLW  Y+++++ ++DN     + R+  AY++AV   G D +S  +W  YIN+           E +K      +Y R +  P
Sbjct:  155 EGKEAMPSDFDRLYKVVEDNPEDFNGWVYLLQYVEQENHILASRRAFDAFFLHYPYCYGYWKKYADIEKKHGFIQEADEVYRRGLQAIPLSVDLWLHYIAFLRENQDNSDGEAESRIRAAYEHAVLAAGTDFRSDRLWEAYINW---------ETEQEKLANVTAVYDRILGIP 319          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Cavefish
Match: prpf39 (pre-mRNA processing factor 39 [Source:NCBI gene;Acc:103021423])

HSP 1 Score: 55.0694 bits (131), Expect = 1.934e-7
Identity = 73/319 (22.88%), Postives = 131/319 (41.07%), Query Frame = 2
Query:  338 IDLWKFYLSYIK-DKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKS------------------TQVKSQYAE---------------SQKTIATRRIYHRAIVTPMV-------------GIETIWRDYNAFETSINSVIAKKFIEERSRDY-MNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVEL--WKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVI-LRENLLLHFAYADYEESRSKFEKVEAIYKNL 1141
            +DLW  Y+++++ ++DN     + R+  AY++AV   G D +S  +W  YIN+                     TQ+ SQ+ +               S++     R+   A   P V             G E +  D     T I + +  K IE R   +  N   V+K + A  +G+ R      P   V+ +++ +L  W++Y+ +E +N           +R +  +E+CL+    + + W + A YLE  S                + V  +Y++A  I L +   +HF +A +EE +   E+   I K+L
Sbjct:   37 VDLWLHYIAFLRENQDNSDGEAESRIRAAYEHAVLAAGTDFRSDRLWEAYINWETEQEKLANVTAVYDRILGIPTQLYSQHFQRFKDHVQNGNPKHFLSEEEFVQLRLELAAANKPTVEGEEEAPSEELPPGTEDL-PDPAKRVTEIEN-MRHKVIEARQEIFNHNEHEVSKRW-AFEEGIKR------PYFHVKALEKTQLSNWREYLDFELEN--------GTPERVVVLFERCLIACALYEEFWIKYAKYLESYS---------------TEGVRHVYKKACTIHLPKKANIHFLWAAFEEQQGNIEEARGILKSL 323          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Sea Lamprey
Match: cstf3 (cleavage stimulation factor, 3' pre-RNA, subunit 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1997])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 398/733 (54.30%), Postives = 515/733 (70.26%), Query Frame = 2
Query:   68 AENKVSN--PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEE--SRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR--QISSQI-ATSVPELG-SNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            AEN      P+K+ KAE +++ NP+DIEAW+VL+R+AQ+   ++ R I ERLV+QF  +G+Y K+YI  E K+K F+ VEKLF+  L ++ HIDLWK YL+Y++D   K PSFKE+MAQAYD+A+DK+G+D+ S+PIW DYI+FLK  +    YAE+ +  A RR+Y R  V PM+ IE +WRDY+ +E  IN  +AKK IE+RSRDYMNARRVAKEYE +TKGL+RN PSVPPQNT +E  QVELWK+YIQWEK NPL+TED   +TKR +F+YEQCLL LGHHPDIWYEAA YLEH+SKLLAEKGD  NSK F+D+ A +Y+RA + +LR+N+LL+FAYADY +  SR K+EKV +IY  L + + IDPTLVYIQ+ +F RR++GI A R VFK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y   PE++LAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES +GDLASILKVE+RR  A    +E+   ETALL+DRY+FM+L+PCS +ELK++GY+D++R    SSQ    SVP    ++ + +      Y +P+  QM PF+P+     G HPV GG FP PPAA  L++L PPP  F GPFV V K ++ F E K+PE  A+     N   D G     +          RR  ++  +  D  DE  +  ST+    P          DIY+ RQQKK R
Sbjct:    6 AENPAQEYVPEKVKKAERKLEDNPFDIEAWSVLIREAQNQVPDKARRILERLVNQFTNSGRYWKTYIEAEIKSKHFDRVEKLFQRCLMKVLHIDLWKCYLTYVRDTKGKLPSFKEKMAQAYDFALDKIGMDIMSYPIWVDYISFLKGVEAVGSYAENLRITAVRRVYQRGCVNPMINIEHLWRDYSKYEEGINVHLAKKMIEDRSRDYMNARRVAKEYETVTKGLDRNAPSVPPQNTPQEAHQVELWKRYIQWEKGNPLRTEDQTLLTKRVMFSYEQCLLVLGHHPDIWYEAAQYLEHSSKLLAEKGDINNSKLFSDEAAAIYERAISTLLRKNMLLYFAYADYPQSHSRMKYEKVHSIYSRLAAVEDIDPTLVYIQYMKFARRAEGIKAGRTVFKKAREDIRTRHHVYVAAALMEYYCSKDKAVAFKIFELGLKKYGDTPEYILAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSSEIWARFLSFESSIGDLASILKVEKRRFTAFR--EEYDGKETALLVDRYQFMDLYPCSSSELKALGYKDVTRAKMTSSQPDPVSVPSAAPTSSEEDVTRRPEYPKPNIHQMAPFQPRHMAPPGLHPVPGGVFPVPPAAVHLMKLCPPPLSFQGPFVHVDKLIDLFREFKLPETTASAAEGNNGSADGGAHRGHDPV--------RRSGAVKRSAADDSDEEDDKTSTT----PPAH-------DIYRVRQQKKVR 717          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Sea Lamprey
Match: cstf3 (cleavage stimulation factor, 3' pre-RNA, subunit 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1997])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 395/724 (54.56%), Postives = 512/724 (70.72%), Query Frame = 2
Query:   89 PDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEE--SRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR--QISSQI-ATSVPELG-SNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQR 2239
            P+K+ KAE +++ NP+DIEAW+VL+R+AQ+   ++ R I ERLV+QF  +G+Y K+YI  E K+K F+ VEKLF+  L ++ HIDLWK YL+Y++D   K PSFKE+MAQAYD+A+DK+G+D+ S+PIW DYI+FLK  +    YAE+ +  A RR+Y R  V PM+ IE +WRDY+ +E  IN  +AKK IE+RSRDYMNARRVAKEYE +TKGL+RN PSVPPQNT +E  QVELWK+YIQWEK NPL+TED   +TKR +F+YEQCLL LGHHPDIWYEAA YLEH+SKLLAEKGD  NSK F+D+ A +Y+RA + +LR+N+LL+FAYADY +  SR K+EKV +IY  L + + IDPTLVYIQ+ +F RR++GI A R VFK ARED RT + VY+ AA+ME+YC+KD  VA KIFELGLK+Y   PE++LAY+DY++HLNEDNNTRVLFER L SG +PPEKS  IW +FL FES +GDLASILKVE+RR  A    +E+   ETALL+DRY+FM+L+PCS +ELK++GY+D++R    SSQ    SVP    ++ + +      Y +P+  QM PF+P+     G HPV GG FP PPAA  L++L PPP  F GPFV V K ++ F E K+PE  A+     N   D G     +          RR  ++  +  D  DE  +  ST+    P          DIY+ RQQKK R
Sbjct:   15 PEKVKKAERKLEDNPFDIEAWSVLIREAQNQVPDKARRILERLVNQFTNSGRYWKTYIEAEIKSKHFDRVEKLFQRCLMKVLHIDLWKCYLTYVRDTKGKLPSFKEKMAQAYDFALDKIGMDIMSYPIWVDYISFLKGVEAVGSYAENLRITAVRRVYQRGCVNPMINIEHLWRDYSKYEEGINVHLAKKMIEDRSRDYMNARRVAKEYETVTKGLDRNAPSVPPQNTPQEAHQVELWKRYIQWEKGNPLRTEDQTLLTKRVMFSYEQCLLVLGHHPDIWYEAAQYLEHSSKLLAEKGDINNSKLFSDEAAAIYERAISTLLRKNMLLYFAYADYPQSHSRMKYEKVHSIYSRLAAVEDIDPTLVYIQYMKFARRAEGIKAGRTVFKKAREDIRTRHHVYVAAALMEYYCSKDKAVAFKIFELGLKKYGDTPEYILAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSSEIWARFLSFESSIGDLASILKVEKRRFTAFR--EEYDGKETALLVDRYQFMDLYPCSSSELKALGYKDVTRAKMTSSQPDPVSVPSAAPTSSEEDVTRRPEYPKPNIHQMAPFQPRHMAPPGLHPVPGGVFPVPPAAVHLMKLCPPPLSFQGPFVHVDKLIDLFREFKLPETTASAAEGNNGSADGGAHRGHDPV--------RRSGAVKRSAADDSDEEDDKTSTT----PPAH-------DIYRVRQQKKVR 717          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Sea Lamprey
Match: prpf39 (PRP39 pre-mRNA processing factor 39 homolog (yeast) [Source:NCBI gene;Acc:368864])

HSP 1 Score: 51.6026 bits (122), Expect = 6.175e-7
Identity = 37/137 (27.01%), Postives = 63/137 (45.99%), Query Frame = 2
Query:   92 DKILKAEERIKSNPWDIEAWNVLLR-DAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRI-YHIDLWKFYLSY-IKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINF 493
            DK  KA   ++ NP D   W  LL+   Q   +   R  F+    ++P    Y K Y   EK+    +  E++F+  L  I   +DLW  Y+++ I+  D   P    ++   ++ AV   G D +S  +W  +I++
Sbjct:   41 DKYWKA---VEENPQDFTGWTYLLQYIEQENHVWAARKAFDEFFMRYPYCYGYWKKYADLEKRFGNVKQAEEVFRRGLQAIPLSVDLWIHYINFEIELLDPDCPETVSKIRSLFELAVAAAGTDFRSDKLWEMFISW 174          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Yeast
Match: RNA14 (Component of the cleavage and polyadenylation factor I (CF I); CF 1, composed of the CF 1A complex (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in cleavage and polyadenylation of mRNA 3' ends; bridges interaction between Rna15p and Hrp1p in the CF I complex; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; required for gene looping and maintenance of genome stability; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000004665])

HSP 1 Score: 177.178 bits (448), Expect = 2.630e-47
Identity = 144/542 (26.57%), Postives = 266/542 (49.08%), Query Frame = 2
Query:   68 AENKVSNP-DKI----LKAEERIKSNPWDIEAWNVLLRDAQST-SIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYH---IDLWKFYLSYIKDKDNKTPSFKERMA---QAYDYAVDKMGL-DLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLP---------SVP-PQNTVEEIKQVELWKKYIQWEKDNPLK-TEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASK--------LLAEKGDQENSKKF---------ADKVAEMYQRAT-VILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRT-SYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERR 1564
            + +KV+ P D I    L+  ERIK NP +I ++  L++  ++  S  + R ++E+  + FP         +  E     FE VEK+  + L        + LW  YL YI+ K+N     +E  A   +A+   + K  + + KS   W++Y+NFL+  +  +++ E Q+    R  Y + +  P   +E +W  Y  +E  INS+ A+KFI E S +YM AR + +E+  +T GL R  P         ++P P  +   I+Q+++W  +I+WE++N L  +ED+  +++R  + Y+Q +  +    ++WY+ + Y+   S         LLA       + K          ++ V+  + + T  +L +   +       E++ +++E+ E +YK          T V+  +   ++R  G+ AAR VF   R+  R  ++ VY+  A +E     D K A K+ ELGLK +     ++  Y+D++  LN+D+  + LFE ++        + + I+ K + +ES  G+L ++  +E+R
Sbjct:   13 SADKVAEPSDNIHGDELRLRERIKDNPTNILSYFQLIQYLETQESYAKVREVYEQFHNTFPFYSPAWTLQLKGELARDEFETVEKILAQCLSGKLENNDLSLWSTYLDYIRRKNNLITGGQEARAVIVKAFQLVMQKCAIFEPKSSSFWNEYLNFLEQWKPFNKWEEQQRIDMLREFYKKMLCVPFDNLEKMWNRYTQWEQEINSLTARKFIGELSAEYMKARSLYQEWLNVTNGLKRASPINLRTANKKNIPQPGTSDSNIQQLQIWLNWIKWERENKLMLSEDM--LSQRISYVYKQGIQYMIFSAEMWYDYSMYISENSDRQNILYTALLANPDSPSLTFKLSECYELDNDSESVSNCFDKCTQTLLSQYKKIASDVNSGEDNNTEYEQ-ELLYK-----QREKLTFVFCVYMNTMKRISGLSAARTVFGKCRKLKRILTHDVYVENAYLEFQNQNDYKTAFKVLELGLKYFQNDGVYINKYLDFLIFLNKDSQIKTLFETSV-EKVQDLTQLKEIYKKMISYESKFGNLNNVYSLEKR 545          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Nematostella
Match: EDO40717 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6G7])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 334/721 (46.32%), Postives = 482/721 (66.85%), Query Frame = 2
Query:   83 SNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRA-TVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSNLDN-NADGPGGYLRPDYCQMLPFKPKAYPRTGSHPV--AGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKK 2233
            S  ++  KAE R++++P+D+E+W VL+R+AQS  ++  + ++E+LV +FP  G+Y + YI QE K + +ENVEKLF+  L ++ +IDLWK YL+Y+K+  +  P+F+E+M QAY++A+DK+GLD  S+ +W DY+ FLKS +    YAE+QK    RR+Y RA+ TP++ +E IWR+YN FE  IN V+AKK I+ER+RDYMNARR+AKEYEA+++GL +  PS+PPQ T EE+KQ++LWKKYI WE+ NPL  +D   +T+R ++AYEQCL C+G +PDIW EAATYLE  S+ LAEKGD + SK   D+ A +Y++A + ++  NLL++FAYAD+EE R +F++ + IY+  I+ +++DPTL +IQ+ RF RR++G+  +R VFK ARED RT++ V++ +A+ME+YC KD  VA KIFELGLK+Y    +FVL YVDY++HLN+DNNTRVLFE+ L +  MP EK+  +W KF++FE+  GDL+SILKVE+RRLQ  +  +EF+ HETA+L+DRY+F++L PCS  ELK +GY   SR ++S I+T+     + L+    +    +  PD  QM PFKP A    G+      GG F   P        L     F+GPFV + + M  F E  +P         +  I D+   L  EM  + +   KR          DSDDE G+ ++      P+         DIY+ RQQK+
Sbjct:   29 SRTERGQKAELRLQNHPYDLESWGVLIREAQSLPLDAAKVLYEKLVRRFPNAGRYWRLYIEQEMKHQNYENVEKLFQRCLIKVLNIDLWKSYLAYVKETKSSLPNFREKMGQAYEFALDKIGLDFNSYQVWMDYLTFLKSGESTGSYAENQKIAMIRRVYLRAVTTPIINVEAIWREYNTFEQGINKVLAKKLIDERTRDYMNARRMAKEYEALSRGLIKGAPSIPPQGTPEEMKQLQLWKKYIFWERSNPLWIDDTGLLTRRVIYAYEQCLQCMGFNPDIWCEAATYLESTSRALAEKGDTQGSKVLGDEAANLYEKAISGLMHNNLLVYFAYADFEEGRMRFQQAKEIYEKYIALENVDPTLAFIQYMRFSRRAEGVKESRSVFKRAREDARTNFHVFVASALMEYYCGKDKAVAFKIFELGLKKYTNEADFVLPYVDYLSHLNDDNNTRVLFEKVLST--MPKEKASDVWTKFIEFETTSGDLSSILKVEKRRLQVYK--EEFEQHETAVLVDRYRFLDLLPCSPMELKIMGYTGPSRHVTS-ISTAQSSTDNPLEEVKEEKTVRFPLPDTSQMTPFKPTA----GAAKCLKIGGGFRASPPPPLEPPPL-----FNGPFVVIEELMRLFAECTLP---------DRPIGDTQNGLDEEMDTDQKRGVKR------PGGGDSDDE-GSTVAP-----PS--------HDIYRARQQKR 706          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Nematostella
Match: EDO33251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSQ6])

HSP 1 Score: 77.0258 bits (188), Expect = 8.974e-15
Identity = 97/413 (23.49%), Postives = 162/413 (39.23%), Query Frame = 2
Query:  119 IKSNPWDIEAWNVLLRDA-QSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRI-YHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKS------------------TQVKSQYAESQK----------TIATRRIY----HRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVI-LRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSR--FIRRSKGIVAAREVFKLA 1246
            +K NP D  +W  LL+   Q   +   R  F+    ++P    Y K Y   E+K    E  +++F++ +  I   +DLW  YL++        P   E M + ++ A+   G D +S  +W  YI + KS                  TQ  +Q+ E  K           + T  +       A   P V  E   +  N  ET     I +K I  R+  +       ++       + R    V P   V    Q++ W+ Y+ +E  N           +R +  +E+C++    + D W   A+Y+E+ S  +AE              + +Y RA  I L     +H A+A +EE      +   I K+L   D+  P LV ++  R    RR+  +  A E+F+ A
Sbjct:    6 VKENPSDFTSWTYLLQFVEQENKLSSARKAFQTFFKRYPYCYGYWKKYADMERKNGNIEAAKEVFEQGVKAIACSVDLWVHYLNFSSQATKGQPDGPEIMRRLFERAIATAGQDFRSDKLWDAYIEWEKSQGQLQRVTALYDKLFTVPTQNYAQHFEKFKEHINTHPVASVLQTEELLKLRAEVAAAPPGVISEAEPQVANDAET---VAIREKVIAARTEIFNKLEDEIRKCWVFEDAIKRPYFHVKPLERV----QLKNWRDYLDYEIANGEH--------RRVVILFERCVIACALYEDFWQRYASYMENHS--IAE-------------CSSIYTRACTIHLPRKPNIHLAWAAFEEKNGDCNRASEILKDL---DNAVPGLVSVKLRRVSLERRANNLEKAAELFEEA 385          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Nematostella
Match: EDO29782 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2N5])

HSP 1 Score: 48.9062 bits (115), Expect = 2.992e-6
Identity = 35/140 (25.00%), Postives = 66/140 (47.14%), Query Frame = 2
Query: 1172 VYIQHSRFIRRSKGIVAAREVFK--LAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEG 1585
            V+I+  RF  ++    +AR++ +  L     R   +  +  A+ME +   DP+  Q + E  L  Y K  +    Y+D M+     +  R +FER +    +   K + ++ K+L FE   GD  S+  V+ + ++ +E 
Sbjct:  132 VWIEFGRFFMKTGKPDSARKLLQRGLKSLPTRKHVETIVQFALME-FKNGDPQRGQTVLESVLSNYPKRTDIWSVYIDMMSKQGHPDTVRQIFERVIHMN-LSSRKMKFLFKKYLDFEREHGDEMSVEAVKTKAMEYVES 269          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Nematostella
Match: EDO38955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBJ3])

HSP 1 Score: 49.2914 bits (116), Expect = 6.926e-6
Identity = 35/139 (25.18%), Postives = 66/139 (47.48%), Query Frame = 2
Query: 1172 VYIQHSRFIRRSKGIVAAREVFK--LAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALE 1582
            V+I+  RF  ++    +AR++ +  L     R   +  +  A+ME +   DP+  Q + E  L  Y K  +    Y+D M+     +  R +FER +    +   K + ++ K+L FE   GD  S+  V+ + ++ +E
Sbjct: 1629 VWIEFGRFFMKTGKPDSARKLLQRGLKSLPTRKHVETIVQFALME-FKNGDPQRGQTVLESVLSNYPKRTDIWSVYIDMMSKQGHPDTVRQIFERVIHMN-LSSRKMKFLFKKYLDFEREHGDEMSVEAVKTKAMEYVE 1765          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Medaka
Match: cstf3 (cleavage stimulation factor subunit 3 [Source:NCBI gene;Acc:101162671])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 390/732 (53.28%), Postives = 523/732 (71.45%), Query Frame = 2
Query:   68 AENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRAT-VILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQ-----IATSVPELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGI-PTIQSAEGNIIDIYKFRQQKKQR 2239
            AE     P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K +I  E KAK ++ VEKLF+  L ++ HIDLWK YL+Y+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDY+ +E  IN  +AKK I++RSRDYMNARRVAKEYE + KGL+RN PSVPPQN+ +E  QV++WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  NSK F+D+ A +Y+RA   +L++N+LL+FA+ADYEESR KFEKV +IY  L++ + IDPTLVY Q+ +F RR++GI + R +FK AREDPRT + VY++AA+ME+YC+KD  VA KIFELGLK+Y  +PE++LAY+DY++HLNEDNNTRVLFER L SG +  EKS  IW +FL FES++GDLASILKVERRR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR +++S      +A SVP L   +D   + P    +PD  QM+P++P+     G HPV GG FP PPAA  L++L+PPP CF GPFVQV + ME F    +PE      VD  + + +G         N  +       S+   N DSD+E         G + P I        DIY+ RQQK+ R
Sbjct:    7 AEQTEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVSQFPSSGRFWKLFIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLAYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYSKYEEGINVHLAKKMIDDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNSPQEAVQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNSKLFSDEAANIYERAIGTLLKKNMLLYFAFADYEESRMKFEKVHSIYNKLLAIEDIDPTLVYTQYMKFARRAEGIKSGRTIFKKAREDPRTRHHVYVSAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYILAYIDYLSHLNEDNNTRVLFERVLTSGSLSAEKSGEIWARFLAFESNIGDLASILKVERRRFTAFK--EEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLASMLPETVVAPSVPVLKDEVDRKPEYP----KPDTNQMIPYQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLIPPPTCFTGPFVQVDELMETFRRCTLPET-----VDAAVELITGRHPDAGGEGNGSMENHTITKSLKRPNADSDEE------DDKGAVAPPIH-------DIYRARQQKRIR 714          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Medaka
Match: cstf3 (cleavage stimulation factor subunit 3 [Source:NCBI gene;Acc:101162671])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 390/732 (53.28%), Postives = 523/732 (71.45%), Query Frame = 2
Query:   68 AENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRAT-VILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISR-QISSQ-----IATSVPELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGI-PTIQSAEGNIIDIYKFRQQKKQR 2239
            AE     P+K+ KAE++++ NP+D++AW++L+R+AQ+  I++ R  +ERLV QFP +G++ K +I  E KAK ++ VEKLF+  L ++ HIDLWK YL+Y+++   K PS+KE+MAQAYD+A+DK+G+++ S+ IW DYINFLK  +    YAE+Q+  A RR+Y R  V PM+ IE +WRDY+ +E  IN  +AKK I++RSRDYMNARRVAKEYE + KGL+RN PSVPPQN+ +E  QV++WKKYIQWEK NPL+TED   ITKR +FAYEQCLL LGHHPDIWYEAA YLE +SKLLAEKGD  NSK F+D+ A +Y+RA   +L++N+LL+FA+ADYEESR KFEKV +IY  L++ + IDPTLVY Q+ +F RR++GI + R +FK AREDPRT + VY++AA+ME+YC+KD  VA KIFELGLK+Y  +PE++LAY+DY++HLNEDNNTRVLFER L SG +  EKS  IW +FL FES++GDLASILKVERRR  A +  +E++  ETALL+DRYKFM+L+PCS +ELK++GY+D+SR +++S      +A SVP L   +D   + P    +PD  QM+P++P+     G HPV GG FP PPAA  L++L+PPP CF GPFVQV + ME F    +PE      VD  + + +G         N  +       S+   N DSD+E         G + P I        DIY+ RQQK+ R
Sbjct:    7 AEQTEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVSQFPSSGRFWKLFIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLAYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRGCVNPMINIEQLWRDYSKYEEGINVHLAKKMIDDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNSPQEAVQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNSKLFSDEAANIYERAIGTLLKKNMLLYFAFADYEESRMKFEKVHSIYNKLLAIEDIDPTLVYTQYMKFARRAEGIKSGRTIFKKAREDPRTRHHVYVSAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYILAYIDYLSHLNEDNNTRVLFERVLTSGSLSAEKSGEIWARFLAFESNIGDLASILKVERRRFTAFK--EEYEGKETALLVDRYKFMDLYPCSASELKALGYKDVSRAKLASMLPETVVAPSVPVLKDEVDRKPEYP----KPDTNQMIPYQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLIPPPTCFTGPFVQVDELMETFRRCTLPET-----VDAAVELITGRHPDAGGEGNGSMENHTITKSLKRPNADSDEE------DDKGAVAPPIH-------DIYRARQQKRIR 714          
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Medaka
Match: prpf39 (pre-mRNA processing factor 39 [Source:NCBI gene;Acc:101169579])

HSP 1 Score: 67.0106 bits (162), Expect = 4.719e-11
Identity = 49/167 (29.34%), Postives = 77/167 (46.11%), Query Frame = 2
Query:   92 DKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEG-RPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRI-YHIDLWKFYLSYIKDK-DNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTP 583
            D++ K+    + NP D  AW  LL+  +  ++  G R  F+    ++P    Y K Y   EKK    +  E++++  L  I   +DLW  YL++IK+  D   P  + R+  +YD+AV   G D +S  +W  YI +           E QK      IY R +  P
Sbjct:  164 DRLFKS---CEENPEDFNAWVALLQYVEQENLLVGARKAFDTFFLRYPYCYGYWKKYADLEKKNGNIQVAEEVYRRGLHAIPLSVDLWLHYLTFIKENSDPNDPETEGRIRASYDHAVMAAGTDFRSDRLWESYITW---------ETEQQKLANVTSIYDRVLGIP 318          
BLAST of Cleavage stimulation factor subunit 3 vs. Planmine SMEST
Match: SMESG000022467.1 (SMESG000022467.1)

HSP 1 Score: 1473.37 bits (3813), Expect = 0.000e+0
Identity = 727/728 (99.86%), Postives = 728/728 (100.00%), Query Frame = 2
Query:   65 MAENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVILRENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFXXXXXXXXXXXXXXXXECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQRSGL 2248
            MAENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVIL+ENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLLRLLPPPECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQRSGL
Sbjct:    1 MAENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFERLVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLSYIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVKSQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFIEERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYIQWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASKLLAEKGDQENSKKFADKVAEMYQRATVILKENLLLHFAYADYEESRSKFEKVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRTSYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHLNEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERRRLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISSQIATSVPELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGGEFPPPPAASSLLRLLPPPECFHGPFVQVAKFMEHFLELKIPEEYANPPVDENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIGGIPTIQSAEGNIIDIYKFRQQKKQRSGL 728          
The following BLAST results are available for this feature:
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSTF30.000e+055.02cleavage stimulation factor subunit 3 [Source:HGNC... [more]
CSTF30.000e+055.02cleavage stimulation factor subunit 3 [Source:HGNC... [more]
CSTF32.364e-1345.90cleavage stimulation factor subunit 3 [Source:HGNC... [more]
CSTF35.528e-1046.81cleavage stimulation factor subunit 3 [Source:HGNC... [more]
PRPF396.048e-725.34pre-mRNA processing factor 39 [Source:HGNC Symbol;... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
suf-10.000e+045.01SUppressor-of-Forked (Drosophila) homolog [Source... [more]
suf-10.000e+045.01SUppressor-of-Forked (Drosophila) homolog [Source... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
su(f)0.000e+047.19gene:FBgn0003559 transcript:FBtr0113733[more]
su(f)0.000e+047.19gene:FBgn0003559 transcript:FBtr0306545[more]
su(f)0.000e+045.20gene:FBgn0003559 transcript:FBtr0306544[more]
CG16465.527e-625.63gene:FBgn0039600 transcript:FBtr0113299[more]
CG16465.527e-625.63gene:FBgn0039600 transcript:FBtr0085325[more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cstf30.000e+054.01cleavage stimulation factor, 3' pre-RNA, subunit 3... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf30.000e+053.94cleavage stimulation factor, 3' pre-RNA, subunit 3... [more]
sil10.000e+054.24SIL1 nucleotide exchange factor [Source:Xenbase;Ac... [more]
cstf30.000e+053.60cleavage stimulation factor, 3' pre-RNA, subunit 3... [more]
sil10.000e+051.46SIL1 nucleotide exchange factor [Source:Xenbase;Ac... [more]
cstf30.000e+050.83cleavage stimulation factor, 3' pre-RNA, subunit 3... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cstf30.000e+054.75cleavage stimulation factor, 3' pre-RNA, subunit 3... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12996|CSTF3_HUMAN0.000e+055.02Cleavage stimulation factor subunit 3 OS=Homo sapi... [more]
sp|Q5RDW9|CSTF3_PONAB0.000e+055.02Cleavage stimulation factor subunit 3 OS=Pongo abe... [more]
sp|Q99LI7|CSTF3_MOUSE0.000e+054.75Cleavage stimulation factor subunit 3 OS=Mus muscu... [more]
sp|P25991|SUF_DROME0.000e+045.20Protein suppressor of forked OS=Drosophila melanog... [more]
sp|Q8GUP1|CTF77_ARATH3.725e-10833.73Cleavage stimulation factor subunit 77 OS=Arabidop... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QIK00.000e+062.10Cleavage stimulation factor subunit 3 (Fragment) O... [more]
A0A3Q0KPI30.000e+063.00Putative cleavage stimulation factor OS=Schistosom... [more]
A0A4Z2DRP20.000e+063.66Cleavage stimulation factor subunit 3 OS=Schistoso... [more]
A0A183SZX50.000e+063.83Suf domain-containing protein OS=Schistocephalus s... [more]
A0A1S8X2U70.000e+062.02Suppressor of forked protein OS=Opisthorchis viver... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cstf30.000e+052.41cleavage stimulation factor, 3' pre-RNA, subunit 3... [more]
prpf391.285e-1223.17pre-mRNA processing factor 39 [Source:NCBI gene;Ac... [more]
prpf391.540e-825.86pre-mRNA processing factor 39 [Source:NCBI gene;Ac... [more]
prpf391.934e-722.88pre-mRNA processing factor 39 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cstf30.000e+054.30cleavage stimulation factor, 3' pre-RNA, subunit 3... [more]
cstf30.000e+054.56cleavage stimulation factor, 3' pre-RNA, subunit 3... [more]
prpf396.175e-727.01PRP39 pre-mRNA processing factor 39 homolog (yeast... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RNA142.630e-4726.57Component of the cleavage and polyadenylation fact... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO407170.000e+046.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332518.974e-1523.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297822.992e-625.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389556.926e-625.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cstf30.000e+053.28cleavage stimulation factor subunit 3 [Source:NCBI... [more]
cstf30.000e+053.28cleavage stimulation factor subunit 3 [Source:NCBI... [more]
prpf394.719e-1129.34pre-mRNA processing factor 39 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cleavage stimulation factor subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000022467.10.000e+099.86SMESG000022467.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017552 ID=SMED30017552|Name=Cleavage stimulation factor subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2275bp
CTTCCGATCTTTTGATCTTATAAAATTTGTTTAATTATGCAATATATTGT
GATATTTTAAATTTATGGCAGAAAATAAAGTTAGTAATCCTGATAAAATA
TTGAAGGCGGAGGAACGCATTAAATCAAATCCATGGGATATCGAAGCGTG
GAATGTTTTATTAAGAGATGCACAAAGTACATCTATTGAAGAGGGTAGGC
CGATATTTGAAAGATTAGTACACCAGTTTCCTCTAACGGGTCAATATGTT
AAAAGCTATATTTCACAGGAGAAAAAGGCCAAAGCTTTTGAAAATGTTGA
AAAACTATTTAAAGAATATTTGCCCAGAATTTATCACATTGATTTATGGA
AATTTTATTTATCTTATATAAAAGATAAAGATAATAAAACTCCAAGTTTC
AAAGAAAGAATGGCTCAAGCTTACGATTATGCTGTAGATAAAATGGGTTT
AGATTTAAAATCTTTTCCTATTTGGTCAGATTATATAAATTTCTTAAAAT
CAACTCAAGTAAAAAGTCAGTATGCGGAAAGTCAAAAAACAATCGCTACA
CGTCGAATCTATCATCGGGCTATTGTTACCCCAATGGTTGGTATTGAAAC
AATTTGGAGAGATTATAATGCTTTCGAAACTTCTATTAATAGCGTCATCG
CTAAGAAATTTATTGAAGAAAGAAGTCGGGATTATATGAATGCAAGACGA
GTTGCAAAAGAATATGAAGCTATTACTAAGGGCTTGAATCGTAACCTCCC
ATCAGTTCCGCCACAAAATACAGTAGAGGAAATCAAACAAGTTGAGTTAT
GGAAAAAATATATTCAATGGGAAAAAGATAACCCTTTAAAAACTGAGGAT
TTGATAACAATAACAAAAAGAACGCTATTTGCATACGAACAATGTTTACT
ATGTCTGGGCCATCATCCAGATATCTGGTACGAAGCAGCAACTTATCTGG
AACACGCCAGTAAGCTTTTAGCTGAGAAGGGTGATCAGGAAAATTCTAAA
AAATTTGCCGATAAAGTCGCAGAAATGTATCAACGGGCTACGGTAATTCT
CAGGGAAAATCTATTATTGCATTTCGCTTATGCCGATTATGAAGAGAGCC
GCAGCAAATTTGAAAAAGTCGAAGCAATCTATAAGAATCTCATCAGTTAC
GATCACATCGATCCTACATTGGTTTACATTCAACACTCGCGCTTTATCAG
GCGTTCCAAAGGTATCGTTGCCGCCAGGGAGGTGTTCAAACTAGCCCGCG
AGGACCCGAGGACCTCGTACCAGGTCTACATAAATGCCGCTATGATGGAG
CATTATTGCACCAAGGATCCGAAAGTCGCACAGAAAATATTCGAACTCGG
CCTGAAACGCTACATGAAAGTACCGGAATTCGTGCTGGCCTATGTGGATT
ACATGAACCATCTGAATGAGGACAACAACACCAGAGTGCTGTTTGAGCGG
GCCCTCGGTAGCGGTTACATGCCACCGGAAAAGAGTCGAATCATCTGGGA
TAAATTCCTGCAATTCGAGTCCCATGTCGGCGATTTAGCGAGTATATTGA
AAGTGGAACGTCGGCGACTGCAGGCATTGGAGGGATTAAAGGAGTTTCAG
AGCCATGAAACCGCATTATTGATAGATCGATACAAATTCATGGAGTTGTT
TCCGTGTTCCGATGCCGAGCTGAAATCGATTGGCTATCGAGACATATCGC
GGCAAATATCGTCACAAATCGCTACATCGGTGCCGGAACTCGGCTCCAAT
CTGGACAACAACGCAGACGGTCCCGGCGGTTACCTTCGGCCGGATTACTG
TCAAATGTTGCCTTTTAAACCGAAAGCCTACCCGAGAACCGGTTCCCATC
CGGTTGCGGGTGGGGAATTCCCCCCTCCGCCCGCTGCCTCATCGTTGTTG
CGGCTCTTACCCCCACCGGAATGCTTCCATGGACCTTTTGTTCAGGTAGC
GAAATTCATGGAGCATTTCCTGGAACTGAAGATCCCTGAAGAGTACGCAA
ATCCCCCGGTCGATGAGAACATGATCATTGACAGTGGCACCGCACTGTCC
ATTGAAATGGCTGCCAATGCACAGCTGATGAGAAAACGGAGGCGCATCAG
TATCAATGAGAATAACCGGGACTCCGATGACGAGATGGGCAACAACCTCT
CTACATCTATCGGCGGCATTCCCACTATCCAATCGGCAGAAGGTAATATC
ATCGATATTTATAAATTCAGACAGCAGAAGAAGCAGCGATCAGGGTTATA
ATTGCGTGATTATATTGTGTAATTT
back to top

protein sequence of SMED30017552-orf-1

>SMED30017552-orf-1 ID=SMED30017552-orf-1|Name=SMED30017552-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=729bp
MAENKVSNPDKILKAEERIKSNPWDIEAWNVLLRDAQSTSIEEGRPIFER
LVHQFPLTGQYVKSYISQEKKAKAFENVEKLFKEYLPRIYHIDLWKFYLS
YIKDKDNKTPSFKERMAQAYDYAVDKMGLDLKSFPIWSDYINFLKSTQVK
SQYAESQKTIATRRIYHRAIVTPMVGIETIWRDYNAFETSINSVIAKKFI
EERSRDYMNARRVAKEYEAITKGLNRNLPSVPPQNTVEEIKQVELWKKYI
QWEKDNPLKTEDLITITKRTLFAYEQCLLCLGHHPDIWYEAATYLEHASK
LLAEKGDQENSKKFADKVAEMYQRATVILRENLLLHFAYADYEESRSKFE
KVEAIYKNLISYDHIDPTLVYIQHSRFIRRSKGIVAAREVFKLAREDPRT
SYQVYINAAMMEHYCTKDPKVAQKIFELGLKRYMKVPEFVLAYVDYMNHL
NEDNNTRVLFERALGSGYMPPEKSRIIWDKFLQFESHVGDLASILKVERR
RLQALEGLKEFQSHETALLIDRYKFMELFPCSDAELKSIGYRDISRQISS
QIATSVPELGSNLDNNADGPGGYLRPDYCQMLPFKPKAYPRTGSHPVAGG
EFPPPPAASSLLRLLPPPECFHGPFVQVAKFMEHFLELKIPEEYANPPVD
ENMIIDSGTALSIEMAANAQLMRKRRRISINENNRDSDDEMGNNLSTSIG
GIPTIQSAEGNIIDIYKFRQQKKQRSGL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003107HAT
IPR008847Suf
IPR011990TPR-like_helical_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
GO:0006397mRNA processing
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003107HAT (Half-A-TPR) repeatSMARTSM00386hat_new_1coord: 313..345
e-value: 21.0
score: 13.0
coord: 111..146
e-value: 5.9
score: 15.9
coord: 265..297
e-value: 41.0
score: 10.9
coord: 382..414
e-value: 49.0
score: 10.4
coord: 73..104
e-value: 85.0
score: 8.6
coord: 157..190
e-value: 53.0
score: 10.1
coord: 417..449
e-value: 5.1
score: 16.1
coord: 215..255
e-value: 3.9
score: 16.4
coord: 347..380
e-value: 810.0
score: 1.4
coord: 451..487
e-value: 20.0
score: 13.2
coord: 39..71
e-value: 44.0
score: 10.7
IPR008847Suppressor of forkedPFAMPF05843Sufcoord: 368..641
e-value: 1.9E-67
score: 228.3
NoneNo IPR availableGENE3DG3DSA:1.25.40.1040coord: 7..539
e-value: 1.8E-174
score: 583.4
NoneNo IPR availablePANTHERPTHR19980RNA CLEAVAGE STIMULATION FACTORcoord: 8..723
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 15..544