Parathyroid hormone receptor 1

Overview
NameParathyroid hormone receptor 1
Smed IDSMED30017522
Length (bp)1437
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Parathyroid hormone receptor 1 (SMED30017522) t-SNE clustered cells

Violin plots show distribution of expression levels for Parathyroid hormone receptor 1 (SMED30017522) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Parathyroid hormone receptor 1 (SMED30017522) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Parathyroid hormone receptor 1 (SMED30017522) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017522

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017522SMESG000076892.1 SmedASXL_012617SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30017522SMESG000076892.1 dd_Smed_v4_13332_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017522SMESG000076892.1 dd_Smed_v6_13332_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30017522SMESG000076892.1 SMED30017522smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Human
Match: PTH2R (parathyroid hormone 2 receptor [Source:HGNC Symbol;Acc:HGNC:9609])

HSP 1 Score: 181.415 bits (459), Expect = 2.679e-50
Identity = 132/445 (29.66%), Postives = 219/445 (49.21%), Query Frame = 1
Query:   34 FAMRLFVWILLTFIWCPFLQGKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ------STNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCF---------------SLFSQLQTNNETNTF------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWD--AGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM-----VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHN-NKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKR 1242
                L VW  L    C  L  ++    +  I  + Q  L+ KA+  C   I+    A+L      C P WDG++CW      GK ++ PCP YI  F  KG  ++ C  NG W    +  K W ++ +C +      S  K+     +  +  +G+ IS  S+ + I I+ +F+ LHC RN IH++LFV+ +LR+                  L S +  ++  N+             CK+ + M  Y +  N+ W+ VE LYLHN++ +  F +T   ++ +IL+GWG P   +  W + R    +  CW+  AGD +     W+ +  P+L  I  N I F+  + +L  K+     V H    ++ ++RKLA+S LVL++VFG++ ++FV L      H+   + ++I+M  E   NS QGF +++++C+CN EV  E+K+
Sbjct:    4 LGASLHVWGWLMLGSC--LLARAQLDSDGTITIEEQIVLVLKAKVQCELNIT----AQLQEGEGNCFPEWDGLICW-PRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLYVMYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHMHLFVSFMLRATSIFVKDRVVHAHIGVKELESLIMQDDPQNSIEATSVDKSQYIGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVAFFSDTK-YLWGFILIGWGFPAAFVAAWAVARATLADARCWELSAGDIK-----WI-YQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHD---TRKQYRKLAKSTLVLVLVFGVHYIVFVCLP-----HSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYCNGEVQAEVKK 426          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 177.563 bits (449), Expect = 3.907e-49
Identity = 111/376 (29.52%), Postives = 189/376 (50.27%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ----STNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF--------------SQLQTNNETNTF----------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            C P WD ++CW      G+  + PCP YI  F  KG  Y+RC  NG W       + W ++ EC +     T +      +  I  +G+ +S+ S+ + + IL +F+ LHC RN IH++LF++ +LR+  S+F              ++  T  E                    C+V ++   Y +  N+ W+ VE LYLH+++ +  F E    ++ + + GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    +   +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +
Sbjct:  108 CLPEWDHILCW-PLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAV-SIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGN---KKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEV---SGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSW 474          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 177.178 bits (448), Expect = 1.636e-48
Identity = 111/376 (29.52%), Postives = 188/376 (50.00%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF--------------SQLQTNNETNTF----------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            C P WD ++CW      G+  + PCP YI  F  KG  Y+RC  NG W       + W ++ EC       T +      +  I  +G+ +S+ S+ + + IL +F+ LHC RN IH++LF++ +LR+  S+F              ++  T  E                    C+V ++   Y +  N+ W+ VE LYLH+++ +  F E    ++ + + GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    +   +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +
Sbjct:  108 CLPEWDHILCW-PLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAV-SIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGN---KKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEV---SGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSW 474          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 177.178 bits (448), Expect = 1.636e-48
Identity = 111/376 (29.52%), Postives = 188/376 (50.00%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF--------------SQLQTNNETNTF----------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            C P WD ++CW      G+  + PCP YI  F  KG  Y+RC  NG W       + W ++ EC       T +      +  I  +G+ +S+ S+ + + IL +F+ LHC RN IH++LF++ +LR+  S+F              ++  T  E                    C+V ++   Y +  N+ W+ VE LYLH+++ +  F E    ++ + + GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    +   +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +
Sbjct:  108 CLPEWDHILCW-PLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAV-SIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGN---KKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEV---SGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSW 474          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Human
Match: PTH1R (parathyroid hormone 1 receptor [Source:HGNC Symbol;Acc:HGNC:9608])

HSP 1 Score: 177.178 bits (448), Expect = 1.636e-48
Identity = 111/376 (29.52%), Postives = 188/376 (50.00%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF--------------SQLQTNNETNTF----------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            C P WD ++CW      G+  + PCP YI  F  KG  Y+RC  NG W       + W ++ EC       T +      +  I  +G+ +S+ S+ + + IL +F+ LHC RN IH++LF++ +LR+  S+F              ++  T  E                    C+V ++   Y +  N+ W+ VE LYLH+++ +  F E    ++ + + GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    +   +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +
Sbjct:  108 CLPEWDHILCW-PLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAV-SIFVKDAVLYSGATLDEAERLTEEELRAIAQAPPPPATAAAGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTVFGWGLPAVFVAVWVSVRATLANTGCWDLSSGN---KKWIIQVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEV---SGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSW 474          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Celegans
Match: seb-3 (SEcretin/class B GPCR; Secretin receptor-like protein SEB-3 [Source:UniProtKB/TrEMBL;Acc:G5EBF7])

HSP 1 Score: 90.8929 bits (224), Expect = 2.120e-19
Identity = 89/378 (23.54%), Postives = 170/378 (44.97%), Query Frame = 1
Query:  211 SLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYI-------DKFIRKGKVYKRCTVNGEWFRRANST---KPWTDFGECKQSTNKE-PALF--FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLR-SCFSLFSQLQTNN--------------ETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFD----NTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            S N   C   +D  +CW      G+  ++ CP          ++   +  V + C   G W + +N T   K   ++ +C Q   +  P +    V+++S    F+S+  ++  I +   F ++ C R +IH NL  A + R +  ++++ +QT N              +    CK  +    Y  +A+  W+ +E  +L++  T+   + +     LY+  GWG+P + +  W ++         N++CW        L +W+L       LI N+IF + ++VIL  K+ T     S+  +R + ++ L+L+ + GI     +PL   E  H + V     M    ++  +QG  +A+++CF NSE+   +KR+ 
Sbjct:   22 SYNPGGCSVDFDKSLCW-ASAHIGQQMTRDCPFTFCTAIPGCEEIKDRYMVSRNCNSMGVW-QDSNYTMCIKVVEEYAQCLQGFCRVCPDVLRDLVISVSLTLSFVSVILLVAAIVLFSIFDSIQCRRLSIHKNLATAFVFRFAVLAIWTIVQTTNVFQDCTRLTPLPLWDYEWICKAILWFVIYFNVASVMWMLIEGAFLYSRFTVFAMRHSDAPWSLYLACGWGVPFVVVTAWALVHQYISSQQTNSFCWLPYAQ--GLHLWILAGTMGSALIMNLIFLLMIVVILVQKLRTENSAESKKIWRTI-KATLLLVPLLGISN---IPL-FYEPEHPSSV----YMLGSAILQHSQGIFIAVLYCFLNSEIQGALKRQL 386          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Celegans
Match: seb-2 (G-protein coupled receptor seb-2 [Source:UniProtKB/Swiss-Prot;Acc:P30650])

HSP 1 Score: 89.7373 bits (221), Expect = 6.548e-19
Identity = 99/408 (24.26%), Postives = 184/408 (45.10%), Query Frame = 1
Query:  214 LNTSFCRPVWDGVVCWYGYFQSGKTAS--QPCPHYIDKFIRKGKVYKR-----CTVNGEWFRRANST-KPWTDFGECKQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTI-HINLFVACLLRSCFSLF--SQLQTNN--------ETNTFCKVFMSMH-NYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFL-YILVGWGXXXXXXXXXXXXXXVFDNT-YCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSL--QTTDEVKIRENSYRKRRGNRDSLKQTDHQV 1365
            ++ S C P WDG  C    F S       + CP+YI         Y R     C  NG      N+  +  TD+  C  + + E  +   +    + +  S+  ++  +F+L   + + C    I H +L ++CLL   F L   S    N+        + + FC++  S+   YL + NFTW+  EA+YL  +L  HT + + G     Y ++ WG+P +  +++I +R + D+   CW   +S +    W++ + P LL +   +  + LIV +  K +       + ++RK  R  L+L+ VFG+ QL+ +          +   +Q+    +  +N  QG  ++ + C+ N  V++ + + + +H+  R+L  +    + I+E+     R       QT+H V
Sbjct:  141 VDDSPCPPTWDGWNC----FDSATPGVVFKQCPNYIYGGSNIKTDYDRLSQKVCRSNGWATPEVNAAAREHTDYTGCMSNGDVEARILAGL----LTYSASVIFLIPAVFLLTLLRPIRCQPMFILHRHLLISCLLYGAFYLITVSLFVVNDAPLSSQVFQNHLFCRLLFSIQLRYLRLTNFTWMLAEAVYLWRLL--HTAQHSEGETLRSYKVICWGVPGVITVVYIFVRSLNDDVGMCW-IENSTVAWIEWMI-ITPSLLAMGVNLLLLGLIVYILVKKLRCDPHLERIQYRKAVRGALMLIPVFGVQQLLTI-------YRFSNTYYQV---TDQSLNGLQGMFVSFIVCYTNRSVVECVLKFWSSHQEKRALGAECRQRMSIQESGKLILRP-----PQTEHVV 521          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 80.4925 bits (197), Expect = 5.545e-16
Identity = 89/388 (22.94%), Postives = 162/388 (41.75%), Query Frame = 1
Query:  226 FCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWF-RRANSTKP----WTDFGEC--------KQSTNKEPALFFVVTISN------IGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF-----------------SQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXV---FDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLI----FVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHR 1260
            +C   +D V+CW     +     Q CPH +        + K C V+G W  R A    P    WT+F  C         Q+ N E          N      +G  +S+ S++L I I  +F+ L   RN +H++L +A L+     L                  ++ +T N     C+       Y     F W+F+E +YL+N +    F  +   +  Y + G+G+PL+  ++W+++ L+   F    C   G   +  + W+L    +  L+ N+ F   +I +L++K V      S+   +K  ++ ++L+ + G+  ++    F P        +N + F +           QG ++A ++CF N EV   +K  +  +R
Sbjct:   73 WCNATYDTVLCWPPTPANSSVTLQ-CPH-MKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFN-SEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCL--GSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSK-VRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAP------TRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYR 448          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 80.4925 bits (197), Expect = 5.545e-16
Identity = 89/388 (22.94%), Postives = 162/388 (41.75%), Query Frame = 1
Query:  226 FCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWF-RRANSTKP----WTDFGEC--------KQSTNKEPALFFVVTISN------IGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF-----------------SQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXV---FDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLI----FVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHR 1260
            +C   +D V+CW     +     Q CPH +        + K C V+G W  R A    P    WT+F  C         Q+ N E          N      +G  +S+ S++L I I  +F+ L   RN +H++L +A L+     L                  ++ +T N     C+       Y     F W+F+E +YL+N +    F  +   +  Y + G+G+PL+  ++W+++ L+   F    C   G   +  + W+L    +  L+ N+ F   +I +L++K V      S+   +K  ++ ++L+ + G+  ++    F P        +N + F +           QG ++A ++CF N EV   +K  +  +R
Sbjct:   73 WCNATYDTVLCWPPTPANSSVTLQ-CPH-MKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFN-SEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCL--GSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSK-VRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAP------TRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYR 448          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 80.4925 bits (197), Expect = 6.349e-16
Identity = 89/388 (22.94%), Postives = 162/388 (41.75%), Query Frame = 1
Query:  226 FCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWF-RRANSTKP----WTDFGEC--------KQSTNKEPALFFVVTISN------IGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF-----------------SQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXV---FDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLI----FVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHR 1260
            +C   +D V+CW     +     Q CPH +        + K C V+G W  R A    P    WT+F  C         Q+ N E          N      +G  +S+ S++L I I  +F+ L   RN +H++L +A L+     L                  ++ +T N     C+       Y     F W+F+E +YL+N +    F  +   +  Y + G+G+PL+  ++W+++ L+   F    C   G   +  + W+L    +  L+ N+ F   +I +L++K V      S+   +K  ++ ++L+ + G+  ++    F P        +N + F +           QG ++A ++CF N EV   +K  +  +R
Sbjct:   73 WCNATYDTVLCWPPTPANSSVTLQ-CPH-MKGLDPNKNITKDCHVSGVWSGRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFN-SEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCL--GSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSK-VRESNNTSEAGLKKSVKAAMMLLPLLGVPNIMQTIPFAP------TRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYR 448          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0087936)

HSP 1 Score: 127.487 bits (319), Expect = 1.190e-31
Identity = 112/399 (28.07%), Postives = 188/399 (47.12%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANST-KPWTDFGECKQSTNK-------EPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRS---CFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXV---FDNTY-------CWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKR---RGNRDSLKQT 1353
            C   +D V+CW     +G  A  PC    ++F  KG V+   T N   F   N T   ++D+  C Q++          P +     I   G+F+S  ++++ + I   FK+L C RNTIH NLF+  +  +     +LF Q+ T   +   C   + M  Y  + NF W+FVE LYL+  L + TF   +    +Y L+GWG P + I++W I +      +N +       C    +S I    W+  V   L L+ N++F I+++ +L  K+ +   T    ++ K ++++LVL+ +FGI  L      L+       ++  +       + S QGF +A+ +CF NSEV + ++  F   R SR++     +K R +   K    R   +SL+ T
Sbjct:   84 CPSSFDSVLCW-PRTNAGSLAVLPC---FEEF--KG-VHYDTTDNATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYT-LVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHID---WIFKVPASLALLVNLVFLIRIMWVLITKLRSAH-TLETRQYYKASKALLVLIPLFGITYL------LVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRNIHRNSSIKNRRHRASKDYSLRSRTESLRLT 464          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0113075)

HSP 1 Score: 124.79 bits (312), Expect = 1.097e-30
Identity = 107/381 (28.08%), Postives = 180/381 (47.24%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANST-KPWTDFGECKQSTNK-------EPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRS---CFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXV---FDNTY-------CWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIREN 1308
            C   +D V+CW     +G  A  PC    ++F  KG V+   T N   F   N T   ++D+  C Q++          P +     I   G+F+S  ++++ + I   FK+L C RNTIH NLF+  +  +     +LF Q+ T   +   C   + M  Y  + NF W+FVE LYL+  L + TF   +    +Y L+GWG P + I++W I +      +N +       C    +S I    W+  V   L L+ N++F I+++ +L  K+ +   T    ++ K ++++LVL+ +FGI  L      L+       ++  +       + S QGF +A+ +CF NSEV + ++  F   R SR++     +K R  
Sbjct:   84 CPSSFDSVLCW-PRTNAGSLAVLPC---FEEF--KG-VHYDTTDNATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYT-LVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHID---WIFKVPASLALLVNLVFLIRIMWVLITKLRSAH-TLETRQYYKASKALLVLIPLFGITYL------LVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRNIHRNSSIKNRST 446          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0070436)

HSP 1 Score: 120.168 bits (300), Expect = 1.385e-28
Identity = 101/390 (25.90%), Postives = 183/390 (46.92%), Query Frame = 1
Query:  166 ENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTK----PWTDFGEC---------KQSTNKEPALFFVV-----TISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSL---FSQLQTNNE---TNT----------FCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDA-GDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLI--FVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEV 1224
            ENC++   N+++ +  L   +C   WD ++CW     +G  A   CP        +    ++C ++G W  R N+T+     WTD+G C         +Q  +K+   +  +     T+  +G  +S+ ++++ + I   F++L  +R  IH NLFVA +L+    L     Q +  N+   TNT           C+    +  Y   A F W+F+E LYLHN++T+  F+ +  + F   L GW +P++   +W    +++ +T   +   +  +T   W+L    + +++ N  F + +I +L  K+   Q  +   + RK  R+ +VL+ + GI  L+    PL    N       F +     H + S QGF +A+++CF N EV
Sbjct:  129 ENCSALFVNYTLPQTGL---YCNWTWDTLLCWPPT-PAGVLARMNCPGGFHGVDTRKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRL-GWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQ-ASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATN-------FAVWSYGTHFLTSFQGFFIALIYCFLNGEV 505          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0340084)

HSP 1 Score: 119.783 bits (299), Expect = 1.893e-28
Identity = 105/393 (26.72%), Postives = 188/393 (47.84%), Query Frame = 1
Query:  166 ENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCP---HYIDKFIRKGKVYKRCTVNGEWFRRANSTK----PWTDFGEC---------KQSTNKEPALFFVV-----TISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSL---FSQLQTNNE---TNT----------FCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDA-GDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLI--FVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEV 1224
            ENC++   N+++ +  L   +C   WD ++CW     +G  A   CP   H +D   RK  + ++C ++G W  R N+T+     WTD+G C         +Q  +K+   +  +     T+  +G  +S+ ++++ + I   F++L  +R  IH NLFVA +L+    L     Q +  N+   TNT           C+    +  Y   A F W+F+E LYLHN++T+  F+ +  + F   L GW +P++   +W    +++ +T   +   +  +T   W+L    + +++ N  F + +I +L  K+   Q  +   + RK  R+ +VL+ + GI  L+    PL    N       F +     H + S QGF +A+++CF N EV
Sbjct:  129 ENCSALFVNYTLPQTGL---YCNWTWDTLLCWPPT-PAGVLARMNCPGGFHGVD--TRKFAI-RKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRL-GWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQ-ASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATN-------FAVWSYGTHFLTSFQGFFIALIYCFLNGEV 505          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0340085)

HSP 1 Score: 119.783 bits (299), Expect = 1.893e-28
Identity = 105/393 (26.72%), Postives = 188/393 (47.84%), Query Frame = 1
Query:  166 ENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCP---HYIDKFIRKGKVYKRCTVNGEWFRRANSTK----PWTDFGEC---------KQSTNKEPALFFVV-----TISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSL---FSQLQTNNE---TNT----------FCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDA-GDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLI--FVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEV 1224
            ENC++   N+++ +  L   +C   WD ++CW     +G  A   CP   H +D   RK  + ++C ++G W  R N+T+     WTD+G C         +Q  +K+   +  +     T+  +G  +S+ ++++ + I   F++L  +R  IH NLFVA +L+    L     Q +  N+   TNT           C+    +  Y   A F W+F+E LYLHN++T+  F+ +  + F   L GW +P++   +W    +++ +T   +   +  +T   W+L    + +++ N  F + +I +L  K+   Q  +   + RK  R+ +VL+ + GI  L+    PL    N       F +     H + S QGF +A+++CF N EV
Sbjct:  129 ENCSALFVNYTLPQTGL---YCNWTWDTLLCWPPT-PAGVLARMNCPGGFHGVD--TRKFAI-RKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRL-GWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQ-ASDIEQTRKAVRAAIVLLPLLGITNLLHQLAPLKTATN-------FAVWSYGTHFLTSFQGFFIALIYCFLNGEV 505          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 198.749 bits (504), Expect = 2.652e-57
Identity = 133/428 (31.07%), Postives = 220/428 (51.40%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ-----STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF---------SQLQ------------------TNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENS 1311
            + Q  LL  A+  C   I     +K   +   C P WDG++CW      GK  S  CP YI  F  KG  Y+RC +NG W   +++ K W ++ EC +     + N+E  +F  +  I  +G+ IS+ S+++   IL +F+ LHC RN IH++LF++ +LR+  S+F         S LQ                   N      CKV +++  Y +  N+ W+ VE LYLH+++ + TF      ++ + L+GWG+P + + IW  +R    +T CWD     +    W++ +  +  ++ N + F+ +I +L  K+         ++ ++RKL +S LVLM +FG++ ++F+ +   E    + V +QI+M  E L NS QGF +A+++CFCN EV  EIK+ +    N R+L    + K R  S
Sbjct:   10 EEQIYLLFNAKRKCERAIK----SKHKTSEGSCLPEWDGILCWPEGV-PGKMVSTSCPEYIYDFNHKGHAYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRA-ISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLADTECWDLSAGNLK---WIVQIPILTAIVVNFLLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEV---SGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIKKAW----NRRTLALDFKRKARSGS 420          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 198.749 bits (504), Expect = 4.809e-57
Identity = 138/457 (30.20%), Postives = 231/457 (50.55%), Query Frame = 1
Query:   46 LFVWILLTFIWCPFLQGKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ-----STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF---------SQLQ------------------TNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENS 1311
            LF   LL+F++        +   +  +  + Q  LL  A+  C   I     +K   +   C P WDG++CW      GK  S  CP YI  F  KG  Y+RC +NG W   +++ K W ++ EC +     + N+E  +F  +  I  +G+ IS+ S+++   IL +F+ LHC RN IH++LF++ +LR+  S+F         S LQ                   N      CKV +++  Y +  N+ W+ VE LYLH+++ + TF      ++ + L+GWG+P + + IW  +R    +T CWD     +    W++ +  +  ++ N + F+ +I +L  K+         ++ ++RKL +S LVLM +FG++ ++F+ +   E    + V +QI+M  E L NS QGF +A+++CFCN EV  EIK+ +    N R+L    + K R  S
Sbjct:   13 LFCGTLLSFVY-------GLVDADDVLTKEEQIYLLFNAKRKCERAIK----SKHKTSEGSCLPEWDGILCWPEGV-PGKMVSTSCPEYIYDFNHKGHAYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRA-ISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLADTECWDLSAGNLK---WIVQIPILTAIVVNFLLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEV---SGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIKKAW----NRRTLALDFKRKARSGS 445          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Zebrafish
Match: pth2ra (parathyroid hormone 2 receptor a [Source:ZFIN;Acc:ZDB-GENE-991123-10])

HSP 1 Score: 193.356 bits (490), Expect = 9.690e-55
Identity = 127/408 (31.13%), Postives = 209/408 (51.23%), Query Frame = 1
Query:  121 KIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQST--NKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC--------------FSLFSQLQTNNETNTF------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHN-NKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKR 1242
            +I  + Q  +L  A+  C  K+S+   A        C P WDG++CW   F  G     PCP YI  F      Y+RC  NG W    +S K W ++ EC +S   NK+  +FF  +  +  +G+ +S +S+L+ IFI+ +F+ LHC RN IH++LFV+ +LR+                  F  +  NN TN              CKV + +  Y +  N+ W+ VE LYLH+++ +  F   S  ++ + L+GWG+P + +  W ++R    +  CW+     I    W+  V P+L  I  N I F+ ++ +L  K+         ++ ++RKLA+S LVL+ VFG++ ++FV +      H    + ++++M  E   NS QGF +++++C+CN EV  EIK+
Sbjct:   62 EITAEEQVQMLLDAKLQCLQKVSSDDPA-----VGVCVPEWDGLICWPQGF-PGTLTKTPCPGYIYDFNHAAHAYRRCDSNGSWVLAESSNKTWVNYTECIKSPEPNKKRQVFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAASIFVKDHVVHTSAGLQEFDAVLMNNFTNAVDVAPVDTSQYMGCKVTVLLFIYFLATNYYWILVEGLYLHSLIFM-AFLSDSKYLWGFTLIGWGVPAVFVAAWAVVRATLADARCWELSAGNIK---WIYQV-PILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVFVFGVHYIVFVGMP-----HTFEGLGWEVRMYCELFFNSFQGFFVSIIYCYCNGEVQTEIKK 453          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Zebrafish
Match: pth2ra (parathyroid hormone 2 receptor a [Source:ZFIN;Acc:ZDB-GENE-991123-10])

HSP 1 Score: 193.356 bits (490), Expect = 9.690e-55
Identity = 127/408 (31.13%), Postives = 209/408 (51.23%), Query Frame = 1
Query:  121 KIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQST--NKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC--------------FSLFSQLQTNNETNTF------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHN-NKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKR 1242
            +I  + Q  +L  A+  C  K+S+   A        C P WDG++CW   F  G     PCP YI  F      Y+RC  NG W    +S K W ++ EC +S   NK+  +FF  +  +  +G+ +S +S+L+ IFI+ +F+ LHC RN IH++LFV+ +LR+                  F  +  NN TN              CKV + +  Y +  N+ W+ VE LYLH+++ +  F   S  ++ + L+GWG+P + +  W ++R    +  CW+     I    W+  V P+L  I  N I F+ ++ +L  K+         ++ ++RKLA+S LVL+ VFG++ ++FV +      H    + ++++M  E   NS QGF +++++C+CN EV  EIK+
Sbjct:   62 EITAEEQVQMLLDAKLQCLQKVSSDDPA-----VGVCVPEWDGLICWPQGF-PGTLTKTPCPGYIYDFNHAAHAYRRCDSNGSWVLAESSNKTWVNYTECIKSPEPNKKRQVFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRAASIFVKDHVVHTSAGLQEFDAVLMNNFTNAVDVAPVDTSQYMGCKVTVLLFIYFLATNYYWILVEGLYLHSLIFM-AFLSDSKYLWGFTLIGWGVPAVFVAAWAVVRATLADARCWELSAGNIK---WIYQV-PILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVFVFGVHYIVFVGMP-----HTFEGLGWEVRMYCELFFNSFQGFFVSIIYCYCNGEVQTEIKK 453          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Zebrafish
Match: pth2rb (parathyroid hormone 2 receptor b [Source:ZFIN;Acc:ZDB-GENE-050208-334])

HSP 1 Score: 179.874 bits (455), Expect = 1.285e-49
Identity = 130/439 (29.61%), Postives = 218/439 (49.66%), Query Frame = 1
Query:   52 VWILLTFIWCPFLQGKSIR----KLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF----------------SQLQTN---------NETNTF-CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHN-NKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            +WI+L +I    L G S+       E  +    Q  LL   +  C   IS  + A        C P WDG+VCW      G     PCP Y+  F   G  Y++C+ NG W    N T  W ++ +C         K    FF  +  +  +G+ +S +S+L+ IFI+ +F+ LHC RN IH++LFV+ +LR+  S+F                + L  N         ++T  F CK+ +    Y +  N+ W+ VE LYLH+++ +  F + S  ++ + L+GWG+P + +  W ++R    +  CW+     I    W+  V P+L  I  N I F+ ++ +L  K+         ++ ++RKLA+S LVL++VFG++ ++FV +      H    + ++++M  E   NS QGF +++++CFCN EV  EI++ +
Sbjct:    1 MWIILVWISVQVLLGTSVEAQHVDPEVGLTAQEQVLLLYDIKLQCLQNISEHNPAD-----EVCSPGWDGLVCW-PQGSPGTVTKVPCPSYVYDFNHNGFAYRQCSSNGSWVSVENRT--WVNYSDCLRFLAPGIEKGKRDFFERLHIMYTVGYAVSFSSLLVAIFIIGYFRRLHCTRNYIHMHLFVSFMLRA-ISIFVKDRVVYANGVLQEYDTMLMDNISTVSISPLDKTQYFGCKITVLFFIYFLATNYYWILVEGLYLHSLIFMAFFSD-SKYLWGFTLIGWGVPALFVSTWAVVRATLADARCWELSAGNIK---WIYQV-PILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMP-----HTFTGLGWELRMYCELFFNSFQGFFVSIIYCFCNGEVQAEIRKTW 420          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 187.963 bits (476), Expect = 1.055e-52
Identity = 128/428 (29.91%), Postives = 211/428 (49.30%), Query Frame = 1
Query:  130 HDSQETLLRKAQENCNSKISNFSIAKLS----LNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ---STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRS-----------CFSLFSQLQTNNETN---------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFEN-------HRNSRSLQTT 1284
            H +Q  L+ K  EN   +    ++ +      L    C P WDGVVCW      G T S  CP YI  F  KG  Y+RC +NG W     + + W ++ EC +   +  KE  +F  +  I  +G+ IS+ S+ + + IL +F+ LHC RN IH++LF++ +LR+             S   + +  +E +                 CKV ++   Y +  N+ W+ VE LYLH+++ +  F      ++ + L GWG+P I ++IW   R    +T CWD     +    W++ V  +  ++ N   FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    + + +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +          R +RS  TT
Sbjct:   47 HGNQWCLISKQGENKKGREEIDALPQGPQPFLLRNGLCLPEWDGVVCWPEGL-PGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGNNRTWANYTECAKYLFNETKEREVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFM-AFISDKKYLWGFTLFGWGVPAIFVLIWARERATVADTGCWDLSAGYLK---WIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTE---VSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSTT 466          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 187.193 bits (474), Expect = 1.410e-52
Identity = 130/426 (30.52%), Postives = 213/426 (50.00%), Query Frame = 1
Query:  124 IEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ---STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRS-----------CFSLFSQLQTNNETN---------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFEN-------HRNSRSLQTT 1284
            I  + Q  LL  A+  C   +S+ S +K   +   C P WDGVVCW      G T S  CP YI  F  KG  Y+RC +NG W     + + W ++ EC +   +  KE  +F  +  I  +G+ IS+ S+ + + IL +F+ LHC RN IH++LF++ +LR+             S   + +  +E +                 CKV ++   Y +  N+ W+ VE LYLH+++ +  F      ++ + L GWG+P I ++IW   R    +T CWD     +    W++ V  +  ++ N   FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    + + +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +          R +RS  TT
Sbjct:   33 ITKEEQILLLWNAKALCEKLLSS-SASKA--HDGLCLPEWDGVVCWPEGL-PGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGNNRTWANYTECAKYLFNETKEREVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFM-AFISDKKYLWGFTLFGWGVPAIFVLIWARERATVADTGCWDLSAGYLK---WIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTE---VSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSTT 447          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 186.808 bits (473), Expect = 1.642e-52
Identity = 129/434 (29.72%), Postives = 213/434 (49.08%), Query Frame = 1
Query:  124 IEHDSQETLLRKAQENCNSKISNFSIAKLSLN--------TSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ---STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRS-----------CFSLFSQLQTNNETN---------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFEN-------HRNSRSLQTT 1284
            I  + Q  LL  A+  C   +S+ +    ++N           C P WDGVVCW      G T S  CP YI  F  KG  Y+RC +NG W     + + W ++ EC +   +  KE  +F  +  I  +G+ IS+ S+ + + IL +F+ LHC RN IH++LF++ +LR+             S   + +  +E +                 CKV ++   Y +  N+ W+ VE LYLH+++ +  F      ++ + L GWG+P I ++IW   R    +T CWD     +    W++ V  +  ++ N   FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    + + +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +          R +RS  TT
Sbjct:   14 ITKEEQILLLWNAKALCEKLLSSSASKAHAINKLLNLPFADGLCLPEWDGVVCWPEGL-PGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGNNRTWANYTECAKYLFNETKEREVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFM-AFISDKKYLWGFTLFGWGVPAIFVLIWARERATVADTGCWDLSAGYLK---WIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTE---VSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSTT 439          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 186.808 bits (473), Expect = 2.298e-52
Identity = 129/434 (29.72%), Postives = 213/434 (49.08%), Query Frame = 1
Query:  124 IEHDSQETLLRKAQENCNSKISNFSIAKLSLN--------TSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ---STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRS-----------CFSLFSQLQTNNETN---------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFEN-------HRNSRSLQTT 1284
            I  + Q  LL  A+  C   +S+ +    ++N           C P WDGVVCW      G T S  CP YI  F  KG  Y+RC +NG W     + + W ++ EC +   +  KE  +F  +  I  +G+ IS+ S+ + + IL +F+ LHC RN IH++LF++ +LR+             S   + +  +E +                 CKV ++   Y +  N+ W+ VE LYLH+++ +  F      ++ + L GWG+P I ++IW   R    +T CWD     +    W++ V  +  ++ N   FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    + + +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +          R +RS  TT
Sbjct:   31 ITKEEQILLLWNAKALCEKLLSSSASKAHAINKLLNLPFADGLCLPEWDGVVCWPEGL-PGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGNNRTWANYTECAKYLFNETKEREVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFM-AFISDKKYLWGFTLFGWGVPAIFVLIWARERATVADTGCWDLSAGYLK---WIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTE---VSGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSTT 456          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Xenopus
Match: ccdc22 (coiled-coil domain containing 22 [Source:Xenbase;Acc:XB-GENE-979496])

HSP 1 Score: 186.037 bits (471), Expect = 3.649e-52
Identity = 129/426 (30.28%), Postives = 209/426 (49.06%), Query Frame = 1
Query:  124 IEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ---STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRS-----------CFSLFSQLQTNNETN---------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFEN-------HRNSRSLQTT 1284
            I  + Q  LL  A+  C          KL  +   C P WDGVVCW      G T S  CP YI  F  KG  Y+RC +NG W     + + W ++ EC +   +  KE  +F  +  I  +G+ IS+ S+ + + IL +F+ LHC RN IH++LF++ +LR+             S   + +  +E +                 CKV ++   Y +  N+ W+ VE LYLH+++ +  F      ++ + L GWG+P I ++IW   R    +T CWD     +    W++ V  +  ++ N   FI ++ +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    + + +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +          R +RS  TT
Sbjct:   44 ITKEEQILLLWNAKALCE---------KLLSSNGLCLPEWDGVVCWPEGL-PGNTVSISCPEYIQDFNHKGHAYRRCDMNGSWELVPGNNRTWANYTECAKYLFNETKEREVFDRLYLIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFISFMLRAGSIFVKDAVLYSGSALEETELISEEDLKFITEIPPADKMQFVGCKVVVTFFLYFLATNYYWILVEGLYLHSLIFM-AFISDKKYLWGFTLFGWGVPAIFVLIWARERATVADTGCWDLSAGYLK---WIVQVPILAAIMVNFGLFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAFPYTEV---SGILWQVQMHYELLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSTT 452          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Mouse
Match: Pth2r (parathyroid hormone 2 receptor [Source:MGI Symbol;Acc:MGI:2180917])

HSP 1 Score: 183.726 bits (465), Expect = 2.226e-51
Identity = 126/410 (30.73%), Postives = 208/410 (50.73%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC--KQSTNKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF---------------SQLQTNNETNTF-------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWD--AGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM-----VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKR 1242
            + Q  L+ KA+  C   I+    A+L      C P WDG++CW      GK ++ PCP Y+  F  KG  ++ CT NG W     S K W ++ +C  +   N     FF  +  +  +G+ IS  S+ + I I+ +F+ LHC RN IH++LFV+ +LR+  S+F                 L    +   F             CK+ + M  Y +  N+ W+ VE LYLHN++ +  F +T   ++ +I +GWG P + ++ W + R    +T CW+  AGD  I       +  P+L  I  N I F+  + +L  K+     V H +   + ++RKLA+S LVL++VFG++ ++FV     +    + + ++I+M  E   NS QGF +++++C+CN EV  E+K+
Sbjct:   35 EEQIVLVMKAKMQCELNIT----AQLQEGEGNCFPEWDGIICW-PRGTVGKMSAVPCPPYVYDFNHKGVAFRHCTPNGTWDSIHGSNKTWANYSDCFLQPDINIGKQEFFESLYILYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHLHLFVSFMLRA-MSIFVKDRVAQAHLGVEALQSLVMQGDLQNFIGGPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVSFFSDTK-YLWGFISIGWGFPAVFVVAWAVARATLADTRCWELSAGDRWI-------YQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHDM---RKQYRKLAKSTLVLVLVFGVHYIVFV----CQPHSFSGLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKK 423          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 180.259 bits (456), Expect = 9.346e-50
Identity = 112/375 (29.87%), Postives = 187/375 (49.87%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC---------FSLFSQLQTNNETN--------------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            C P WD +VCW      G+  + PCP YI  F  KG  Y+RC  NG W       + W ++ EC       T +      +  I  +G+ +S+ S+ + + IL +F+ LHC RN IH+++F++ +LR+          +S F+  +    T                       C+V ++   Y +  N+ W+ VE LYLH+++ +  F E    ++ + + GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI +I +L  K+         ++ ++RKL RS LVL+ +FG++  +F+ L   E    +   +QI+M  E L NS QGF +A+++CFCN EV  EI++ +
Sbjct:  108 CLPEWDNIVCW-PLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGH---KKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEV---SGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSW 474          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 180.259 bits (456), Expect = 9.346e-50
Identity = 112/375 (29.87%), Postives = 187/375 (49.87%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC---------FSLFSQLQTNNETN--------------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            C P WD +VCW      G+  + PCP YI  F  KG  Y+RC  NG W       + W ++ EC       T +      +  I  +G+ +S+ S+ + + IL +F+ LHC RN IH+++F++ +LR+          +S F+  +    T                       C+V ++   Y +  N+ W+ VE LYLH+++ +  F E    ++ + + GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI +I +L  K+         ++ ++RKL RS LVL+ +FG++  +F+ L   E    +   +QI+M  E L NS QGF +A+++CFCN EV  EI++ +
Sbjct:  108 CLPEWDNIVCW-PLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGH---KKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEV---SGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSW 474          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Mouse
Match: Pth1r (parathyroid hormone 1 receptor [Source:MGI Symbol;Acc:MGI:97801])

HSP 1 Score: 180.259 bits (456), Expect = 9.346e-50
Identity = 112/375 (29.87%), Postives = 187/375 (49.87%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC---------FSLFSQLQTNNETN--------------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            C P WD +VCW      G+  + PCP YI  F  KG  Y+RC  NG W       + W ++ EC       T +      +  I  +G+ +S+ S+ + + IL +F+ LHC RN IH+++F++ +LR+          +S F+  +    T                       C+V ++   Y +  N+ W+ VE LYLH+++ +  F E    ++ + + GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI +I +L  K+         ++ ++RKL RS LVL+ +FG++  +F+ L   E    +   +QI+M  E L NS QGF +A+++CFCN EV  EI++ +
Sbjct:  108 CLPEWDNIVCW-PLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGH---KKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEV---SGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSW 474          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Mouse
Match: Vipr2 (vasoactive intestinal peptide receptor 2 [Source:MGI Symbol;Acc:MGI:107166])

HSP 1 Score: 164.081 bits (414), Expect = 4.930e-45
Identity = 122/410 (29.76%), Postives = 204/410 (49.76%), Query Frame = 1
Query:  217 NTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFI-RKGKVYKRCTVNGEWFRRANSTKPWTDFGEC-----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC---------FSLFSQLQTNNETNTF--CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLL-LIQNIIFFIKLIVILHAKMVTHQLTA-SQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFE-------NHRNSRSLQTTDEVKIRENSYRKRRGNR-DSLKQTDHQV 1365
            N   C  VWD + CW      G+T + PCP     F  R G + K CT +G W      ++ + DF +       +  +K      V  I  +G+ +S+ S+  G  I+  F+ LHC RN IH+NLF++ +LR+          +S    L+ +++  ++  CK+ +    Y IMANF W+ VE LYLH +L        S     Y+L+GWG+P + I  W   RL  ++T CWD  D  I    W +   P+L+ ++ N   FI ++ IL  K+ +  +    Q+++++LA+S L+L+ +FG++ ++F    +         T+QI    E  + S QG ++A+++CF NSEV  E+KR++          R+ R    +      E++ +  RG+R  S  Q++  V
Sbjct:   47 NQRACSGVWDNITCWRPA-DVGETVTVPCPKVFSNFYSRPGNISKNCTSDG-W------SETFPDFIDACGYNDPEDESKISFYILVKAIYTLGYSVSLMSLTTGSIIICLFRKLHCTRNYIHLNLFLSFMLRAISVLVKDSVLYSSSGLLRCHDQPASWVGCKLSLVFFQYCIMANFYWLLVEGLYLHTLLV--AILPPSRCFLAYLLIGWGIPSVCIGAWTATRLSLEDTGCWDTNDHSIP---WWVIRMPILISIVVNFALFISIVRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAAFPI-----GISSTYQILF--ELCVGSFQGLVVAVLYCFLNSEVQCELKRRWRGLCLTQAGSRDYRLHSWSMSRNGSESALQIHRGSRTQSFLQSETSV 436          
BLAST of Parathyroid hormone receptor 1 vs. UniProt/SwissProt
Match: sp|P25107|PTH1R_DIDVI (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Didelphis virginiana OX=9267 GN=PTH1R PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 1.020e-55
Identity = 130/425 (30.59%), Postives = 214/425 (50.35%), Query Frame = 1
Query:  127 EHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC------FSLFSQLQTN-------NETNTF-------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFEN-------HRNSRSLQTT 1284
            +    E L  +A+E+   ++S+ S     L   FC P WD +VCW      GK  + PCP YI  F  KG+ Y+RC  NG W     + + W ++ EC       T +      +  I  +G+ IS+ S+ + + IL +F+ LHC RN IH++LFV+ +LR+         L+S + T+        E   F             C+V +++  Y +  N+ W+ VE LYLH+++ +  F E    ++ + L GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI +I +L  K+         ++ ++RKL +S LVLM +FG++ ++F+     E    + + +Q++M  E L NS QGF +A+++CFCN EV  EIK+ +          R +RS  +T
Sbjct:   77 KEKPAEKLYSQAEES--REVSDRS----RLQDGFCLPEWDNIVCWPAGV-PGKVVAVPCPDYIYDFNHKGRAYRRCDSNGSWELVPGNNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSISLGSLTVAVLILGYFRRLHCTRNYIHMHLFVSFMLRAVSIFIKDAVLYSGVSTDEIERITEEELRAFTEPPPADKAGFVGCRVAVTVFLYFLTTNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTLFGWGLPAVFVAVWVTVRATLANTECWDLSSGN---KKWIIQVPILAAIVVNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTE---VSGILWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSST 487          
BLAST of Parathyroid hormone receptor 1 vs. UniProt/SwissProt
Match: sp|P70555|PTH2R_RAT (Parathyroid hormone 2 receptor OS=Rattus norvegicus OX=10116 GN=Pth2r PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.053e-51
Identity = 126/412 (30.58%), Postives = 211/412 (51.21%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC--KQSTNKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF---------------SQLQTNNETNTF-------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWD--AGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM-----VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            + Q  L+ KA+  C   I+    A+       C P WDG++CW     +GKT++ PCP Y+  F  KG  ++ CT NG W     S K W ++ +C  +   N     FF  +  +  +G+ IS  S+ + I I+ +F+ LHC RN IH++LFV+ +LR+  S+F                 L    +   F             CK+ + M  Y +  N+ W+ VE LYLHN++ +  F +T   ++ +IL+GWG P + ++ W + R    +T CW+  AGD  I       +  P+L  I  N I F+  + +L  K+     V H +   + ++RKLA+S LVL++VFG++ ++F+     +    + + ++I+M  E   NS QGF +++++C+CN EV  E+K+ +
Sbjct:   35 EEQIVLVMKAKMQCELNIT----AQFQEGEGNCFPEWDGLICW-PRGTAGKTSAMPCPSYVYDFNHKGVAFRHCTPNGTWDFIHGSNKTWANYSDCFLQPDINIGKQEFFENLYILYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHLHLFVSFMLRA-XSIFVKDRVAQAHLGVEALQSLVMQGDLQNFIGGPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVSFFSDTK-YLWGFILIGWGFPAVFVVAWAVARATLADTRCWELSAGDRWI-------YXXPILAAIGLNFILFLNTVRVLATKIWETNAVGHDM---RKQYRKLAKSTLVLVLVFGVHYIVFI----CQPHSFSGLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKKTW 425          
BLAST of Parathyroid hormone receptor 1 vs. UniProt/SwissProt
Match: sp|Q91V95|PTH2R_MOUSE (Parathyroid hormone 2 receptor OS=Mus musculus OX=10090 GN=Pth2r PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.557e-50
Identity = 126/410 (30.73%), Postives = 208/410 (50.73%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC--KQSTNKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF---------------SQLQTNNETNTF-------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWD--AGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM-----VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKR 1242
            + Q  L+ KA+  C   I+    A+L      C P WDG++CW      GK ++ PCP Y+  F  KG  ++ CT NG W     S K W ++ +C  +   N     FF  +  +  +G+ IS  S+ + I I+ +F+ LHC RN IH++LFV+ +LR+  S+F                 L    +   F             CK+ + M  Y +  N+ W+ VE LYLHN++ +  F +T   ++ +I +GWG P + ++ W + R    +T CW+  AGD  I       +  P+L  I  N I F+  + +L  K+     V H +   + ++RKLA+S LVL++VFG++ ++FV     +    + + ++I+M  E   NS QGF +++++C+CN EV  E+K+
Sbjct:   35 EEQIVLVMKAKMQCELNIT----AQLQEGEGNCFPEWDGIICW-PRGTVGKMSAVPCPPYVYDFNHKGVAFRHCTPNGTWDSIHGSNKTWANYSDCFLQPDINIGKQEFFESLYILYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHLHLFVSFMLRA-MSIFVKDRVAQAHLGVEALQSLVMQGDLQNFIGGPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVSFFSDTK-YLWGFISIGWGFPAVFVVAWAVARATLADTRCWELSAGDRWI-------YQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHDM---RKQYRKLAKSTLVLVLVFGVHYIVFV----CQPHSFSGLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKK 423          
BLAST of Parathyroid hormone receptor 1 vs. UniProt/SwissProt
Match: sp|P49190|PTH2R_HUMAN (Parathyroid hormone 2 receptor OS=Homo sapiens OX=9606 GN=PTH2R PE=1 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.287e-49
Identity = 132/445 (29.66%), Postives = 219/445 (49.21%), Query Frame = 1
Query:   34 FAMRLFVWILLTFIWCPFLQGKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ------STNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCF---------------SLFSQLQTNNETNTF------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWD--AGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM-----VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHN-NKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKR 1242
                L VW  L    C  L  ++    +  I  + Q  L+ KA+  C   I+    A+L      C P WDG++CW      GK ++ PCP YI  F  KG  ++ C  NG W    +  K W ++ +C +      S  K+     +  +  +G+ IS  S+ + I I+ +F+ LHC RN IH++LFV+ +LR+                  L S +  ++  N+             CK+ + M  Y +  N+ W+ VE LYLHN++ +  F +T   ++ +IL+GWG P   +  W + R    +  CW+  AGD +     W+ +  P+L  I  N I F+  + +L  K+     V H    ++ ++RKLA+S LVL++VFG++ ++FV L      H+   + ++I+M  E   NS QGF +++++C+CN EV  E+K+
Sbjct:    4 LGASLHVWGWLMLGSC--LLARAQLDSDGTITIEEQIVLVLKAKVQCELNIT----AQLQEGEGNCFPEWDGLICW-PRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLYVMYTVGYSISFGSLAVAILIIGYFRRLHCTRNYIHMHLFVSFMLRATSIFVKDRVVHAHIGVKELESLIMQDDPQNSIEATSVDKSQYIGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVAFFSDTK-YLWGFILIGWGFPAAFVAAWAVARATLADARCWELSAGDIK-----WI-YQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHD---TRKQYRKLAKSTLVLVLVFGVHYIVFVCLP-----HSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYCNGEVQAEVKK 426          
BLAST of Parathyroid hormone receptor 1 vs. UniProt/SwissProt
Match: sp|P25961|PTH1R_RAT (Parathyroid hormone/parathyroid hormone-related peptide receptor OS=Rattus norvegicus OX=10116 GN=Pth1r PE=1 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 6.537e-49
Identity = 112/375 (29.87%), Postives = 187/375 (49.87%), Query Frame = 1
Query:  229 CRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC----KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC---------FSLFSQLQTNNETN--------------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            C P WD +VCW      G+  + PCP YI  F  KG  Y+RC  NG W       + W ++ EC       T +      +  I  +G+ +S+ S+ + + IL +F+ LHC RN IH+++F++ +LR+          +S F+  +    T                       C+V ++   Y +  N+ W+ VE LYLH+++ +  F E    ++ + + GWGLP + + +W+ +R    NT CWD          W++ V  +  ++ N I FI +I +L  K+         ++ ++RKL RS LVL+ +FG++  +F+ L   E    +   +QI+M  E L NS QGF +A+++CFCN EV  EI++ +
Sbjct:  108 CLPEWDNIVCW-PLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVKDAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKK-YLWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGH---KKWIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVHYTVFMALPYTEV---SGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSW 474          
BLAST of Parathyroid hormone receptor 1 vs. TrEMBL
Match: A0A3Q3DKT9 (Parathyroid hormone 1 receptor a OS=Hippocampus comes OX=109280 PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 3.542e-58
Identity = 130/443 (29.35%), Postives = 228/443 (51.47%), Query Frame = 1
Query:   88 LQGKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ-----STNKEPALFF-VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCF--------------------------SLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSY 1314
            L  + + +++  +  + Q  LL KA+  C   + +    +  L   +C P WDG+VCW     SGK  S  CP YI  F  +G+ Y+RC+ NG W   A + K W ++ EC +     + N+E  +F  +  I  +G+ +S+ S+++ + IL +F+ LHC RN IH++LFV+ +LR+                            S+     +N      CK  +++  Y +  N+ W+ VE LYLH+++ + TF      ++ + ++GWG+P + + +W  +R  F +T CWD     +    W+  V  +  ++ N + F+ +I +L  K+         ++ ++RKL +S LVLM +FG++ +IF  +   E    + + +QI+M  E L NS QGFL+A+++CFCN EV  EIK+ +   R + +L    + +   N+Y
Sbjct:    5 LTSRPLGRMDDVLTKEEQIALLFKAKRKCEGLVKS---RQGKLPDGYCSPEWDGIVCW-PEGASGKLVSTSCPDYIYDFNHRGRTYRRCSSNGTWEISAANNKTWANYSECAKFLYHYNQNQEKDVFHRLYLIYTVGYSVSLGSLIVAVLILGYFRRLHCTRNYIHMHLFVSYMLRAVSIFVKDVVLYSGSALEDVQRVTVEELKSITEAPPSNKAHFIGCKAAVTLFMYFLATNYFWILVEGLYLHSLIFM-TFFSDRKYLWGFTMIGWGVPAMFVSVWATVRATFADTECWDLSAGNLK---WIYQVPILAAVVVNFVLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIIFNAMPYTEV---SGIPWQIQMHYEMLFNSFQGFLVAIIYCFCNGEVQAEIKKSWS--RRTLALDFKRKARSGSNTY 434          
BLAST of Parathyroid hormone receptor 1 vs. TrEMBL
Match: A0A4W4HJ77 (Parathyroid hormone 1 receptor a OS=Electrophorus electricus OX=8005 PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.121e-57
Identity = 133/428 (31.07%), Postives = 218/428 (50.93%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ-----STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCF--------------------------SLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLT--ASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSY 1314
            + Q  LL  A+  C   I     ++   +  FC P WDG+VCW      G+T +  CP YI  F  KG  Y+RC VNG W   A S K W ++ EC       + N+E  +F  +  I  IG+ IS+ S+++ + IL +F+ LHC RN IH++LFV+ +LR+                            S+     TN      CKV +++  Y +  N+ W+ VE LYLH+++ +  F +    +  + ++GWG+P + + +W  +R    +T CWD     +    W++ V  +  ++ N + F+ +I +L  K+         S+ ++RKL +S LVLM +FG++ ++F+ +   E    + V +QI+M  E L NS QGF +A+++CFCN EV  EIK+ +   R S +L    + +   N+Y
Sbjct:   31 EEQIYLLVNAKRKCERTIK----SRHKTSEGFCLPEWDGIVCW-PEGAPGRTITTTCPEYIYDFNHKGNAYRRCDVNGSW-ELAVSNKTWANYSECATYLSHYNQNQEREVFDRLYLIYTIGYSISLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRAISIFVKDVVLYSGAALEEAERITVEDLKSITEAPPTNKTQFVGCKVVVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKKYLLGFTMIGWGVPAMFVTVWACVRATLADTECWDLSAGSLK---WIVQVPILTAIVVNFLLFLNIIRVLATKLRESNAGRCDSRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTE---VSGVPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWS--RRSLALDFKRKARSGSNTY 444          
BLAST of Parathyroid hormone receptor 1 vs. TrEMBL
Match: R7UVQ3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220667 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.810e-57
Identity = 128/407 (31.45%), Postives = 218/407 (53.56%), Query Frame = 1
Query:  139 QETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKE-PALFFV------VTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQ--------------------LQTNNE-TNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTH-QLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRS 1272
            QE +  KA+ +C  ++ N       +    C   WD + CW     +G  A QPCP YI+KFI      K C  +GEWF  + +   WT++ +C  + N E P+   V      + ++N+G+ +SI  +L+ + ++ +FK LHC RNT+HINLFV  +LR+  S   +                    L  N++ T+  CK+ M+++ Y++ AN TW+FVE LYLH ++ +  F E S V   YI +GW  PL+ +I W+++R   D+  CW+   ++     W++      L++ N +FF+ ++ ++  KM T   + A   ++RK+A+S LVL+ +FGI+ ++F+    I+    + V   + +  E   NS QG  +A++FCF N EV  E+K+ ++ ++  R 
Sbjct:   15 QEQMRVKARLDCYQRMLN---ETAPIEGVHCPRRWDSIACWPPT-AAGVQAEQPCPDYINKFIVDENATKICKADGEWFISSETNHTWTNYSQCISTANPEVPSQLLVDHVPNLLILANVGYALSIVMLLVAVILMLYFKKLHCPRNTVHINLFVTFILRAVLSFLKENLMVQGVGLPQDVHTDKHGMLAFNHQGTHWECKLLMTVYMYILGANCTWIFVEGLYLHMLIFMAVFSENSSVA-QYIAIGWFSPLLFVIPWVVVRATLDDFMCWNVYTNKNYF--WIIRGPLTFLMVVNFLFFLNIVRVVFTKMSTGTAMEARGQRYRKMAKSTLVLIPLFGIHYMVFI---WIDPSRASDVVELVWLYFEMFFNSFQGVFIALLFCFFNGEVRAEVKKSWQRYQLRRG 411          
BLAST of Parathyroid hormone receptor 1 vs. TrEMBL
Match: A0A3Q2YAC1 (Parathyroid hormone 1 receptor a OS=Hippocampus comes OX=109280 PE=3 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 5.009e-57
Identity = 129/428 (30.14%), Postives = 221/428 (51.64%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ-----STNKEPALFF-VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCF--------------------------SLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSY 1314
            + Q  LL KA+  C   + +    +  L   +C P WDG+VCW     SGK  S  CP YI  F  +G+ Y+RC+ NG W   A + K W ++ EC +     + N+E  +F  +  I  +G+ +S+ S+++ + IL +F+ LHC RN IH++LFV+ +LR+                            S+     +N      CK  +++  Y +  N+ W+ VE LYLH+++ + TF      ++ + ++GWG+P + + +W  +R  F +T CWD     +    W+  V  +  ++ N + F+ +I +L  K+         ++ ++RKL +S LVLM +FG++ +IF  +   E    + + +QI+M  E L NS QGFL+A+++CFCN EV  EIK+ +   R + +L    + +   N+Y
Sbjct:   26 EEQIALLFKAKRKCEGLVKS---RQGKLPDGYCSPEWDGIVCW-PEGASGKLVSTSCPDYIYDFNHRGRTYRRCSSNGTWEISAANNKTWANYSECAKFLYHYNQNQEKDVFHRLYLIYTVGYSVSLGSLIVAVLILGYFRRLHCTRNYIHMHLFVSYMLRAVSIFVKDVVLYSGSALEDVQRVTVEELKSITEAPPSNKAHFIGCKAAVTLFMYFLATNYFWILVEGLYLHSLIFM-TFFSDRKYLWGFTMIGWGVPAMFVSVWATVRATFADTECWDLSAGNLK---WIYQVPILAAVVVNFVLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIIFNAMPYTEV---SGIPWQIQMHYEMLFNSFQGFLVAIIYCFCNGEVQAEIKKSWS--RRTLALDFKRKARSGSNTY 440          
BLAST of Parathyroid hormone receptor 1 vs. TrEMBL
Match: A0A1S3LZC6 (parathyroid hormone/parathyroid hormone-related peptide receptor-like OS=Salmo salar OX=8030 GN=LOC106569329 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.135e-56
Identity = 134/429 (31.24%), Postives = 221/429 (51.52%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ-----STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF--------------------------SQLQTNNETN-TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSY 1314
            + Q  LL KA+  C   ISN    K      +C P WDG+VCW      GK  S  CP YI  F  KG  Y+RC  NG W    N+ K W ++ EC +     + N E  +F  +  I  +G+ IS+ S+++ + IL +F+ LHC RN IH++LFV+ +LR   S+F                          ++    N+T    CKV +++  Y +  N+ W+ VE LYLH+++ + TF      ++ + L+GWG+P + + +W  +R    +T CWD     +    W++ V  +  ++ N + F+ +I +L  K+         ++ ++RKL +S LVLM +FG++ ++F+ +   E     +V +QI+M  E L NS QGF +A+++CFCN EV  E+K+ +   R + +L    + +   N+Y
Sbjct:   39 EEQIGLLFKAKRKCEVAISN----KHKPGDGYCSPEWDGIVCW-PEGSPGKLVSTACPEYIYDFNHKGLAYRRCDNNGTWELTTNNNKTWANYSECAKFLSHYNKNNEKEVFDRLYLIYTVGYSISLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRG-ISIFVKDVVLYSGSALEDMERVSVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAMFVTVWASVRATLADTECWDLSAGNLK---WIVQVPILTAIVVNFMLFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEV---TEVPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEMKKSWS--RRTLALDFKRKARSGSNTY 452          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Cavefish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 205.682 bits (522), Expect = 6.997e-60
Identity = 130/429 (30.30%), Postives = 223/429 (51.98%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ-----STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF--------------------------SQLQTNNETN-TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLT--ASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSY 1314
            + Q  LL  A+  C   I     ++  L   FC P WDG++CW      G+T S  CP YI  F  KG  Y+RC +NG W    ++ K W ++ EC +       N+E  +F  +  I  IG+ IS+ S+++ + IL +F+ LHC RN IH++LFV+ +LR+  S+F                          ++    N+T    CK+ +++  Y +  N+ W+ VE LYLH+++ + TF      ++ + L+GWG+P + + +W  +R    +T CWD     +    W++ +  +  ++ N + F+ +I +L  K+         S+ ++RKL +S LVLM +FG++ ++F+ +   E    + + +QI+M  E L NS QGF +A+++CFCN EV  EIK+ +   R + +L    + +   N+Y
Sbjct:   24 EEQIYLLFNAKRKCERAIK----SRHRLPEGFCMPEWDGILCW-PEGAPGRTVSTACPEYIYDFNHKGHAYRRCDLNGSWELATSNNKTWANYSECAKFLHYNHQNQEREVFDRLYLIYTIGYSISLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRA-ISIFVKDVVLYSGAVLEETERVTVEDLKSITEAPPANKTQFVGCKIAVTLFLYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAMFVTVWASVRATLADTECWDLSAGNLK---WIVQIPILTAIVVNFLLFLNIIRVLATKLRESNAGRCDSRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEV---SGIPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWS--RRTLALDFKRKARSGSNTY 437          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Cavefish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 205.297 bits (521), Expect = 1.737e-59
Identity = 130/429 (30.30%), Postives = 223/429 (51.98%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ-----STNKEPALF-FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF--------------------------SQLQTNNETN-TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLT--ASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSY 1314
            + Q  LL  A+  C   I     ++  L   FC P WDG++CW      G+T S  CP YI  F  KG  Y+RC +NG W    ++ K W ++ EC +       N+E  +F  +  I  IG+ IS+ S+++ + IL +F+ LHC RN IH++LFV+ +LR+  S+F                          ++    N+T    CK+ +++  Y +  N+ W+ VE LYLH+++ + TF      ++ + L+GWG+P + + +W  +R    +T CWD     +    W++ +  +  ++ N + F+ +I +L  K+         S+ ++RKL +S LVLM +FG++ ++F+ +   E    + + +QI+M  E L NS QGF +A+++CFCN EV  EIK+ +   R + +L    + +   N+Y
Sbjct:   38 EEQIYLLFNAKRKCERAIK----SRHRLPEGFCMPEWDGILCW-PEGAPGRTVSTACPEYIYDFNHKGHAYRRCDLNGSWELATSNNKTWANYSECAKFLHYNHQNQEREVFDRLYLIYTIGYSISLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSFMLRA-ISIFVKDVVLYSGAVLEETERVTVEDLKSITEAPPANKTQFVGCKIAVTLFLYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAMFVTVWASVRATLADTECWDLSAGNLK---WIVQIPILTAIVVNFLLFLNIIRVLATKLRESNAGRCDSRQQYRKLLKSTLVLMPLFGVHYIVFMAMPYTEV---SGIPWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWS--RRTLALDFKRKARSGSNTY 451          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Cavefish
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:103034973])

HSP 1 Score: 188.734 bits (478), Expect = 1.666e-53
Identity = 127/411 (30.90%), Postives = 211/411 (51.34%), Query Frame = 1
Query:  121 KIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCW-YGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQST--NKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC--------------FSLFSQLQTNNETNTF------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLD-LIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            +I  + Q  +L  A+  C   +S+  +A        C   WDG++CW  GY   G  A  PCP YI  F   G  Y+RC  N  W    +  K W ++ EC +S   N+E  +FF  +  +  +G+ +S  S+L+ I I+ +F+ LHC RN IH++LFV+ +LR+                  F  +  NN TN              CKV + +  Y +  N+ W+ VE LYLH+++ +    +T   ++ + L+GWG+P + +  W I+R    ++ CW+     I    W+  V P+L  I  N I F+ ++ +L  K+         ++ ++RKLA+S LVL++VFG++ ++FV +   IE +      ++++M  E   NS QGF +++++CFCN EV  EIK+ +
Sbjct:   18 EITAEEQVQMLLDARLQCLQTVSSHDLA-----VDECPAEWDGLICWPRGY--PGTLAKVPCPRYIYDFNHAGHAYRRCDSNSSWLLGESLNKTWANYTECIKSPGPNRERQVFFERLHIMYTVGYAVSFGSLLVAILIIGYFRRLHCTRNYIHMHLFVSFMLRAVSIFVKDRVVHTSAGLQEFDAVLMNNFTNAVDVAPVDTSQYMGCKVTVLLFIYFLATNYYWILVEGLYLHSLIFMAFLSDTK-YLWGFTLIGWGVPAVFVATWAIVRATVADSRCWELSAGNIK---WIYQV-PILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMPHTIEGL-----GWEVRMYCELFFNSFQGFFVSIIYCFCNGEVQTEIKKTW 411          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Cavefish
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:103034973])

HSP 1 Score: 188.734 bits (478), Expect = 1.961e-53
Identity = 127/411 (30.90%), Postives = 211/411 (51.34%), Query Frame = 1
Query:  121 KIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCW-YGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQST--NKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC--------------FSLFSQLQTNNETNTF------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLD-LIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            +I  + Q  +L  A+  C   +S+  +A        C   WDG++CW  GY   G  A  PCP YI  F   G  Y+RC  N  W    +  K W ++ EC +S   N+E  +FF  +  +  +G+ +S  S+L+ I I+ +F+ LHC RN IH++LFV+ +LR+                  F  +  NN TN              CKV + +  Y +  N+ W+ VE LYLH+++ +    +T   ++ + L+GWG+P + +  W I+R    ++ CW+     I    W+  V P+L  I  N I F+ ++ +L  K+         ++ ++RKLA+S LVL++VFG++ ++FV +   IE +      ++++M  E   NS QGF +++++CFCN EV  EIK+ +
Sbjct:   28 EITAEEQVQMLLDARLQCLQTVSSHDLA-----VDECPAEWDGLICWPRGY--PGTLAKVPCPRYIYDFNHAGHAYRRCDSNSSWLLGESLNKTWANYTECIKSPGPNRERQVFFERLHIMYTVGYAVSFGSLLVAILIIGYFRRLHCTRNYIHMHLFVSFMLRAVSIFVKDRVVHTSAGLQEFDAVLMNNFTNAVDVAPVDTSQYMGCKVTVLLFIYFLATNYYWILVEGLYLHSLIFMAFLSDTK-YLWGFTLIGWGVPAVFVATWAIVRATVADSRCWELSAGNIK---WIYQV-PILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGVHYIVFVGMPHTIEGL-----GWEVRMYCELFFNSFQGFFVSIIYCFCNGEVQTEIKKTW 421          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Cavefish
Match: pth3r (parathyroid hormone/parathyroid hormone-related peptide receptor-like [Source:NCBI gene;Acc:103044101])

HSP 1 Score: 184.111 bits (466), Expect = 1.521e-51
Identity = 128/447 (28.64%), Postives = 225/447 (50.34%), Query Frame = 1
Query:   46 LFVWILLTFIWCPFLQ-GKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC------KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC---------FSLFSQLQTN------NETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM---VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENS 1311
            + V + +TFI+C  L   K++   +  I  D Q  LL  A+  C   I +    + S+  + C P WDG++CW    + G+  +  CP YI  F  +G  Y+ C V+G W +     + W+++ EC        +  +E     +  +   G+ IS+ S+L+ +FIL FFK LHC RN IH +LF + + R+          ++   +++T+            CK+ ++   Y +  N  W+ VE LYLH+++ +  F      ++   ++GWG+P + + IW+ +R    +T CWD     +    W+  V  +  ++ N   F+ +I +L +K+    T +L   Q ++RKL +S LVLM +FG++ ++F+ L   E      + +Q++M  E   NS QGF +A ++CFCN EV  E+K+ +   R S  L    + +I  ++
Sbjct:    2 MVVEVSVTFIFCCILMTAKALIDSDDVITRDEQIFLLIGARTKCERSIRS---QQGSIRENDCVPEWDGIICW-PRGKPGQLVAVLCPEYIYDFNHQGNAYRNCDVSGNWEQVPIINRTWSNYTECTTYLHSNHAGQQEAVFRRLHLMYTTGYSISLASLLVAVFILCFFKRLHCTRNYIHTHLFTSFICRAVSIFVKDAVLYTFAEEVETDYVVVDPRPPMVGCKLAVTFFLYFLATNHYWILVEGLYLHSLIFM-AFLSDKNYLWALTIIGWGVPALFVSIWVSVRASLADTQCWDISAGNLK---WIYQVPILAAIVVNFFLFLNIIRVLASKLWETNTGKLDPRQ-QYRKLLKSTLVLMPLFGVHYMVFMALPYTE---VTGLLWQVQMHYEMFFNSLQGFFVAFIYCFCNGEVQAEVKKAWL--RRSLVLDLKQKARITSSA 434          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Sea Lamprey
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 179.489 bits (454), Expect = 1.161e-51
Identity = 118/415 (28.43%), Postives = 216/415 (52.05%), Query Frame = 1
Query:  124 IEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTN------KEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQ---LQTNNETN----------------TFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVY--PVLLLIQ-NIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQ 1278
            I  + Q  +L +A+ +C   I +      S   + C   WDG++CW  +   G    + CP YI  F   G  Y++C  NG W + + + + W ++ EC +  N      ++ ++  +  +  IG+ +S+ S+ + + IL  F+ LHC RN IH++LFV+ +LR+  S+F +   L ++NE                    C+V +++  Y +  ++ WV VE LYL++++ L TF   SG ++ + L+GWG P++ + +W   R    N+ CWD          W+ ++Y  P+L  +  N + F+ ++ +L  K+         S+ ++RKL +S LVLM +FG++ ++F  +   + +    + +QI+M  E   NS QGF +A+++CFCN EV  E+K+ +      ++L+
Sbjct:   16 ITKEEQMFMLTEAKTHCEKTIHS---TNASSADTHCTAEWDGLICW-PWGLPGSMVREKCPSYIYDFNAHGHAYRKCESNGTW-KMSTANRLWANYSECTEFLNPHVQAKEKESIHRLSILYTIGYSVSLASLAIALCILTVFRRLHCTRNYIHMHLFVSFMLRAA-SIFVKDGVLYSDNELRLATPGPSPPAEAPHIFAGCRVVVTLFLYCLATSYFWVLVEGLYLYSLIFL-TF-SASGRLWTFALIGWGFPVVFVFVWAAARATLANSQCWDLSAG------WLKWIYQAPILAAVAVNFVLFVNIVRVLATKLRETNAARQESRQQYRKLLKSTLVLMPLFGVHYVLFAAMPYTDVI---GLAWQIQMYYEMTFNSFQGFFVAIIYCFCNGEVRGEMKKLWSRWSLDQALK 413          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000542.1 (pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1 gene:ENSPMAG00000000476.1 transcript:ENSPMAT00000000542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.377 bits (394), Expect = 4.804e-43
Identity = 111/374 (29.68%), Postives = 193/374 (51.60%), Query Frame = 1
Query:  151 LRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPAL---FFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSL--FSQLQTNNE----TNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM-VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKR 1242
            + K Q  CN ++        S++   C   WDG +CW G   +G  A Q CP Y   F  + KV K C  +G+WFR  +S + W+++  C   T  +  +    F + ++  G  +SI  +L+ + I  +FK+L C R T+H NLF++ +L S  ++   + +  N E       +CKV    H Y++  N+ W+  E +YLH ++ +  F E    +F Y L+GWG P++  ++  + R ++ +  CW +  + +   ++++    V  L+ N+ F + ++ +L  K+ VTH+  A  + + K  R+ L+L+ + GI Q + VP    E        + +++   HLI   QGFL+A +FCFCN EV   +KR
Sbjct:   17 ISKMQYECNKRM--LLEPPYSVSRKHCNRTWDGWLCW-GDTMAGDVAVQHCPDYFPDFDLQEKVTKICNTDGQWFRHPDSNRTWSNYTLCNAFTADKLKMAVNLFYLAVTGHG--VSILVLLVSLTIFFYFKSLSCQRITLHKNLFMSYILNSIITIIQLTAVANNQELVASKPVWCKVLQFFHQYMMGCNYFWMLCEGIYLHTLIVVAVFAEKQH-LFWYYLLGWGFPIVPALMHAVARTIYYDDNCWISSATHL---LYIIHGPVVAALLVNLFFLLNIVRVLVTKLKVTHR--AETSMYMKAVRATLILVPLLGI-QFVLVPWK-PERFVGEIYDYIMQIFPTHLI---QGFLVATIFCFCNGEVQAALKR 374          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004243.1 (pep scaffold:Pmarinus_7.0:GL484465:15708:23345:-1 gene:ENSPMAG00000003877.1 transcript:ENSPMAT00000004243.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.413 bits (324), Expect = 4.509e-34
Identity = 98/301 (32.56%), Postives = 146/301 (48.50%), Query Frame = 1
Query:  214 LNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHY---IDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTN------KEPALFFVVT-ISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQ-TNN-----------------ETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLL-LIQNIIFFIKLIVILHAKMVTHQLTASQNKFR 1029
            L+  +C   +D   CW       K A  PCP Y   IDK +  G VY+ CT +G W  + N T  W D  EC    N      KE  L   +  +   G+ +S+ S+++ + IL  F+ LHC RN IH+NLF + +LR+   L      T+N                 E  T C+       Y I AN+ W+ VE  YLH +LT+  F +   + F Y+L+GWG P++ II W++ +L+++N  CW        + +W L   P+L  ++ N I F+K+I IL +K+   Q   S  K R
Sbjct:   28 LSGVYCNRTFDHYACWPDSLPDTKVAI-PCPSYLPWIDK-VEGGYVYRYCTRDGTWLTQDNVTAAWRDHSECLDDENNISTEGKEMYLLHALRLVYTTGYSVSLASLVVAMGILIMFRRLHCTRNYIHMNLFASFILRAISVLLKDAALTHNYTKRPQNASDWLGYFGYEGYTGCRATHVFMQYCIGANYFWLLVEGSYLHTLLTMCVFTKKKLIAF-YVLLGWGTPIMFIIPWMVSKLIYENQGCWGI---NTWMGIWWLIRGPILFSIVVNCILFVKIIKILLSKLKAQQSKFSNYKSR 322          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004899.1 (pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-1 gene:ENSPMAG00000004402.1 transcript:ENSPMAT00000004899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.099e-29
Identity = 93/348 (26.72%), Postives = 173/348 (49.71%), Query Frame = 1
Query:  256 CWYGYFQSGKTASQPCPHYID--KFIRKGKVYKRCTVNGEWFRRANST--KPWTDFGECKQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQ---LQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLL-LIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGI-YQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF----ENHR 1260
            CW    ++G+T + PCP   +  ++     V + C  NG W +R+N +  KP  D    K+  ++   +  +V  + +G  IS+ +++       + +++ C RN IH +L    +LR+   L  Q   L T      +C+V +++ NY  + NF W+FVE  YLH  + + T+        +++ +GW +P   II+W +++L +++  CW        +D   ++  P++L L+ N IF   ++ IL  K+     + +    RK  ++ LVL+ + GI Y L FV      N   + V+  I +     + S QGF +++ +CF N EV   +++++    +NHR
Sbjct:   52 CW-PESEAGRTVATPCPERFNGVRYDSSKSVIRECLANGTWAQRSNYSLCKPIID---AKKPNSQHYKIALIV--NYLGHCISLAALITAFGFFWWLRSIRCLRNAIHWHLVTTFILRNAAWLLLQIIDLSTQERNEPWCRVVITVFNYFQVTNFFWMFVEGCYLHTAIVM-TYSTDKLRKSIFVCIGWCIPAPIIIVWAMVKLFYEDEKCWFGKTEGKYIDY--IYQGPIILVLLVNFIFLFNIVRILMTKLRASTTSETIQYSRKAVKATLVLLPLLGITYMLFFV------NPGEDPVSQVIFIYVNSFLMSFQGFFVSVFYCFLNGEVRSALRKRWNRWMDNHR 384          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009958.1 (pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 gene:ENSPMAG00000008983.1 transcript:ENSPMAT00000009958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 3.044e-27
Identity = 99/382 (25.92%), Postives = 186/382 (48.69%), Query Frame = 1
Query:  226 FCRPVWDGV-VCWYGYFQSGKTASQPCPHYID--KFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQL---QTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLL-LIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGI-YQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF----ENH----RNSRSLQ-TTDEVKIRENSYRK 1320
            FC    D +  CW    ++ +   +PCP   +  ++     VY+ C  +  W RR+N +         + S + + AL     ++ +G  +S+ +++    I    +++ C RN IH NL    +LR+      QL    T      +C + +++ NY  + NF W+FVE  YLH  + + T+       +++I +GW +P   IIIW +++L F++  CW        +D   ++  P++L L+ N IF   ++ IL  K+     T+   ++RK  ++ LVL+ + GI Y L FV      N   ++++  I +     + S QGF +++ +CF N EV   I++++    +NH    R +R++   T   +I  +S+++
Sbjct:   12 FCNATRDEIGTCWPSS-EASRVVIRPCPDRFNGVQYDTSKSVYRECMADATWARRSNYSLCEAIILSKRNSQHYKVAL----VVNYLGHCVSLLALMTAFTIFWCLRSIRCLRNAIHWNLMTTFILRNATWFLLQLIDLSTQERNEPWCCIIITIFNYFQVTNFFWMFVEGCYLHTAIVM-TYSTDKLRKWIFICIGWVIPAPIIIIWAMVKLHFEDEKCWFGKTPGKYIDY--IYQGPIILVLLINFIFLFNIVTILMTKL-RASTTSETIQYRKAVKATLVLLPLLGITYMLFFV------NPGEDEISQVIFLYVNSFLMSFQGFFVSVFYCFLNGEVRSAIRKRWHRWLDNHAIRARVTRAMSIPTSPTRISFHSFKR 378          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Nematostella
Match: EDO39196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS3])

HSP 1 Score: 70.0922 bits (170), Expect = 2.350e-13
Identity = 79/314 (25.16%), Postives = 137/314 (43.63%), Query Frame = 1
Query:  322 FIRKGKVYKRCTVNGEWFRRANSTK------PWTDFGECKQSTNKEPALF--FVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTY--CWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNK--FRKLARSILVLMVVFGIYQLI-FVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEV 1224
            FI  G  +   ++ G      N+T+        T+F    +   K+P +   ++  I+ IG  +SI   +L I    F  +L  +R  IHINL  A L      LF    T+ E  + C     +  +  M+ FTW+ VE ++++  L +  F    G   +Y ++GWG  L      +        T   CW + +S     +W  FV P L++I   +  + +++ + A M+  +   S N    R L ++ + L+ + G+  L  F+  +      N  V F+       + NS QGFL+ + +C  +SEV
Sbjct:    1 FISDGSPHGSWSIEGCRLGPRNATQITCYCYHLTNFAILTRLKAKDPTVHDDYLTYITFIGLGLSIAGCVLTILTHLFLPSLRSERVFIHINLVTAILFAQI--LFIVGATHREPQSLCLSVAVLLYFFYMSVFTWMLVEGIHIY-CLVIRVFNSGRGRKKIYTVIGWGEFLSIFPSGMPAFRNSSTTSSRCWLSLESG---AIWA-FVAPALVVIAFNLVILFMVLRVTAVMLKDESQTSSNVCLSRALVKAFVTLLPILGLTWLFGFLAFN------NKTVMFEYLFA---IFNSMQGFLIFVFYCLLSSEV 298          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Nematostella
Match: EDO32853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STW1])

HSP 1 Score: 51.6026 bits (122), Expect = 2.737e-7
Identity = 63/262 (24.05%), Postives = 116/262 (44.27%), Query Frame = 1
Query:  466 ISNIGFFISITSVLLGIFI-LRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTY------CWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTH--QLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEV 1224
            IS IG  IS+ ++LL I + + F++++   R  + +N+ +A +   C  + ++  T   +   CK    + +Y ++A F W+  E   L+ ++      +    V  ++L GWG P I + I +         Y      CW + D+ +   +W      +++L+ NII F   +++L   M T   Q  +   K R   ++  V++ + GI  L F  L         K  F I       +NS QG ++ +  C  N +V
Sbjct:   61 ISTIGCAISLFAILLTIILTVAFWRSVRSPRAIVLLNICLA-VAAVCILVIAE-GTARNSQKGCKALAILLHYFLLAVFCWMLCEGALLYIIIVKVIGGKPEEKVKYFLLFGWGFPAIIVAISLGATQTKGYGYHGAQTACWLSVDNGL---IWAFVAPALVVLMINIIVF---VLVLRQTMGTRHVQNKSRDEKLRVAVKATAVILPLLGITWL-FGLLAFSAETVAFKYIFAI-------LNSLQGLMIFIFHCVLNKQV 306          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Nematostella
Match: EDO50018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF24])

HSP 1 Score: 50.0618 bits (118), Expect = 8.929e-7
Identity = 63/260 (24.23%), Postives = 113/260 (43.46%), Query Frame = 1
Query:  466 ISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNT--YCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM-----VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEV 1224
            ++ IG  +SI  V L +  L     L  +R  IH NL +A  +     L    +   E+   CK++ ++  Y  M+ F+W+ VE ++L+ ++ +     T  ++  Y  +GWGLP+  ++I   +      T  +CW +        +W  F  P +++I      +  ++ L  K+     V+H+   S    R  AR  ++L+ + G+   IF     +E     +  F          NS QG ++    C  NSEV
Sbjct:   48 VTYIGCTLSILGVFLTVVTLISLPVLRSERTRIHCNLCIAVGVSQILFLAGGTEELVESKVGCKLYAALMFYAFMSVFSWMLVEGIHLYQMIIIAFI--TRAMMKFYYFIGWGLPMCIVVIASCISHKGYGTPNFCWLSLTDH---TIWA-FTGPAIVVILVNAVVLGAVLRLRTKLENNAEVSHRACLSILFLRTGARVSIMLLPLLGL-SWIFGLFTAMEGTLVIQYIFAAT-------NSLQGLMIFAFHCVGNSEV 293          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Nematostella
Match: EDO34537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP31])

HSP 1 Score: 49.6766 bits (117), Expect = 1.063e-6
Identity = 73/290 (25.17%), Postives = 126/290 (43.45%), Query Frame = 1
Query:  391 TKPWTDFGECKQSTN---KEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTY-----CWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNK----FRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEV 1224
            T   T F    Q T+    EP    +  I+ IG  IS  ++L+ + I    ++L  +R+ IH+NL +A  L     L     T N+    C+V  +  +Y     FTW+  E ++L+ +  +  F+  +  +  Y + GWG      +I  I   +  N+Y     CW +    ++ D    F+ PV      II    LI+I+  K + +  +  +N      R   +  LVLM + G+       +  +  ++ + V FQ       + NS QGFL+ ++    N+EV
Sbjct:   20 THHLTSFAVLMQHTDIPLTEPEKLSLQIITYIGCGISSVALLITLVIFLSIESLSTERHRIHLNLVLALFLAQILFLSGINATGNKIG--CQVVAAFLHYFYTVAFTWMLNEGVHLY-LKVVKVFRIENVRLLHYYIFGWG---FPAVIVGISAAIKPNSYGTESICWLS----LSDDFVWAFIGPVTF----IIAINCLILIVVVKTIVNSASTVKNSDHAHIRAGVKGALVLMPLLGVSW-----ISGLLAVNKDTVFFQYVFA---ITNSFQGFLIFLLHVVFNTEV 287          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 48.9062 bits (115), Expect = 4.167e-6
Identity = 53/232 (22.84%), Postives = 104/232 (44.83%), Query Frame = 1
Query:  442 PALFFVVTISN-IGFFISITSVLLGIFILRFFKNLH-CDRNTIHINLFVACLLRSCFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWG--XXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLL--IQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMH 1119
            P + F + I   IG  +S+  +L+        + L   + N IH NL  A ++     L    +TN+   T C++   + +Y     FTW+ VE ++++  L+     +T  + F Y L GWG    ++ I   +      +N +CW A D  +   +W  F  PV+++  + ++  F    +  H     +     ++ +R   R+  V++ + G+  L+F  L + ++M 
Sbjct: 2230 PQVAFALRIGTYIGIAVSVAILLIAFVSFVCLRGLKKSNANDIHKNLVAAIVIAEIIFLAGINRTND--TTACRLVAILLHYFFSTVFTWMLVEGVHMYRRLSEKRNIDTGRMNFYYFL-GWGCPAIVVGISAGLSTEGYGNNHFCWMATDGTL---IWT-FTIPVMIVVAVSSMERFFFFTLPSHETFTCYFYLLMRSLYRAGMRASAVVLPLLGV-SLVFAILMVNKDME 2453          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Medaka
Match: pth1r (parathyroid hormone 1 receptor [Source:NCBI gene;Acc:101155466])

HSP 1 Score: 199.904 bits (507), Expect = 1.612e-57
Identity = 134/427 (31.38%), Postives = 221/427 (51.76%), Query Frame = 1
Query:  133 DSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ------STNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC------FSLFSQLQTNN-ETNTF-------------------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENS 1311
            + Q T L  A+  C + I++ S     +   FC   WDG+VCW      GK  S  CP YI  F  KG  Y+RC  NG W  +A++ K W ++ EC +       ++++     +  I  +G+ +S+ S+++ + IL +F+ LHC RN IH++LFV+ +LR+         L+S+    N E  T                    CKV +++  Y +  N+ W+ VE LYLH+++ + TF      ++ + L+GWG+P + + IW  +R  F +T CWD     +    W+  V  ++ ++ N I F+ +I +L  K+         ++ ++RKL +S LVLM +FG++ +IF  +   E    + + + I+M  E L NS QGFL+A+++CFCN EV  EIK+ +    N R+L    + K R  S
Sbjct:   33 EEQITQLVIAKHTCENNIASRS----KIPNGFCSAEWDGIVCW-PEGPPGKLVSTACPEYIYDFNHKGLAYRRCDNNGTW-EQASANKTWANYNECAKFLYHYNHSHEKEVFHRLYLIYTVGYSVSLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSYMLRAISIFVKDVVLYSESPLENMERVTLDDLKSITIAPPVNKTQFIACKVVVTLFMYFLATNYYWILVEGLYLHSLIFM-TFFSDRKYLWGFTLIGWGVPAVFVSIWATVRATFADTECWDLSAGNLK---WIYQVPILMAVVVNFILFLNIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIIFNAMPYTEV---SGIPWLIQMHYEMLFNSFQGFLVAIIYCFCNGEVQAEIKKSW----NRRTLALDFKRKARSGS 442          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Medaka
Match: pth3r (parathyroid hormone/parathyroid hormone-related peptide receptor [Source:NCBI gene;Acc:101173747])

HSP 1 Score: 188.734 bits (478), Expect = 2.804e-53
Identity = 124/415 (29.88%), Postives = 213/415 (51.33%), Query Frame = 1
Query:  124 IEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQ--STN----KEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF--------------SQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMV---THQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKI 1299
            I  D Q  +L  AQ  C   I   +     +    C P WDG++CW    ++G+  S PCP YI  F  +G+ Y++C V G W    ++   W ++ EC +  ++N    +E     +  +  +G+ IS++S+L+ + IL +FK LHC RN IHI+LF + + R+  S+F              ++     +    CK  ++   Y +  N  W+  E LYLH+++ +    + + +  L I+ GWG+P + + +W+  R    +T CWD     +    W+  V  +  +  N + FI +I +L +K+    T +L   Q ++RKL RS LVLM +FG++ ++F+ +   E    N + +Q++M  E   NS+QGF +A ++CFCN EV  E+K+ +   R S +L    + +I
Sbjct:   29 ITRDEQIYVLTGAQARCERSIQTQTAI---IKEGDCVPEWDGIICW-PQSRAGQLVSVPCPEYIYDFNHRGRAYRQCDVTGNWELVTSNNHTWANYTECTRYLTSNHRSLQEKVFKRLHLMYTVGYSISLSSLLVAVSILCYFKRLHCTRNYIHIHLFTSFICRA-VSIFVKDSVLYSITDDSKAEFPAERQYTAGCKAAVTFFLYFLATNHYWILAEGLYLHSLIFMALLSDKNYLWVLTIM-GWGIPAVFVSVWVSARASLADTQCWDISAGNLK---WIYQVPILAGIFVNFLLFINIIRVLASKLWETNTGKLNPRQ-QYRKLLRSTLVLMPLFGVHYIVFMAIPYTE---VNGLLWQVQMHYEMFFNSSQGFFVAFIYCFCNGEVQAEVKKAWL--RRSLTLDLKQKARI 428          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Medaka
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:101167084])

HSP 1 Score: 184.496 bits (467), Expect = 1.274e-51
Identity = 127/441 (28.80%), Postives = 220/441 (49.89%), Query Frame = 1
Query:   37 AMRLFVWILLTFIWCPFLQGKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGEC-------KQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLF----------------SQLQTNNETNTF----------CKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQ-NIIFFIKLIVILHAKM--VTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHN-NKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKF 1248
            +     WIL  F++  ++  +     +  +    Q  +L + +  C     N S  + +     C P WDG++CW  +   G+    PCP YI  F  KG  Y++C VNG W       K WT++ EC       K    ++     +  +   G+ +S +S+L+ I I+ +F+ LHC RN IH++LFV+ +LR+  S+F                S L  N +T +           CK+ + +  Y +  N+ W+ VE LYLH+++ +  F+  S  ++ +I +GWG+P + + IW I+R    +  CW+     +    W+  V P+L  I  N I F+ ++ +L  K+         ++ ++RKLA+S LVL++VFGI+ +IFV +      H     +++++M  E   NS QGF +++++C+CN EV  EIK+ +
Sbjct:   15 SANFLTWILNFFLYWQWIDAQ--MGFDGPLSAQEQMLILYEVKIQC---YQNLSSMEPTTTDEVCPPDWDGLICW-PHGSPGQVTEVPCPSYIYDFNHKGHAYRKCDVNGSWVFVEQWNKTWTNYSECLSFLQPFKDEEARQDFFERLYVMYTTGYAVSFSSLLVAIMIIGYFRRLHCTRNYIHMHLFVSFMLRAV-SIFVKDKVVYSSAGLQDFDSALLDNLKTVSIASVDKSHYIGCKMTVVLFIYFLATNYYWILVEGLYLHSLIFM-AFRSDSKYLWGFIFIGWGVPAVFVAIWAIVRATLADARCWELSAGNVK---WIYQV-PILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRKQYRKLAKSTLVLVLVFGIHYIIFVGMP-----HTFQGPSWEMRMYFELFFNSFQGFFVSIIYCYCNGEVQTEIKKTW 438          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Medaka
Match: vipr1a (vasoactive intestinal polypeptide receptor-like [Source:NCBI gene;Acc:101161752])

HSP 1 Score: 167.162 bits (422), Expect = 2.790e-46
Identity = 128/412 (31.07%), Postives = 214/412 (51.94%), Query Frame = 1
Query:  151 LRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKF---IRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC------FSLFSQLQTNN-ETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQ-NKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRGNRDSLKQT 1353
            + K +  C ++I N         T+ C   WD + CW G  + G+  + PCP Y+  F   +    V K CT NG    R +  +      EC  + N       V+  + +G  +S+ S+++ I IL  F+ LHC RN IH++LFV+ +L++         L+   +T+N + +  CK  + + +Y +MA++ W+ VE LYLH +L +  F E     + YI++GWG+P I I  W+I +   D+  CW+  D  +    W++ +   L ++ N + FI +I IL  KM    +   + N++ +LA+S L+L+ +FGI  ++F  +   ENMH      Q++M  + ++ S QGF++A+++CF N EV  EIKRK+      R L T  + K ++ S     GN  S + T
Sbjct:   19 IEKERSICEAQIEN--------KTTSCSVEWDNITCWPGA-EIGEVVTIPCPKYLFYFSEDMPPRNVSKTCTANGLTPIRVDYVR------ECGYNPNNTVEENSVMGYT-VGHSVSLISLMIAISILCLFRKLHCTRNYIHMHLFVSLILKAVTVFIKDVVLYDVGETDNCQGSVGCKAVVVIFHYGVMASYFWLLVEGLYLHALLAVSFFSERK-YFWWYIVIGWGVPTIFICAWVITKAYLDHPGCWETIDDNL---WWIIRIPISLSILVNFLLFICIIRILLQKMNCPDIGRRESNQYSRLAKSTLLLIPLFGINYILFAYIP--ENMH-----VQVRMVFDLVLGSFQGFVVAILYCFLNGEVQSEIKRKWRRWMLQRFLGT--DAKYQQPS-MGSNGNNSSTQIT 400          
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Medaka
Match: vipr1a (vasoactive intestinal polypeptide receptor-like [Source:NCBI gene;Acc:101161752])

HSP 1 Score: 158.688 bits (400), Expect = 2.811e-43
Identity = 125/412 (30.34%), Postives = 207/412 (50.24%), Query Frame = 1
Query:  151 LRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKF---IRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSC------FSLFSQLQTNN-ETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQ-NKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRGNRDSLKQT 1353
            + K +  C ++I N         T+ C   WD + CW G  + G+  + PCP Y+  F   +    V K CT NG    R +  +      EC  + N       V+  + +G  +S+ S+++ I IL  F+ LHC RN IH++LFV+ +L++         L+   +T+N + +  CK  + + +Y +MA++ W+ VE LYLH +L +  F E     + YI++GWG         I L   F    CW+  D  +    W++ +   L ++ N + FI +I IL  KM    +   + N++ +LA+S L+L+ +FGI  ++F  +   ENMH      Q++M  + ++ S QGF++A+++CF N EV  EIKRK+      R L T  + K ++ S     GN  S + T
Sbjct:   19 IEKERSICEAQIEN--------KTTSCSVEWDNITCWPGA-EIGEVVTIPCPKYLFYFSEDMPPRNVSKTCTANGLTPIRVDYVR------ECGYNPNNTVEENSVMGYT-VGHSVSLISLMIAISILCLFRKLHCTRNYIHMHLFVSLILKAVTVFIKDVVLYDVGETDNCQGSVGCKAVVVIFHYGVMASYFWLLVEGLYLHALLAVSFFSERK-YFWWYIVIGWG-------KCIELFSCFYCFRCWETIDDNL---WWIIRIPISLSILVNFLLFICIIRILLQKMNCPDIGRRESNQYSRLAKSTLLLIPLFGINYILFAYIP--ENMH-----VQVRMVFDLVLGSFQGFVVAILYCFLNGEVQSEIKRKWRRWMLQRFLGT--DAKYQQPS-MGSNGNNSSTQIT 393          
BLAST of Parathyroid hormone receptor 1 vs. Planmine SMEST
Match: SMESG000076892.1 (SMESG000076892.1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 450/450 (100.00%), Postives = 450/450 (100.00%), Query Frame = 1
Query:   40 MRLFVWILLTFIWCPFLQGKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRGNRDSLKQTDHQVTCQFSVSE 1389
            MRLFVWILLTFIWCPFLQGKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGLPLIAIIIWIILRLVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRGNRDSLKQTDHQVTCQFSVSE
Sbjct:    1 MRLFVWILLTFIWCPFLQGKSIRKLEYKIEHDSQETLLRKAQENCNSKISNFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFFVVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGLPLIAIIIWIILRLVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRGNRDSLKQTDHQVTCQFSVSE 450          
BLAST of Parathyroid hormone receptor 1 vs. Planmine SMEST
Match: SMESG000047057.1 (SMESG000047057.1)

HSP 1 Score: 235.728 bits (600), Expect = 2.112e-72
Identity = 154/412 (37.38%), Postives = 238/412 (57.77%), Query Frame = 1
Query:  118 YKIEHDSQETLLRKAQENCNSKIS--NFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFS-LFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNN---KVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRG 1329
            Y+I  D Q   + +    C  ++S  N+S+  +++N+  C   WDG++CW    ++GK  S  CP+Y+D F   G V K+CT NG W+ + N T  WT++ +CK   +      F  +  I  +G+ ISI S+++ I IL  F+ L C+RN IH+NLF A   R+ F  L S LQT      +C+    ++NY   A+F  +F EA+Y+HN++  HTF  +     +YI++ W +P   I IW +LR  F+N YCWD  + +   D W L  Y +LL + N + FI L   L +KM +H ++  + KF+KLARSI +L++VFG+Y ++FVP+++I  + +N   K T  IK+   H+ NS QGFL++++ CF NSEV +EIKR  +    SR  Q ++      N+ R RR 
Sbjct:   12 YQIPQDKQMESIIEEHIKCLGRMSFLNYSLDIVTINSK-CPVSWDGIMCW-PETEAGKLVSSRCPNYVDSFQINGTVTKKCTNNGTWYLKDNVT--WTNYSDCKSKIDSLAFKQFEKIEKIGQVGYAISILSLVIAIIILCSFRRLRCNRNYIHLNLFFAFFFRAIFHYLTSFLQTEK---IYCRALRVIYNYFTQASFQSIFTEAIYMHNMIFYHTFDSSKINTPVYIVLCWVVPGFVIGIWSLLRYKFNNVYCWDLSNDKHNRDFWFLNAYVILLTLVNSVIFIILTCSLCSKMNSH-ISTEREKFKKLARSICILVIVFGVYNVVFVPVEIICAIADNATAKKTELIKLYFHHIFNSCQGFLVSLLLCFVNSEVHREIKRFIQKILISRGFQNSNIYVF--NNIRSRRS 413          
BLAST of Parathyroid hormone receptor 1 vs. Planmine SMEST
Match: SMESG000047057.1 (SMESG000047057.1)

HSP 1 Score: 235.728 bits (600), Expect = 2.457e-72
Identity = 154/412 (37.38%), Postives = 238/412 (57.77%), Query Frame = 1
Query:  118 YKIEHDSQETLLRKAQENCNSKIS--NFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFS-LFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNN---KVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRG 1329
            Y+I  D Q   + +    C  ++S  N+S+  +++N+  C   WDG++CW    ++GK  S  CP+Y+D F   G V K+CT NG W+ + N T  WT++ +CK   +      F  +  I  +G+ ISI S+++ I IL  F+ L C+RN IH+NLF A   R+ F  L S LQT      +C+    ++NY   A+F  +F EA+Y+HN++  HTF  +     +YI++ W +P   I IW +LR  F+N YCWD  + +   D W L  Y +LL + N + FI L   L +KM +H ++  + KF+KLARSI +L++VFG+Y ++FVP+++I  + +N   K T  IK+   H+ NS QGFL++++ CF NSEV +EIKR  +    SR  Q ++      N+ R RR 
Sbjct:   22 YQIPQDKQMESIIEEHIKCLGRMSFLNYSLDIVTINSK-CPVSWDGIMCW-PETEAGKLVSSRCPNYVDSFQINGTVTKKCTNNGTWYLKDNVT--WTNYSDCKSKIDSLAFKQFEKIEKIGQVGYAISILSLVIAIIILCSFRRLRCNRNYIHLNLFFAFFFRAIFHYLTSFLQTEK---IYCRALRVIYNYFTQASFQSIFTEAIYMHNMIFYHTFDSSKINTPVYIVLCWVVPGFVIGIWSLLRYKFNNVYCWDLSNDKHNRDFWFLNAYVILLTLVNSVIFIILTCSLCSKMNSH-ISTEREKFKKLARSICILVIVFGVYNVVFVPVEIICAIADNATAKKTELIKLYFHHIFNSCQGFLVSLLLCFVNSEVHREIKRFIQKILISRGFQNSNIYVF--NNIRSRRS 423          
BLAST of Parathyroid hormone receptor 1 vs. Planmine SMEST
Match: SMESG000047057.1 (SMESG000047057.1)

HSP 1 Score: 235.343 bits (599), Expect = 3.023e-72
Identity = 154/412 (37.38%), Postives = 238/412 (57.77%), Query Frame = 1
Query:  118 YKIEHDSQETLLRKAQENCNSKIS--NFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFS-LFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNN---KVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRG 1329
            Y+I  D Q   + +    C  ++S  N+S+  +++N+  C   WDG++CW    ++GK  S  CP+Y+D F   G V K+CT NG W+ + N T  WT++ +CK   +      F  +  I  +G+ ISI S+++ I IL  F+ L C+RN IH+NLF A   R+ F  L S LQT      +C+    ++NY   A+F  +F EA+Y+HN++  HTF  +     +YI++ W +P   I IW +LR  F+N YCWD  + +   D W L  Y +LL + N + FI L   L +KM +H ++  + KF+KLARSI +L++VFG+Y ++FVP+++I  + +N   K T  IK+   H+ NS QGFL++++ CF NSEV +EIKR  +    SR  Q ++      N+ R RR 
Sbjct:   23 YQIPQDKQMESIIEEHIKCLGRMSFLNYSLDIVTINSK-CPVSWDGIMCW-PETEAGKLVSSRCPNYVDSFQINGTVTKKCTNNGTWYLKDNVT--WTNYSDCKSKIDSLAFKQFEKIEKIGQVGYAISILSLVIAIIILCSFRRLRCNRNYIHLNLFFAFFFRAIFHYLTSFLQTEK---IYCRALRVIYNYFTQASFQSIFTEAIYMHNMIFYHTFDSSKINTPVYIVLCWVVPGFVIGIWSLLRYKFNNVYCWDLSNDKHNRDFWFLNAYVILLTLVNSVIFIILTCSLCSKMNSH-ISTEREKFKKLARSICILVIVFGVYNVVFVPVEIICAIADNATAKKTELIKLYFHHIFNSCQGFLVSLLLCFVNSEVHREIKRFIQKILISRGFQNSNIYVF--NNIRSRRS 424          
BLAST of Parathyroid hormone receptor 1 vs. Planmine SMEST
Match: SMESG000047057.1 (SMESG000047057.1)

HSP 1 Score: 235.343 bits (599), Expect = 3.941e-72
Identity = 154/412 (37.38%), Postives = 238/412 (57.77%), Query Frame = 1
Query:  118 YKIEHDSQETLLRKAQENCNSKIS--NFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGKVYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFF--VVTISNIGFFISITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFS-LFSQLQTNNETNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYILVGWGXXXXXXXXXXXXXXVFDNTYCWDAGDSQITLDMWVLFVYPVLLLIQNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIFVPLDLIENMHNN---KVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIKRKFENHRNSRSLQTTDEVKIRENSYRKRRG 1329
            Y+I  D Q   + +    C  ++S  N+S+  +++N+  C   WDG++CW    ++GK  S  CP+Y+D F   G V K+CT NG W+ + N T  WT++ +CK   +      F  +  I  +G+ ISI S+++ I IL  F+ L C+RN IH+NLF A   R+ F  L S LQT      +C+    ++NY   A+F  +F EA+Y+HN++  HTF  +     +YI++ W +P   I IW +LR  F+N YCWD  + +   D W L  Y +LL + N + FI L   L +KM +H ++  + KF+KLARSI +L++VFG+Y ++FVP+++I  + +N   K T  IK+   H+ NS QGFL++++ CF NSEV +EIKR  +    SR  Q ++      N+ R RR 
Sbjct:   31 YQIPQDKQMESIIEEHIKCLGRMSFLNYSLDIVTINSK-CPVSWDGIMCW-PETEAGKLVSSRCPNYVDSFQINGTVTKKCTNNGTWYLKDNVT--WTNYSDCKSKIDSLAFKQFEKIEKIGQVGYAISILSLVIAIIILCSFRRLRCNRNYIHLNLFFAFFFRAIFHYLTSFLQTEK---IYCRALRVIYNYFTQASFQSIFTEAIYMHNMIFYHTFDSSKINTPVYIVLCWVVPGFVIGIWSLLRYKFNNVYCWDLSNDKHNRDFWFLNAYVILLTLVNSVIFIILTCSLCSKMNSH-ISTEREKFKKLARSICILVIVFGVYNVVFVPVEIICAIADNATAKKTELIKLYFHHIFNSCQGFLVSLLLCFVNSEVHREIKRFIQKILISRGFQNSNIYVF--NNIRSRRS 432          
The following BLAST results are available for this feature:
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTH2R2.679e-5029.66parathyroid hormone 2 receptor [Source:HGNC Symbol... [more]
PTH1R3.907e-4929.52parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R1.636e-4829.52parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R1.636e-4829.52parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
PTH1R1.636e-4829.52parathyroid hormone 1 receptor [Source:HGNC Symbol... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
seb-32.120e-1923.54SEcretin/class B GPCR; Secretin receptor-like prot... [more]
seb-26.548e-1924.26G-protein coupled receptor seb-2 [Source:UniProtK... [more]
pdfr-15.545e-1622.94Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-15.545e-1622.94Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-16.349e-1622.94Calcitonin receptor-like protein 1 [Source:UniPro... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dh44-R21.190e-3128.07gene:FBgn0033744 transcript:FBtr0087936[more]
Dh44-R21.097e-3028.08gene:FBgn0033744 transcript:FBtr0113075[more]
Pdfr1.385e-2825.90gene:FBgn0260753 transcript:FBtr0070436[more]
Pdfr1.893e-2826.72gene:FBgn0260753 transcript:FBtr0340084[more]
Pdfr1.893e-2826.72gene:FBgn0260753 transcript:FBtr0340085[more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r2.652e-5731.07parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r4.809e-5730.20parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth2ra9.690e-5531.13parathyroid hormone 2 receptor a [Source:ZFIN;Acc:... [more]
pth2ra9.690e-5531.13parathyroid hormone 2 receptor a [Source:ZFIN;Acc:... [more]
pth2rb1.285e-4929.61parathyroid hormone 2 receptor b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc221.055e-5229.91coiled-coil domain containing 22 [Source:Xenbase;A... [more]
ccdc221.410e-5230.52coiled-coil domain containing 22 [Source:Xenbase;A... [more]
ccdc221.642e-5229.72coiled-coil domain containing 22 [Source:Xenbase;A... [more]
ccdc222.298e-5229.72coiled-coil domain containing 22 [Source:Xenbase;A... [more]
ccdc223.649e-5230.28coiled-coil domain containing 22 [Source:Xenbase;A... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pth2r2.226e-5130.73parathyroid hormone 2 receptor [Source:MGI Symbol;... [more]
Pth1r9.346e-5029.87parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Pth1r9.346e-5029.87parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Pth1r9.346e-5029.87parathyroid hormone 1 receptor [Source:MGI Symbol;... [more]
Vipr24.930e-4529.76vasoactive intestinal peptide receptor 2 [Source:M... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25107|PTH1R_DIDVI1.020e-5530.59Parathyroid hormone/parathyroid hormone-related pe... [more]
sp|P70555|PTH2R_RAT1.053e-5130.58Parathyroid hormone 2 receptor OS=Rattus norvegicu... [more]
sp|Q91V95|PTH2R_MOUSE1.557e-5030.73Parathyroid hormone 2 receptor OS=Mus musculus OX=... [more]
sp|P49190|PTH2R_HUMAN1.287e-4929.66Parathyroid hormone 2 receptor OS=Homo sapiens OX=... [more]
sp|P25961|PTH1R_RAT6.537e-4929.87Parathyroid hormone/parathyroid hormone-related pe... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3DKT93.542e-5829.35Parathyroid hormone 1 receptor a OS=Hippocampus co... [more]
A0A4W4HJ771.121e-5731.07Parathyroid hormone 1 receptor a OS=Electrophorus ... [more]
R7UVQ31.810e-5731.45Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A3Q2YAC15.009e-5730.14Parathyroid hormone 1 receptor a OS=Hippocampus co... [more]
A0A1S3LZC61.135e-5631.24parathyroid hormone/parathyroid hormone-related pe... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r6.997e-6030.30parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r1.737e-5930.30parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth2ra1.666e-5330.90parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
pth2ra1.961e-5330.90parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
pth3r1.521e-5128.64parathyroid hormone/parathyroid hormone-related pe... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r1.161e-5128.43parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000000542.14.804e-4329.68pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1... [more]
ENSPMAT00000004243.14.509e-3432.56pep scaffold:Pmarinus_7.0:GL484465:15708:23345:-1 ... [more]
ENSPMAT00000004899.11.099e-2926.72pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-... [more]
ENSPMAT00000009958.13.044e-2725.92pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 ... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391962.350e-1325.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328532.737e-724.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500188.929e-724.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345371.063e-625.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482374.167e-622.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pth1r1.612e-5731.38parathyroid hormone 1 receptor [Source:NCBI gene;A... [more]
pth3r2.804e-5329.88parathyroid hormone/parathyroid hormone-related pe... [more]
pth2ra1.274e-5128.80parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
vipr1a2.790e-4631.07vasoactive intestinal polypeptide receptor-like [S... [more]
vipr1a2.811e-4330.34vasoactive intestinal polypeptide receptor-like [S... [more]
back to top
BLAST of Parathyroid hormone receptor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076892.10.000e+0100.00SMESG000076892.1[more]
SMESG000047057.12.112e-7237.38SMESG000047057.1[more]
SMESG000047057.12.457e-7237.38SMESG000047057.1[more]
SMESG000047057.13.023e-7237.38SMESG000047057.1[more]
SMESG000047057.13.941e-7237.38SMESG000047057.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017522 ID=SMED30017522|Name=Parathyroid hormone receptor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1437bp
TATTAATTATGACACAGAAAAATTAGACAATTGTTTGCCATGAGATTATT
TGTGTGGATTTTGTTGACATTTATTTGGTGCCCCTTTCTACAAGGAAAGT
CAATTCGGAAATTAGAGTACAAGATCGAGCACGACAGCCAAGAAACCCTA
TTAAGAAAAGCCCAAGAAAACTGTAACTCAAAAATATCAAATTTTTCAAT
AGCGAAATTATCTCTGAACACTTCTTTCTGTCGGCCAGTTTGGGATGGAG
TAGTCTGTTGGTATGGATATTTTCAATCAGGCAAAACAGCTTCTCAACCG
TGTCCTCATTACATTGATAAATTTATTCGAAAAGGAAAAGTCTATAAACG
TTGTACAGTTAATGGAGAATGGTTTCGACGTGCAAATTCTACTAAACCAT
GGACAGACTTTGGAGAATGCAAACAATCTACTAACAAAGAACCAGCATTG
TTCTTCGTGGTCACTATCAGTAATATTGGATTTTTTATATCTATTACTTC
GGTTCTCCTAGGAATATTTATTTTGAGATTTTTCAAAAATTTGCACTGCG
ACCGGAATACAATTCACATAAACCTATTTGTCGCATGTCTGTTGAGATCT
TGTTTCAGTTTATTCTCTCAGCTTCAGACAAACAATGAAACTAACACATT
TTGCAAAGTCTTCATGTCGATGCATAATTATCTTATTATGGCAAATTTTA
CATGGGTCTTTGTGGAAGCTCTGTATTTGCATAATGTTTTAACGCTTCAC
ACTTTCAAAGAAACATCTGGTGTCGTTTTTCTTTATATTCTTGTAGGGTG
GGGTCTCCCATTAATTGCGATAATAATATGGATTATTCTAAGACTTGTCT
TCGACAATACATATTGTTGGGATGCTGGAGATAGCCAAATTACACTTGAT
ATGTGGGTGTTATTTGTTTATCCTGTTCTCCTGTTAATTCAAAATATCAT
TTTCTTCATAAAGCTCATCGTGATCCTCCATGCGAAAATGGTCACACACC
AATTGACAGCATCTCAAAATAAATTCAGGAAATTAGCAAGATCAATTTTG
GTACTAATGGTGGTATTTGGGATCTACCAGTTGATTTTTGTTCCCTTAGA
TTTAATTGAAAACATGCATAACAATAAAGTTACTTTTCAAATCAAAATGT
GTGCGGAACACTTAATAAATTCAGCACAAGGTTTTCTTTTAGCTATGATG
TTCTGCTTTTGCAATTCCGAAGTGCTGAAAGAAATCAAAAGAAAATTCGA
AAATCACAGAAACTCAAGAAGTCTTCAGACGACCGATGAAGTGAAAATTC
GAGAAAATAGCTACCGAAAACGGCGCGGAAATCGAGATTCATTAAAACAA
ACTGATCATCAAGTGACTTGCCAATTTTCAGTTTCGGAATAAATTTGGAA
TAAATGAGTCGTTTTCCAAGAACTTGCGTGCAAAATC
back to top

protein sequence of SMED30017522-orf-1

>SMED30017522-orf-1 ID=SMED30017522-orf-1|Name=SMED30017522-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=451bp
MRLFVWILLTFIWCPFLQGKSIRKLEYKIEHDSQETLLRKAQENCNSKIS
NFSIAKLSLNTSFCRPVWDGVVCWYGYFQSGKTASQPCPHYIDKFIRKGK
VYKRCTVNGEWFRRANSTKPWTDFGECKQSTNKEPALFFVVTISNIGFFI
SITSVLLGIFILRFFKNLHCDRNTIHINLFVACLLRSCFSLFSQLQTNNE
TNTFCKVFMSMHNYLIMANFTWVFVEALYLHNVLTLHTFKETSGVVFLYI
LVGWGLPLIAIIIWIILRLVFDNTYCWDAGDSQITLDMWVLFVYPVLLLI
QNIIFFIKLIVILHAKMVTHQLTASQNKFRKLARSILVLMVVFGIYQLIF
VPLDLIENMHNNKVTFQIKMCAEHLINSAQGFLLAMMFCFCNSEVLKEIK
RKFENHRNSRSLQTTDEVKIRENSYRKRRGNRDSLKQTDHQVTCQFSVSE
*
back to top
Aliases
The feature 'Parathyroid hormone receptor 1' has the following synonyms
Synonym
pthr
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004991parathyroid hormone receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
GO:0004871signal transducer activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036445GPCR_2_extracell_dom_sf
IPR000832GPCR_2_secretin-like
IPR001879GPCR_2_extracellular_dom
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 174..198
score: 28.2
coord: 370..391
score: 35.21
coord: 289..314
score: 26.27
coord: 142..166
score: 24.07
coord: 207..230
score: 39.19
coord: 246..271
score: 35.27
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 142..383
e-value: 3.4E-48
score: 164.1
IPR001879GPCR, family 2, extracellular hormone receptor domainSMARTSM00008HormR_1coord: 60..136
e-value: 2.1E-10
score: 50.6
IPR001879GPCR, family 2, extracellular hormone receptor domainPFAMPF02793HRMcoord: 62..128
e-value: 7.3E-12
score: 45.4
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 44..131
score: 15.996
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 130..426
e-value: 6.1E-64
score: 217.9
NoneNo IPR availablePANTHERPTHR45620FAMILY NOT NAMEDcoord: 35..438
NoneNo IPR availableCDDcd152727tmB1_PTH-R_relatedcoord: 143..405
e-value: 2.87898E-54
score: 180.662
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.903
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 121..411
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 211..233
NoneNo IPR availableTMHMMTMhelixcoord: 374..396
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 245..267
NoneNo IPR availableTMHMMTMhelixcoord: 332..354
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilyGENE3DG3DSA:4.10.1240.10coord: 19..129
e-value: 6.8E-23
score: 82.9
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilySUPERFAMILYSSF111418Hormone receptor domaincoord: 36..132
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 140..392
score: 34.182